Caveolin

Overview
NameCaveolin
Smed IDSMED30021874
Length (bp)758
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Caveolin (SMED30021874) t-SNE clustered cells

Violin plots show distribution of expression levels for Caveolin (SMED30021874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Caveolin (SMED30021874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Caveolin (SMED30021874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021874SMESG000052389.1 SmedASXL_069169SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021874SMESG000052389.1 dd_Smed_v4_877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021874SMESG000052389.1 dd_Smed_v4_877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021874SMESG000052389.1 dd_Smed_v6_877_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021874SMESG000052389.1 OX_Smed_1.0.03666ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021874SMESG000052389.1 dd_Smed_v6_877_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021874SMESG000052389.1 dd_Smed_v6_877_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021874SMESG000052389.1 dd_Smed_v4_877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021874SMESG000052389.1 dd_Smed_v4_877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021874SMESG000052389.1 dd_Smed_v4_877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 102.834 bits (255), Expect = 6.310e-27
Identity = 44/131 (33.59%), Postives = 71/131 (54.20%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+  +  P+ E  G      R+ + K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKE 146          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 102.834 bits (255), Expect = 6.310e-27
Identity = 44/131 (33.59%), Postives = 71/131 (54.20%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+  +  P+ E  G      R+ + K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKE 146          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 102.834 bits (255), Expect = 6.310e-27
Identity = 44/131 (33.59%), Postives = 71/131 (54.20%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+  +  P+ E  G      R+ + K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKE 146          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 102.834 bits (255), Expect = 6.310e-27
Identity = 44/131 (33.59%), Postives = 71/131 (54.20%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+  +  P+ E  G      R+ + K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKE 146          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 102.449 bits (254), Expect = 1.670e-26
Identity = 46/143 (32.17%), Postives = 75/143 (52.45%), Query Frame = 3
Query:  228 ELTTI*IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            EL+   +     K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+  +  P+ E  G      R+ + K 
Sbjct:   24 ELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKE 166          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-1 (Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94051])

HSP 1 Score: 62.7734 bits (151), Expect = 1.362e-11
Identity = 34/123 (27.64%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  270 LDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRV 638
            +DL NRD  ++N H+Q  +ED   E D   S DC+W+ +   F       Y+ +S LL L   + +   +G  A  +++   P  K+  +   L  K+    +  I  PI    GL    F +
Sbjct:  100 VDLVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVS-LLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNI 221          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 58.151 bits (139), Expect = 2.005e-10
Identity = 32/143 (22.38%), Postives = 63/143 (44.06%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHIQAEWEDNIAEP-DGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST*VLNI 671
            I  + +  +++++RDP++   ++   + +   EP +   S  C+W  SFK F+      Y+ L+ + GL IA   G  +   AF +IW   P + +  +  A    I   ++  I+ P     G      R+   +   V+ +
Sbjct:   10 IAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEV 152          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-1 (Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94051])

HSP 1 Score: 53.9138 bits (128), Expect = 3.228e-9
Identity = 29/113 (25.66%), Postives = 48/113 (42.48%), Query Frame = 3
Query:  300 INAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRV 638
            +N H+Q  +ED   E D   S DC+W+ +   F       Y+ +S LL L   + +   +G  A  +++   P  K+  +   L  K+    +  I  PI    GL    F +
Sbjct:    1 MNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVS-LLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNI 112          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 54.299 bits (129), Expect = 1.499e-8
Identity = 31/135 (22.96%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  270 LDLENRDPRNINAHIQAEWEDNIAEP-DGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST*VLNI 671
            +++++RDP++   ++   + +   EP +   S  C+W  SFK F+      Y+ L+ + GL IA   G  +   AF +IW   P + +  +  A    I   ++  I+ P     G      R+   +   V+ +
Sbjct:  139 MNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEV 273          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 53.9138 bits (128), Expect = 2.542e-8
Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  270 LDLENRDPRNINAHIQAEWEDNIAEP-DGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCV 524
            +++++RDP++   ++   + +   EP +   S  C+W  SFK F+      Y+ L+ + GL IA   G  +   AF +IW   P +
Sbjct:  177 MNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPIL 262          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav3 (caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426])

HSP 1 Score: 107.842 bits (268), Expect = 6.879e-29
Identity = 50/132 (37.88%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            K++DL NRDP+ IN  + + ++ED IAEPDG  S D +WK S+  F      CY+ LS + G+ +AL WG C+ C +FCHIW   PC+K Y++      +I    +     P+ E  G      RV + K  
Sbjct:   19 KEIDLINRDPKQINEDVVKVDFEDVIAEPDGTHSMDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPLFEALGKIFSSVRVALRKEV 150          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 102.449 bits (254), Expect = 6.053e-27
Identity = 53/141 (37.59%), Postives = 79/141 (56.03%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYI--LHCALCKKINKAYMDCIL---GPICEICGLCGGYFRVTMDK 650
            ++ +  K++DL NRDP+++N  + + ++ED IAEP G  S D +WK SF  F      CY+ L+ L+G+ +AL WG  +   +F HIW   PCVK Y+  +HC     I++ Y  C+     P+ E  G C    RVT  K
Sbjct:   11 LQDVHTKEIDLVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHC-----ISRVYSICVHTFCDPLFEAMGKCFSNVRVTATK 146          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 102.449 bits (254), Expect = 1.716e-26
Identity = 53/141 (37.59%), Postives = 79/141 (56.03%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYI--LHCALCKKINKAYMDCIL---GPICEICGLCGGYFRVTMDK 650
            ++ +  K++DL NRDP+++N  + + ++ED IAEP G  S D +WK SF  F      CY+ L+ L+G+ +AL WG  +   +F HIW   PCVK Y+  +HC     I++ Y  C+     P+ E  G C    RVT  K
Sbjct:   44 LQDVHTKEIDLVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHC-----ISRVYSICVHTFCDPLFEAMGKCFSNVRVTATK 179          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: zgc:172270 (zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67])

HSP 1 Score: 78.5666 bits (192), Expect = 1.733e-17
Identity = 34/115 (29.57%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLC 620
            +  RDPR IN  ++  +ED IAEP  V+S D +W  S   F+      Y+ ++ +L + ++L  G  +   +F HIW  TPCV++ +++    + +  + +D I+ P  +    C
Sbjct:   60 INERDPRQINECLKVSFEDVIAEPVSVRSGDRVWIWSHALFEVSRVWFYRIITAVLAVPVSLIAGIVFAVLSFIHIWFFTPCVQVVLINTGWLQTLWSSVLDIIILPFFQSVAKC 174          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: zgc:172270 (zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67])

HSP 1 Score: 78.5666 bits (192), Expect = 1.879e-17
Identity = 34/115 (29.57%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLC 620
            +  RDPR IN  ++  +ED IAEP  V+S D +W  S   F+      Y+ ++ +L + ++L  G  +   +F HIW  TPCV++ +++    + +  + +D I+ P  +    C
Sbjct:   56 INGRDPRQINECLKVSFEDVIAEPVSVRSGDRVWIWSHALFEVSRVWFYRIITAVLAVPVSLIAGIVFAVLSFIHIWFFTPCVQVVLINTGWLQTLWSSVLDIIILPFFQSVAKC 170          
BLAST of Caveolin vs. Ensembl Xenopus
Match: tmod2 (tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511])

HSP 1 Score: 99.7525 bits (247), Expect = 1.003e-25
Identity = 49/131 (37.40%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL  RDP+ IN  + Q ++ED IAEPDG  S D +WK S   F      CY+  S + GL +AL WG  + C +FCHIW   PCVK Y++      +     +     PI E  G      +V++ K 
Sbjct:   22 KEIDLVQRDPKKINQEVVQVDFEDVIAEPDGTHSFDGVWKASSTTFTVTKYWCYRVFSAIFGLPLALLWGFLFACLSFCHIWAVVPCVKSYLMEVQCLGQFYALCVRTFCDPIFEAIGKVLSGIKVSLRKE 152          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav3.1 (caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124])

HSP 1 Score: 96.6709 bits (239), Expect = 1.978e-24
Identity = 47/136 (34.56%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNIN-AHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K L  K++DL +RDP+ IN + I+ ++ED IAEP G  S D +WK S+  F      CY+ LS  +G+ +++ WG  +   +FCHIW   PC+K Y +      +I          P+ E  G      +VT+ K+
Sbjct:   19 KDLLTKEIDLVDRDPKRINDSVIKVDFEDVIAEPQGTHSFDGVWKASYTTFTVTKFWCYRILSAAIGIPLSIVWGFIFALISFCHIWAVVPCIKSYQIETHCLGRIFSLCTHTFCDPLFEALGKIFSSIKVTLQKN 154          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 95.1301 bits (235), Expect = 1.423e-23
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            + +  K++DL NRDP+++N  + + ++ED IAEPDG  S D +WK SF  F       Y+ L+ + G+ +AL WG  +   +F HIW   P ++ Y++      ++    +     P+ E  G    + ++++ K 
Sbjct:   40 RDVHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKE 175          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 95.1301 bits (235), Expect = 1.474e-23
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            + +  K++DL NRDP+++N  + + ++ED IAEPDG  S D +WK SF  F       Y+ L+ + G+ +AL WG  +   +F HIW   P ++ Y++      ++    +     P+ E  G    + ++++ K 
Sbjct:   44 RDVHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKE 179          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 95.1301 bits (235), Expect = 1.474e-23
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            + +  K++DL NRDP+++N  + + ++ED IAEPDG  S D +WK SF  F       Y+ L+ + G+ +AL WG  +   +F HIW   P ++ Y++      ++    +     P+ E  G    + ++++ K 
Sbjct:   41 RDVHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKE 176          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav3 (caveolin 3 [Source:MGI Symbol;Acc:MGI:107570])

HSP 1 Score: 104.76 bits (260), Expect = 1.064e-27
Identity = 48/100 (48.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILH 542
            IK +  K++DL NRDP+NIN  I + ++ED IAEP+G  S D +WK SF  F      CY+ LS LLG+ +AL WG  + C +FCHIW   PC+K Y++ 
Sbjct:   14 IKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE 113          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 100.138 bits (248), Expect = 5.340e-26
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS + G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+     P+ E  G      R++  K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKE 146          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 100.138 bits (248), Expect = 5.340e-26
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS + G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+     P+ E  G      R++  K 
Sbjct:   16 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKE 146          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 99.7525 bits (247), Expect = 1.783e-25
Identity = 45/143 (31.47%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  228 ELTTI*IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            E+T   +     K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS + G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+     P+ E  G      R++  K 
Sbjct:   35 EVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKE 177          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 99.7525 bits (247), Expect = 1.783e-25
Identity = 45/143 (31.47%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  228 ELTTI*IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKS 653
            E+T   +     K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS + G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+     P+ E  G      R++  K 
Sbjct:   35 EVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKE 177          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|P51637|CAV3_MOUSE (Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.445e-27
Identity = 48/100 (48.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILH 542
            IK +  K++DL NRDP+NIN  I + ++ED IAEP+G  S D +WK SF  F      CY+ LS LLG+ +AL WG  + C +FCHIW   PC+K Y++ 
Sbjct:   14 IKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE 113          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|Q3ZDQ5|CAV3_PIG (Caveolin-3 OS=Sus scrofa OX=9823 GN=CAV3 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.216e-26
Identity = 46/100 (46.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILH 542
            +K +  K++DL NRDP+NIN  I + ++ED IAEP G  S D +WK S+  F      CY+ LS LLG+ +AL WG  + C +FCHIW   PC+K Y++ 
Sbjct:   14 VKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE 113          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|Q2KI43|CAV3_BOVIN (Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.457e-26
Identity = 46/100 (46.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILH 542
            +K +  K++DL NRDP+NIN  I + ++ED IAEP G  S D +WK S+  F      CY+ LS LLG+ +AL WG  + C +FCHIW   PC+K Y++ 
Sbjct:   14 VKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE 113          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|P33724|CAV1_CANLF (Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.795e-26
Identity = 46/132 (34.85%), Postives = 70/132 (53.03%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            K++DL NRDP+++N  + + ++ED IAEP+G  S D +WK SF  F       Y+ LS L G+ +AL WG  +   +F HIW   PC+K +++      ++   Y+     P  E  G      R+ M K T
Sbjct:   47 KEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET 178          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|P51638|CAV3_RAT (Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.958e-26
Identity = 46/100 (46.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILH 542
            IK +  K++DL NRDP+NIN  I + ++ED IAEP+G  S D +W+ S+  F      CY+ LS LLG+ +AL WG  + C +FCHIW   PC+K Y++ 
Sbjct:   14 IKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE 113          
BLAST of Caveolin vs. TrEMBL
Match: A0A1I8HL38 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.018e-37
Identity = 60/131 (45.80%), Postives = 88/131 (67.18%), Query Frame = 3
Query:  249 KTLK-MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRV 638
            KT K +KDLD+  RDP+++N H+Q E++D +AEP+G  S +C+W+CS++C++C  NC Y+ L+ L G CIA  WGC +   AFCH+WCCTP +K YI+   + +++N A  D  LG  C  CG C    R+
Sbjct:  490 KTKKSVKDLDMNRRDPQDVNIHLQVEFDDILAEPEGAYSINCVWRCSYRCYECWKNCWYRTLTLLCGCCIAAMWGCHFAELAFCHVWCCTPYLKSYIMDIKIIREMNAACYDACLGTCCSACGNCFSRIRL 620          
BLAST of Caveolin vs. TrEMBL
Match: A0A210PEX1 (Caveolin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11365 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.027e-36
Identity = 58/126 (46.03%), Postives = 84/126 (66.67%), Query Frame = 3
Query:  264 KDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVT 641
            K++DLE+RDP ++N H+Q  +ED + EPD   S DC+WK S+ CF CG NCCY+F+S L G+CIALYWGC +    F  +WCCTP +K++ +   +C++   + + C L P+CE  GLC     +T
Sbjct:    6 KEVDLESRDPNSLNGHVQVAFEDVLGEPDTTHSIDCVWKNSYSCFNCGKNCCYKFMSTLCGICIALYWGCEFAMITFQMVWCCTPSLKVHTIMLGICQRFFGSCIQCCLAPLCETMGLCFSNITIT 131          
BLAST of Caveolin vs. TrEMBL
Match: A0A210PEW9 (Caveolin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11361 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 8.962e-35
Identity = 57/119 (47.90%), Postives = 85/119 (71.43%), Query Frame = 3
Query:  261 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGL 617
            M ++DL NRDP +IN++++  +ED +AEPDG  SCDC+WK S+ CF CG NC Y++++ L G+CIAL WGC + C AF  IWC TP ++++ ++C  C+K     ++C + P+CE CGL
Sbjct:    1 MMEVDLGNRDPNDINSNVKVSFEDVLAEPDGAHSCDCVWKLSYCCFNCGKNCAYRWMTFLCGMCIALSWGCEFACIAFDQIWCVTPTLRIFSIYCGSCQKFFSIVINCCMAPVCETCGL 119          
BLAST of Caveolin vs. TrEMBL
Match: A0A267F6W6 (Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034428g1 PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.588e-33
Identity = 58/129 (44.96%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  255 LKMKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVT 641
            +   DLD+ENRDP ++N H+  ++ED + EPDG+ S DC+W+ S+ CF CG NC Y+  +   G+ IALYWGC +   A  HIWC TP  K++ ++ A  ++ +K+ +DC LGP CE CGL     R+T
Sbjct:    1 MTSTDLDMENRDPNSLNGHLSTKFEDVLGEPDGIHSMDCVWRNSYSCFNCGKNCLYKVCTLFCGIFIALYWGCVFAWVAMEHIWCITPSFKVWEINMACMRRYSKSIVDCCLGPCCETCGLFLSKMRLT 129          
BLAST of Caveolin vs. TrEMBL
Match: A0A267F2S4 (Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001154g1 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.687e-33
Identity = 58/134 (43.28%), Postives = 89/134 (66.42%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMD 647
            + + + K+LD++ RDP+++N H+Q E++D +AEP+G  S DC+W+CS++C++C  NC Y+ L+ L G CIA  WGC +   AFCH+WCCTP +K YI++  + ++IN A  D  LG  C  CG      RV  +
Sbjct:    1 MSSKEKKNLDMDRRDPQDVNIHLQVEFDDVLAEPEGAHSIDCIWRCSYRCYECWKNCWYRTLTLLCGCCIAAMWGCHFAEMAFCHVWCCTPHLKSYIMNIKIVREINTACYDACLGTCCSACGNFLSRVRVQQN 134          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:103034163])

HSP 1 Score: 108.227 bits (269), Expect = 3.345e-29
Identity = 51/138 (36.96%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            +K    K++DL NRDP+ IN  + + ++ED IAEPDG  S D +WK S+  F      CY+ LS + G+ +AL WG C+ C +FCHIW   PC+K Y++      +I    +     P  E  G      RV + K  
Sbjct:   13 LKDRHAKEIDLINRDPKQINEDVVKVDFEDVIAEPDGTHSLDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPFFEALGKVFSSVRVALRKEV 150          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:103028370])

HSP 1 Score: 99.7525 bits (247), Expect = 1.192e-25
Identity = 49/141 (34.75%), Postives = 79/141 (56.03%), Query Frame = 3
Query:  246 IKTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYI--LHCALCKKINKAYMDCIL---GPICEICGLCGGYFRVTMDK 650
            ++ +  K++DL NRDP+++N H+ + ++ED IAEP G  S D +WK S+  F       Y+ L+ L+G+ +AL WG  +   +F HIW   PC+K Y+  +HC     +++ Y  C+     P+ E  G C    R+T  K
Sbjct:   43 MQDVHTKEIDLVNRDPKHLNDHVVKVDFEDVIAEPAGTYSFDGVWKASYTTFTVTKYWFYRLLTALVGIPLALIWGIFFAILSFLHIWAVVPCLKSYLIEIHC-----VSQVYSICVHTFCDPLFEAVGKCFSSVRITTTK 178          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav2 (caveolin 2 [Source:NCBI gene;Acc:103028678])

HSP 1 Score: 79.337 bits (194), Expect = 5.757e-18
Identity = 37/112 (33.04%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  279 ENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICG 614
             +RDPR+INAH++ E+ED IAEP    S D +W  S   F+      Y+ L+ LL + +A   G  +G  +  HIW   P V   ++     + +  + MD   GP     G
Sbjct:   40 RDRDPRDINAHLKVEFEDIIAEPSSTHSFDSVWIWSHAVFELLKYIFYRLLTTLLAIPMAFVAGIVFGLLSCVHIWVVMPLVHSCMMALPSVQVVWASLMDMFTGPFFHSFG 151          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:172270 (caveolin-2-like [Source:NCBI gene;Acc:103029205])

HSP 1 Score: 77.411 bits (189), Expect = 3.598e-17
Identity = 37/125 (29.60%), Postives = 66/125 (52.80%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDK 650
            +  RDPR IN  ++  +ED IAEP  V+S D +W  S   F+      Y+ ++ LL + +++  G  +   +  HIW  TPCVKM +++    + +  + +D I+ P  +    C G F + +++
Sbjct:   56 INERDPRQINECLKVSFEDVIAEPMTVRSGDRVWIWSNALFEVSRVWFYRIITVLLAVPVSIIAGILFAILSCLHIWLFTPCVKMVLINTGWLETLWSSILDIIILPFYQSVAKCCGGFSIQLNR 180          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:103043623])

HSP 1 Score: 59.6918 bits (143), Expect = 8.812e-11
Identity = 34/126 (26.98%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCAL--CKKINKAYMDCILGPICEICGLC 620
             ++       E+RDP  +N H++ ++ D +AEP   +S D +W  S   F+      Y+ L+ +  + ++   GC +   A  HIWC  PCV+  + H  L   + +  + ++  L P+CE    C
Sbjct:   39 SSISQASFTNESRDPYGVNNHLKVDFSDVLAEPASTRSYDRVWVYSGIGFESARIWSYRCLTAVCAVPVSCLSGCLFALLACLHIWCVMPCVQ--VCHTCLPCVRSLWMSLVNIFLMPLCESAARC 162          
BLAST of Caveolin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007616.1 (pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:ENSPMAG00000006881.1 transcript:ENSPMAT00000007616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.111e-13
Identity = 34/108 (31.48%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  315 QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRV 638
            Q  +ED  A P+G  S   +W+C+F+ +      CY  LS L  + ++  WGC + C  F H+W  TPC++M  ++    +      + C+  P+CE C LC  + R+
Sbjct:    1 QVLFEDVFAYPEGSHSIPGVWRCAFRTYNGTKWFCYLLLSVLCAVPLSCCWGCDFACAQFYHVW-VTPCLRMCRMNMLCLQMFWSTIVRCVCEPLCETCALCFSHIRI 107          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO33339 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5])

HSP 1 Score: 93.5893 bits (231), Expect = 4.072e-24
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            +E+RDP NIN H++  ++D  AEP+G  S D +W+ SF  F     CCY+ L+ + G+  A+  GC + C +F +IWC  PC++ Y++      KI    +     P  E  G      R    K+T
Sbjct:    1 MEDRDPSNINDHVKVFYQDVFAEPEGNHSIDGVWRASFSTFVNTKYCCYRLLTAIFGVPTAILCGCYFACLSFDYIWCIMPCLRAYVIQLQFLGKIFSLLIKTFCDPFFESFGRVFSGIRHVKIKTT 127          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO41786 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1])

HSP 1 Score: 63.929 bits (154), Expect = 2.918e-13
Identity = 28/84 (33.33%), Postives = 48/84 (57.14%), Query Frame = 3
Query:  312 IQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKI 563
            +Q  ++D  AEP+G  S D +W+ S+K F      CY+ ++ + G+  A+  GC + C +F +IWC  PC++ Y++      KI
Sbjct:    2 LQVFFQDVFAEPEGTHSIDGVWRTSYKTFVATKYWCYRIITAIFGIPTAILCGCYFACLSFDYIWCVMPCLRGYLIELQCLGKI 85          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:101171655])

HSP 1 Score: 105.145 bits (261), Expect = 5.398e-28
Identity = 50/137 (36.50%), Postives = 70/137 (51.09%), Query Frame = 3
Query:  249 KTLKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            K    K++DL NRDP+ IN  + + E+ED IAEPDG  S D +WK S+  F      CY+ LS + G+ +AL WG  + C +FCHIW   PC+K  ++      +I    +     P  E  G      RV + K  
Sbjct:   16 KDSHTKEIDLINRDPKQINEDVVKVEFEDVIAEPDGTHSLDGVWKLSYTTFTVSKYWCYRILSAIFGIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCISRIYTLCIQTFFDPFFEAVGKIFSSVRVALRKEV 152          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:101162818])

HSP 1 Score: 98.2117 bits (243), Expect = 6.385e-25
Identity = 50/139 (35.97%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  255 LKMKDLDLENRDPRNINAHI-QAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYI--LHCALCKKINKAYMDCIL---GPICEICGLCGGYFRVTMDKS 653
            +  K++DL NRDP+ IN  + + ++ED IAEP G  S D +WK SF  F      CY+ L+ ++G+ +AL WG  +   +F HIW   PCVK Y+  +HC     +++ Y  C+     P+ E  G C    R+   K 
Sbjct:   47 VHTKEIDLVNRDPKQINDDVVKVDFEDIIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTAVVGIPLALIWGIFFAILSFLHIWAVVPCVKSYLIEIHC-----LSRVYSICVHTFCDPLFEAMGRCFSSIRIRTTKE 180          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav2 (caveolin-2 [Source:NCBI gene;Acc:110014685])

HSP 1 Score: 77.411 bits (189), Expect = 7.235e-17
Identity = 34/112 (30.36%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  279 ENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICG 614
            ++RDP +INAH++  +ED IAEP    S D +W  S   F+     CY+ LS LL + +A   G  +G  +  HIW   P ++ ++        + +  M   + P+    G
Sbjct:   94 DDRDPNDINAHVKVAFEDVIAEPVSTHSFDTVWVGSHAAFELVKFLCYRLLSTLLAVPVAFVLGLMFGVLSCLHIWLVGPVIRGFLTFLPPALTVWRKLMVLFVAPLSHSMG 205          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:172270 (caveolin-2 [Source:NCBI gene;Acc:101164882])

HSP 1 Score: 60.4622 bits (145), Expect = 1.237e-10
Identity = 31/121 (25.62%), Postives = 57/121 (47.11%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRV 638
            ++ RDPR IN  ++  +ED IAEP  V+S D +W  S   F+      Y+ L+ +L + +++  G  +   +  H+W   PCV+  ++     + +    +   + P       C G F +
Sbjct:  112 IKTRDPRGINDCLKVTFEDVIAEPVSVRSGDRVWIWSNALFEVSRVWLYRILTVVLAIPMSVLSGVLFAIFSCFHVWMVGPCVEYVLIGTRWLQSLWNVVLGVFVLPFSRTAKRCCGGFSI 232          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:101156574])

HSP 1 Score: 56.225 bits (134), Expect = 2.221e-9
Identity = 31/123 (25.20%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  282 NRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDK 650
            +RDP+ IN H++ E  D ++EP    S   +W  S   F+      Y+ L+ LL + +A   G      A   +W   PC+++  L     + +    +D ++ P C    LC     +T+ +
Sbjct:   57 SRDPKGINKHLKVEVSDVLSEPTAPHSTAAVWTVSVCGFERTRVWTYRCLTLLLAVPMAFVCGLSVAVLASLRVWFLVPCIQLSSLFIPCLRSLCLCAVDVVVSPFCVSLALCCSQIIITLTR 179          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000052389.1 (SMESG000052389.1)

HSP 1 Score: 264.233 bits (674), Expect = 8.758e-91
Identity = 129/132 (97.73%), Postives = 130/132 (98.48%), Query Frame = 3
Query:  261 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDKST 656
            MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCA CKKINKAYMDCI GPICEICGLCGG+FRVTMDKST
Sbjct:    1 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCAFCKKINKAYMDCIYGPICEICGLCGGHFRVTMDKST 132          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000047637.1 (SMESG000047637.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.056e-38
Identity = 63/133 (47.37%), Postives = 88/133 (66.17%), Query Frame = 3
Query:  255 LKMK-DLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEICGLCGGYFRVTMDK 650
            +K+K D+DLENRDP+ IN H+   +ED+ AEPD VKSCDCLW  ++  +QC L CCY+ LSGL G+ IAL WG CY C AF +IWCC PC     +  ++ +     ++ C   P  + CGLC G++ VT+++
Sbjct:    1 MKIKTDIDLENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 133          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063381.1 (SMESG000063381.1)

HSP 1 Score: 129.413 bits (324), Expect = 9.958e-38
Identity = 68/132 (51.52%), Postives = 87/132 (65.91%), Query Frame = 3
Query:  261 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILG----PICEICGLCGGYFRVTM 644
            M DLDLENRDPRNIN H++  +ED +AEP+G  S DC+W+ S+ C++ G+ CCY+FL+ L GLC+AL WGC + C AF +IW  TP  K+Y LHCA    I K+ MD I G    P C  CG C    +VT 
Sbjct:    1 MADLDLENRDPRNINNHLKVTFEDILAEPEGAHSIDCVWRTSYCCYKFGIGCCYKFLTTLCGLCLALCWGCVFACVAFEYIWFLTPICKVYGLHCA----IFKSLMDSITGICCEPCCRACGACFSNIQVTQ 128          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 125.946 bits (315), Expect = 2.387e-36
Identity = 65/135 (48.15%), Postives = 87/135 (64.44%), Query Frame = 3
Query:  261 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEIC----GLCGGYFRVTMDKS 653
            M + D++NRD  NIN+H++  +E+ +AEP+G  S DC+WK S+KCFQ  L CCY+F + L GLCIAL WGC + C AF HIWCC+P  K+Y LHC+ C    +A +D I G  CE C    G C    +VT   +
Sbjct:    1 MTEFDMDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSC----RALIDSICGVCCEPCYRAMGACCSNIQVTQKSA 131          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 119.783 bits (299), Expect = 5.055e-34
Identity = 63/130 (48.46%), Postives = 84/130 (64.62%), Query Frame = 3
Query:  276 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKKINKAYMDCILGPICEIC----GLCGGYFRVTMDKS 653
            ++NRD  NIN+H++  +E+ +AEP+G  S DC+WK S+KCFQ  L CCY+F + L GLCIAL WGC + C AF HIWCC+P  K+Y LHC+ C    +A +D I G  CE C    G C    +VT   +
Sbjct:    1 MDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSC----RALIDSICGVCCEPCYRAMGACCSNIQVTQKSA 126          
The following BLAST results are available for this feature:
BLAST of Caveolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAV16.310e-2733.59caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV16.310e-2733.59caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV16.310e-2733.59caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV16.310e-2733.59caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV11.670e-2632.17caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
back to top
BLAST of Caveolin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav-11.362e-1127.64Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9405... [more]
cav-22.005e-1022.38Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-13.228e-925.66Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9405... [more]
cav-21.499e-822.96Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-22.542e-827.91Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
back to top
BLAST of Caveolin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav36.879e-2937.88caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426][more]
cav16.053e-2737.59caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
cav11.716e-2637.59caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
zgc:1722701.733e-1729.57zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67][more]
zgc:1722701.879e-1729.57zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67][more]
back to top
BLAST of Caveolin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmod21.003e-2537.40tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511][more]
cav3.11.978e-2434.56caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124... [more]
cav11.423e-2329.41caveolin 1 [Source:NCBI gene;Acc:548467][more]
cav11.474e-2329.41caveolin 1 [Source:NCBI gene;Acc:548467][more]
cav11.474e-2329.41caveolin 1 [Source:NCBI gene;Acc:548467][more]
back to top
BLAST of Caveolin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cav31.064e-2748.00caveolin 3 [Source:MGI Symbol;Acc:MGI:107570][more]
Cav15.340e-2632.82caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav15.340e-2632.82caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.783e-2531.47caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.783e-2531.47caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Caveolin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51637|CAV3_MOUSE7.445e-2748.00Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 S... [more]
sp|Q3ZDQ5|CAV3_PIG1.216e-2646.00Caveolin-3 OS=Sus scrofa OX=9823 GN=CAV3 PE=2 SV=1[more]
sp|Q2KI43|CAV3_BOVIN1.457e-2646.00Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1[more]
sp|P33724|CAV1_CANLF1.795e-2634.85Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CA... [more]
sp|P51638|CAV3_RAT4.958e-2646.00Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 P... [more]
back to top
BLAST of Caveolin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HL384.018e-3745.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PEX19.027e-3646.03Caveolin OS=Mizuhopecten yessoensis OX=6573 GN=KP7... [more]
A0A210PEW98.962e-3547.90Caveolin OS=Mizuhopecten yessoensis OX=6573 GN=KP7... [more]
A0A267F6W61.588e-3344.96Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
A0A267F2S42.687e-3343.28Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
back to top
BLAST of Caveolin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav33.345e-2936.96caveolin 3 [Source:NCBI gene;Acc:103034163][more]
cav11.192e-2534.75caveolin-1 [Source:NCBI gene;Acc:103028370][more]
cav25.757e-1833.04caveolin 2 [Source:NCBI gene;Acc:103028678][more]
zgc:1722703.598e-1729.60caveolin-2-like [Source:NCBI gene;Acc:103029205][more]
zgc:1582968.812e-1126.98caveolin-2-like [Source:NCBI gene;Acc:103043623][more]
back to top
BLAST of Caveolin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007616.13.111e-1331.48pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:E... [more]
back to top
BLAST of Caveolin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO333394.072e-2433.86Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5][more]
EDO417862.918e-1333.33Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1][more]
back to top
BLAST of Caveolin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav35.398e-2836.50caveolin 3 [Source:NCBI gene;Acc:101171655][more]
cav16.385e-2535.97caveolin-1 [Source:NCBI gene;Acc:101162818][more]
cav27.235e-1730.36caveolin-2 [Source:NCBI gene;Acc:110014685][more]
zgc:1722701.237e-1025.62caveolin-2 [Source:NCBI gene;Acc:101164882][more]
zgc:1582962.221e-925.20caveolin-2-like [Source:NCBI gene;Acc:101156574][more]
back to top
BLAST of Caveolin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052389.18.758e-9197.73SMESG000052389.1[more]
SMESG000047637.11.056e-3847.37SMESG000047637.1[more]
SMESG000063381.19.958e-3851.52SMESG000063381.1[more]
SMESG000063380.12.387e-3648.15SMESG000063380.1[more]
SMESG000063380.15.055e-3448.46SMESG000063380.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021874 ID=SMED30021874|Name=Caveolin|organism=Schmidtea mediterranea sexual|type=transcript|length=758bp
AGCAAAGATCCTGCAAAGGTGCAGTTAATGAATAGATAGATGCATATTTG
GAATGAGCTCTATTCAATGATAACCAATTAAGTCCATCAGTTTGCAACGC
ATTTCAATGTATTAGAAATATGATGAACTAGATGGTTATCCGTTGTCATG
GCTACTCGGAATCGCAAATCTCTGCAAAGTCTATTATTGCACACCAATGC
TAACGCGGACTCTATAAAATATGTGTTGAGCTGACAACGATATAAATCAA
AACTTTAAAAATGAAAGATCTAGATTTGGAAAACAGAGATCCAAGAAATA
TTAATGCACACATTCAGGCAGAATGGGAGGATAACATCGCTGAGCCCGAT
GGGGTGAAATCGTGCGACTGTTTGTGGAAATGTTCTTTCAAATGTTTTCA
ATGCGGTCTGAATTGTTGCTATCAGTTTCTCAGTGGTCTTCTGGGGTTAT
GCATTGCACTTTATTGGGGATGTTGTTACGGATGCACTGCTTTTTGTCAT
ATTTGGTGCTGTACGCCTTGCGTCAAAATGTATATACTTCATTGTGCGTT
ATGCAAGAAAATAAATAAAGCTTACATGGATTGCATCCTTGGTCCCATAT
GTGAGATTTGTGGTCTATGCGGAGGTTATTTCCGAGTAACAATGGATAAA
TCCACCTGAGTGTTAAATATATTTGGATAGAAACGTGGCACAACTATATT
ACCATGTAATATGTCTGATTTGTTAAAAAATAAAAATATTTGTTGTTTTA
AAAAAAAA
back to top

protein sequence of SMED30021874-orf-1

>SMED30021874-orf-1 ID=SMED30021874-orf-1|Name=SMED30021874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGL
NCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCALCKK
INKAYMDCILGPICEICGLCGGYFRVTMDKST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001612Caveolin
Vocabulary: biological process
TermDefinition
GO:0070836caveola assembly
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001612CaveolinPFAMPF01146Caveolincoord: 3..128
e-value: 2.2E-33
score: 115.0
IPR001612CaveolinPANTHERPTHR10844CAVEOLINcoord: 2..131
NoneNo IPR availableTMHMMTMhelixcoord: 59..81