Potassium voltage-gated channel protein Shaw

Overview
NamePotassium voltage-gated channel protein Shaw
Smed IDSMED30021870
Length (bp)1879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel protein Shaw (SMED30021870) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein Shaw (SMED30021870) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel protein Shaw (SMED30021870) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein Shaw (SMED30021870) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021870

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021870h1SMcG0004284 SmedASXL_016536SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021870h1SMcG0004284 SmedASXL_053571SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021870h1SMcG0004284 SmedASXL_062559SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021870h1SMcG0004284 dd_Smed_v4_14595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021870h1SMcG0004284 dd_Smed_v4_14595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021870h1SMcG0004284 dd_Smed_v6_14595_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021870h1SMcG0004284 OX_Smed_1.0.17420ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 340.117 bits (871), Expect = 8.811e-109
Identity = 207/508 (40.75%), Postives = 290/508 (57.09%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEA---------------------------------------------------LANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP---EDLYRKFGILEDDMNLSW-------WQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQI---QNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            ++  RV+LNVGG RHETY++TLK +P TRL+ L  +                                                    +++     E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL  I   P   EDL  K   +ED   L         W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F I   +   ++N T       + Y     P    A  Y++ VC V+FTFE L+R+  +     FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 ENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDL--IGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGT----SVVLQYEIETDP----ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 339.732 bits (870), Expect = 2.390e-108
Identity = 207/508 (40.75%), Postives = 290/508 (57.09%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEA---------------------------------------------------LANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP---EDLYRKFGILEDDMNLSW-------WQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQI---QNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            ++  RV+LNVGG RHETY++TLK +P TRL+ L  +                                                    +++     E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL  I   P   EDL  K   +ED   L         W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F I   +   ++N T       + Y     P    A  Y++ VC V+FTFE L+R+  +     FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 ENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDL--IGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGT----SVVLQYEIETDP----ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 340.502 bits (872), Expect = 3.235e-108
Identity = 207/508 (40.75%), Postives = 290/508 (57.09%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEA---------------------------------------------------LANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP---EDLYRKFGILEDDMNLSW-------WQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQI---QNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            ++  RV+LNVGG RHETY++TLK +P TRL+ L  +                                                    +++     E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL  I   P   EDL  K   +ED   L         W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F I   +   ++N T       + Y     P    A  Y++ VC V+FTFE L+R+  +     FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 ENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDL--IGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGT----SVVLQYEIETDP----ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 337.035 bits (863), Expect = 3.535e-108
Identity = 202/463 (43.63%), Postives = 281/463 (60.69%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A      AF+ YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAET---EAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 339.732 bits (870), Expect = 5.147e-108
Identity = 207/508 (40.75%), Postives = 290/508 (57.09%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEA---------------------------------------------------LANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP---EDLYRKFGILEDDMNLSW-------WQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQI---QNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            ++  RV+LNVGG RHETY++TLK +P TRL+ L  +                                                    +++     E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL  I   P   EDL  K   +ED   L         W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F I   +   ++N T       + Y     P    A  Y++ VC V+FTFE L+R+  +     FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 ENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDL--IGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGT----SVVLQYEIETDP----ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 484.567 bits (1246), Expect = 1.711e-164
Identity = 254/446 (56.95%), Postives = 342/446 (76.68%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNI----SLVNATFTPNETTVN--YFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRP 1462
            D+E+RV+LNVGGIRHETY   LKKIPATRLSRLT  LANYDP LNEYFFDRHP VFS ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR T+DTL ++++LDLD      E++ +KFG  EDD    N+S WQR +P++W L +E +SS+ ++VI+  +I F+++SI+ FCLK+ P F+I +I    ++ N +   N   +N  Y    A  AH +F Y++ + N++F+ E L R+     ++ F+++P+N+ID  A +SFY++++   ++   N ++V +FFS+IR++R+FKLT++ +GLKIL+ TFKASA+EL LLVFF+++ IVIFAALVYYAER   N EN+F SI +GLWWA+IT+ T+GFGD VP T+ G L+G++CA+ GVLT++LPVPVIVSNF+MFYSH QARSKLPK+RRRVL    I+P
Sbjct:   98 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFG-WEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISVVNIIFVIISIVCFCLKTHPSFRIPDIDISTTMGNFSAPLNGVQMNNIYVGKTATRAHPSFFYVELLSNIWFSGEFLTRMVFCPNVATFLRTPVNLIDFIATVSFYIDWALDRTLSGSNRDSV-EFFSIIRILRLFKLTQHSTGLKILIQTFKASAQELFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLGRLVGSVCALMGVLTIALPVPVIVSNFAMFYSHAQARSKLPKKRRRVLQPHEIKP 541          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 479.559 bits (1233), Expect = 2.386e-164
Identity = 261/474 (55.06%), Postives = 340/474 (71.73%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTV-NYFTSAA---PIA--HRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTP 1546
            D+E+RV+LNVGGIRHETY   LKKIPATRLSRLT  LANYDP LNEYFFDRHP VFS ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR T+DTL ++++LDLD      E++ +KFG  EDD    N+S WQR +P++W L +E +SS+ ++VI+  S+ FI+ S  SF LK+ P FQI +I +  +    +E    NY  +     P+   H  F Y+D +CN++FT ELLIR         F++SPL IID+ +  +F+ E   +  +    +     F S+I ++R+FKLT++ SGLKIL+ TFKASA+EL LLVFF+I+ IVIFAALVYYAER   N +N+F SI +GLWW+++T++TVGFGD VP T  GML+G+LCA+ GVLT++LPVPVIVSNFS  YSH+QAR+KLPK+RRRVL    ++P     KQ +G  +    +K+ S T+N P
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFG-WEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGVKQHHGKHR----KKSSSATFNQP 470          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 479.559 bits (1233), Expect = 2.386e-164
Identity = 261/474 (55.06%), Postives = 340/474 (71.73%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTV-NYFTSAA---PIA--HRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTP 1546
            D+E+RV+LNVGGIRHETY   LKKIPATRLSRLT  LANYDP LNEYFFDRHP VFS ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR T+DTL ++++LDLD      E++ +KFG  EDD    N+S WQR +P++W L +E +SS+ ++VI+  S+ FI+ S  SF LK+ P FQI +I +  +    +E    NY  +     P+   H  F Y+D +CN++FT ELLIR         F++SPL IID+ +  +F+ E   +  +    +     F S+I ++R+FKLT++ SGLKIL+ TFKASA+EL LLVFF+I+ IVIFAALVYYAER   N +N+F SI +GLWW+++T++TVGFGD VP T  GML+G+LCA+ GVLT++LPVPVIVSNFS  YSH+QAR+KLPK+RRRVL    ++P     KQ +G  +    +K+ S T+N P
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFG-WEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGVKQHHGKHR----KKSSSATFNQP 470          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 479.559 bits (1233), Expect = 3.406e-164
Identity = 261/474 (55.06%), Postives = 340/474 (71.73%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTV-NYFTSAA---PIA--HRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTP 1546
            D+E+RV+LNVGGIRHETY   LKKIPATRLSRLT  LANYDP LNEYFFDRHP VFS ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR T+DTL ++++LDLD      E++ +KFG  EDD    N+S WQR +P++W L +E +SS+ ++VI+  S+ FI+ S  SF LK+ P FQI +I +  +    +E    NY  +     P+   H  F Y+D +CN++FT ELLIR         F++SPL IID+ +  +F+ E   +  +    +     F S+I ++R+FKLT++ SGLKIL+ TFKASA+EL LLVFF+I+ IVIFAALVYYAER   N +N+F SI +GLWW+++T++TVGFGD VP T  GML+G+LCA+ GVLT++LPVPVIVSNFS  YSH+QAR+KLPK+RRRVL    ++P     KQ +G  +    +K+ S T+N P
Sbjct:   19 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFG-WEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGVKQHHGKHR----KKSSSATFNQP 487          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 479.559 bits (1233), Expect = 3.530e-164
Identity = 261/474 (55.06%), Postives = 340/474 (71.73%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTV-NYFTSAA---PIA--HRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTP 1546
            D+E+RV+LNVGGIRHETY   LKKIPATRLSRLT  LANYDP LNEYFFDRHP VFS ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR T+DTL ++++LDLD      E++ +KFG  EDD    N+S WQR +P++W L +E +SS+ ++VI+  S+ FI+ S  SF LK+ P FQI +I +  +    +E    NY  +     P+   H  F Y+D +CN++FT ELLIR         F++SPL IID+ +  +F+ E   +  +    +     F S+I ++R+FKLT++ SGLKIL+ TFKASA+EL LLVFF+I+ IVIFAALVYYAER   N +N+F SI +GLWW+++T++TVGFGD VP T  GML+G+LCA+ GVLT++LPVPVIVSNFS  YSH+QAR+KLPK+RRRVL    ++P     KQ +G  +    +K+ S T+N P
Sbjct:   12 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFG-WEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGVKQHHGKHR----KKSSSATFNQP 480          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 280/452 (61.95%), Postives = 343/452 (75.88%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQ---IQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNG 1492
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  +   ++NI++  A    N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R    PG  P G
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTA----NGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGA-PGG 453          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 280/452 (61.95%), Postives = 343/452 (75.88%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQ---IQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNG 1492
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  +   ++NI++  A    N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R    PG  P G
Sbjct:   22 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTA----NGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGA-PGG 468          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 286/491 (58.25%), Postives = 354/491 (72.10%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQ---IQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIR----------------PKTKPGKQPNGSQKL-PKVEKTESKTYNTPKRSP 1558
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  +   ++NI++  A    N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R                P + P   P GS    P+    ++K   +PK  P
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTA----NGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVSGCGTPGSGPHSGPMGSGGTGPRRMNNKTKDLVSPKSGP 493          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 286/498 (57.43%), Postives = 354/498 (71.08%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIR----------------PKTKPGKQPNGSQKL-PKVEKTESKTYNTPKRSPSTIDTSKPSE 1588
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  ++  +  +    T N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R                P + P   P GS    P+    ++K   +PK    T    KP +
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVK-TANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVSGCGTPGSGPHSGPMGSGGTGPRRMNNKTKDLVSPKSDEYTTMIGKPRD 503          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 278/449 (61.92%), Postives = 340/449 (75.72%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNG 1492
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  ++  +  +    T N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R    PG  P G
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVK-TANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGA-PGG 453          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 340.502 bits (872), Expect = 3.386e-109
Identity = 200/452 (44.25%), Postives = 278/452 (61.50%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED----DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTP--NETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   RV+LNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L + +     ++ ++ +D Y K   +ED    D  +S W+R +P +W L ++ YSSRA++ I   S+ FI+VSI +FCL++   F     +++N T  P  NET  +           A  Y++ VC ++FTFE L+R+  +     FI+S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P +        F +I IG WWA++TMTT+G+GD  P T SGM++GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFEM----NVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFN----TIINKT-DPLRNETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 340.117 bits (871), Expect = 1.507e-108
Identity = 200/452 (44.25%), Postives = 278/452 (61.50%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED----DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTP--NETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   RV+LNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L + +     ++ ++ +D Y K   +ED    D  +S W+R +P +W L ++ YSSRA++ I   S+ FI+VSI +FCL++   F     +++N T  P  NET  +           A  Y++ VC ++FTFE L+R+  +     FI+S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P +        F +I IG WWA++TMTT+G+GD  P T SGM++GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFEM----NVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFN----TIINKT-DPLRNETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 337.806 bits (865), Expect = 9.013e-108
Identity = 190/439 (43.28%), Postives = 278/439 (63.33%), Query Frame = 2
Query:  149 CDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALN--------EYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED-DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPG-FQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            C+  +++++NVGG RHETY++TL+ IP +RL+ L +  +  +P  +        E+FFDRHP +F+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  D +      +D+ R+FGI +  D +    +  +PK+W L E+ YSSRA++VI   S+ FI+VSI +FCL++    F+  N +  +     N TT+       P+       ++ +C V+FTFE L+R+        FI++ LNIID  A++ FYLE S   +      + V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER +++P++        F +I IG WWA++TMTT+G+GD VP T  GM++GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   32 CEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDD-QDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHT--DTKSATNSTTIIQVMDTKPV----LTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKD-VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 338.191 bits (866), Expect = 1.061e-107
Identity = 190/439 (43.28%), Postives = 278/439 (63.33%), Query Frame = 2
Query:  149 CDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALN--------EYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED-DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPG-FQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            C+  +++++NVGG RHETY++TL+ IP +RL+ L +  +  +P  +        E+FFDRHP +F+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  D +      +D+ R+FGI +  D +    +  +PK+W L E+ YSSRA++VI   S+ FI+VSI +FCL++    F+  N +  +     N TT+       P+       ++ +C V+FTFE L+R+        FI++ LNIID  A++ FYLE S   +      + V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER +++P++        F +I IG WWA++TMTT+G+GD VP T  GM++GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   32 CEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDD-QDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHT--DTKSATNSTTIIQVMDTKPV----LTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKD-VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 338.191 bits (866), Expect = 1.061e-107
Identity = 190/439 (43.28%), Postives = 278/439 (63.33%), Query Frame = 2
Query:  149 CDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALN--------EYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED-DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPG-FQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            C+  +++++NVGG RHETY++TL+ IP +RL+ L +  +  +P  +        E+FFDRHP +F+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  D +      +D+ R+FGI +  D +    +  +PK+W L E+ YSSRA++VI   S+ FI+VSI +FCL++    F+  N +  +     N TT+       P+       ++ +C V+FTFE L+R+        FI++ LNIID  A++ FYLE S   +      + V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER +++P++        F +I IG WWA++TMTT+G+GD VP T  GM++GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   32 CEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDD-QDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHT--DTKSATNSTTIIQVMDTKPV----LTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKD-VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 357.066 bits (915), Expect = 2.939e-115
Identity = 208/467 (44.54%), Postives = 289/467 (61.88%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP-----EDLYRKFGILED----DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            D   R++LNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL +    P     EDL ++  I ED    D  +  W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F     +++N T T N  T    +        A  Y++ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 DENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAI-EDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFN----TIINKTETVNNGT-ELISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 356.681 bits (914), Expect = 9.862e-115
Identity = 208/467 (44.54%), Postives = 289/467 (61.88%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP-----EDLYRKFGILED----DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            D   R++LNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR  E+ L I +  DL +    P     EDL ++  I ED    D  +  W+R +P++W L E+ YSSRA++ I   S+ FI+VSI +FCL++   F     +++N T T N  T    +        A  Y++ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P +       +F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLP++R++ +P
Sbjct:    5 DENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAI-EDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFN----TIINKTETVNNGT-ELISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 343.584 bits (880), Expect = 6.190e-110
Identity = 196/437 (44.85%), Postives = 279/437 (63.84%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            +  +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR  E+    LD+ +      + ED   ++  + ED   L  W+R +PK+W L E+ YSS+A++ I   S+ FI++SI +FCL++   F   N    N T    +  +    +   +    F+ Y++ +C ++FTFE LIR+        FI+S LNIID  A++ FYLE    + +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P++        F +I IG WWA++TMTT+G+GD  PVT SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEA---LDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVN----NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLE----IGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 343.969 bits (881), Expect = 7.399e-110
Identity = 196/437 (44.85%), Postives = 279/437 (63.84%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            +  +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR  E+    LD+ +      + ED   ++  + ED   L  W+R +PK+W L E+ YSS+A++ I   S+ FI++SI +FCL++   F   N    N T    +  +    +   +    F+ Y++ +C ++FTFE LIR+        FI+S LNIID  A++ FYLE    + +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P++        F +I IG WWA++TMTT+G+GD  PVT SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEA---LDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVN----NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLE----IGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 343.199 bits (879), Expect = 8.138e-110
Identity = 196/437 (44.85%), Postives = 279/437 (63.84%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            +  +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR  E+    LD+ +      + ED   ++  + ED   L  W+R +PK+W L E+ YSS+A++ I   S+ FI++SI +FCL++   F   N    N T    +  +    +   +    F+ Y++ +C ++FTFE LIR+        FI+S LNIID  A++ FYLE    + +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P++        F +I IG WWA++TMTT+G+GD  PVT SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEA---LDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVN----NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLE----IGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 337.421 bits (864), Expect = 1.467e-108
Identity = 202/463 (43.63%), Postives = 281/463 (60.69%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A      AF+ YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAET---EAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 338.191 bits (866), Expect = 7.650e-108
Identity = 201/462 (43.51%), Postives = 279/462 (60.39%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A   A     YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAETEAF--LTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 337.421 bits (864), Expect = 5.021e-106
Identity = 197/470 (41.91%), Postives = 279/470 (59.36%), Query Frame = 2
Query:  164 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGI----------------------LEDDMNL-------------SWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-QIQNISLVNATFTPN---ETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSVIR---LMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR  E+ L   +A D  +  +         G+                       +D                 +WW+R +P++W L E+ YSSRA++ +   S+ FI++SI +FCL++  GF  I N ++  A+  P    E   N      P       Y++ VC V+FTFE L+R+        F++S LNIID  A++ FYLE    V +  +++ A   V  F  V+R   ++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPF----LTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 337.421 bits (864), Expect = 6.920e-106
Identity = 197/470 (41.91%), Postives = 279/470 (59.36%), Query Frame = 2
Query:  164 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGI----------------------LEDDMNL-------------SWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-QIQNISLVNATFTPN---ETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSVIR---LMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR  E+ L   +A D  +  +         G+                       +D                 +WW+R +P++W L E+ YSSRA++ +   S+ FI++SI +FCL++  GF  I N ++  A+  P    E   N      P       Y++ VC V+FTFE L+R+        F++S LNIID  A++ FYLE    V +  +++ A   V  F  V+R   ++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPF----LTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 338.191 bits (866), Expect = 7.950e-106
Identity = 197/470 (41.91%), Postives = 279/470 (59.36%), Query Frame = 2
Query:  164 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGI----------------------LEDDMNL-------------SWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-QIQNISLVNAT---FTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSVIR---LMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR  E+ L   +A D  +  +         G+                       +D                 +WW+R +P++W L E+ YSSRA++ +   S+ FI++SI +FCL++  GF  I N ++  A+     P E   N      P       Y++ VC V+FTFE L+R+        F++S LNIID  A++ FYLE    V +  +++ A   V  F  V+R   ++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPF----LTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 278/449 (61.92%), Postives = 340/449 (75.72%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNG 1492
            DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL +LD LDLD+ +   E+L RKFG  ED     +SWWQ  +P++W L +E YSS A+K I   S+ FI +SI+SFCLK+ P  ++  +  +    T N +   +       AH AF YI+ VCN +FTFE+L+R   +     FI+S +NIID  A +SFY++         + N  + +FFS+IR+MR+FKLTR+ SGLKIL+ TF+ASAKEL+LLVFFL++ IVIFA+LVYYAER   NP N F+SI +GLWWA++TMTTVG+GD  P T  GM +GALCA+ GVLT++LPVPVIVSNF+M+YSHTQAR+KLPK+RRRVLP+E  R    PG  P G
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVK-TANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGA-PGG 453          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 6.398e-151
Identity = 253/460 (55.00%), Postives = 326/460 (70.87%), Query Frame = 2
Query:  158 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDL---DSIRSKPEDLYRKFGILED--DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQI-----QNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGK---QPNGSQ 1498
            + R+VLNVGG+RHETY+ATLKKIPATRLSRLT +LAN+DP LNEYFFDRHP VF+ ILNYYR GKLHYP DVCGPLFEEEL +WGLD++  EPCCWM     + T++TL +LD +D    D  + + +D  +KFG  ED      + W + +P++W L +E YSS+A+K+I G S+ FI +SI SFCLK+   F++     QNI++      P+   V+  T   PI    F  I+ +CN++FT EL+IR         F +SPLN+IDL A +SFY + +  V V       V +F S+IR+ R+FKLT++  GL+IL+ TF+ASAKEL LLVFFLI+ IVIFAALVYYAE+  +NP N+F SI +GLWWAI TMTTVG+GD  P T+ G L+G+LCAV GVLT++LPVPVIVSNF+MFYSH QAR KLPK RRRVLP+E IR + +      +P+ SQ
Sbjct:   36 DERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDADHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVLFIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVS--TEPLPI----FGQIEMLCNIWFTLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYAD-AMMVRVVEDEPKDVVEFLSMIRIFRLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQ 488          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 1.026e-107
Identity = 202/463 (43.63%), Postives = 281/463 (60.69%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A      AF+ YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAET---EAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P48547|KCNC1_HUMAN (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 1.698e-107
Identity = 202/463 (43.63%), Postives = 281/463 (60.69%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFI-YIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A      AF+ YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAET---EAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P25122|KCNC1_RAT (Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 5.351e-107
Identity = 201/462 (43.51%), Postives = 279/462 (60.39%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDS-----IRSKPEDLYRKFGILEDDMNLS---------------WWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-------QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L       LD+         P D     G  ED++ ++               +W+R +P++W L E+ YSSR ++ +   S+ FI+VSI +FCL++   F       +I+N+         N T V Y+  A   A     YI+ VC V+FTFE L+R+        FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  + P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDS----GDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVR--------NGTQVRYYREAETEAF--LTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267FE93 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007473g1 PE=3 SV=1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 310/498 (62.25%), Postives = 378/498 (75.90%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILED---DMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETT--VNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMM 1621
            M D++NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL ILD LDLD+ +  PEDLY+KFG LED   +  L+ WQ+ +PKLW L +E YSS A+K++   S+ FIV+SI+SFCLK+ PG ++  I+ V      N+T     Y T + P  H AF YI+ VCN +FTFE++ R +VT     F++SP+NIID  A +SFY++     V      +  V +FFS+IR+MR+FKLTR+I+GLKIL+ TFKASAKEL LLVFFLIVFIV+FAAL+YYAER + NPEN FDSI IGLWWAI+TMTTVG+GD  P T +GM +GALCA+TGVLT++LPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK       +G  K        ++ +N  K  P  +D SK + L + +  Q MM
Sbjct:    1 MADADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTTHRETQETLTILDRLDLDTDKLAPEDLYKKFG-LEDKYENNELNLWQKVKPKLWALFDEPYSSVAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIITNVTVVVDSNDTMSYALYKTRSEP--HSAFFYIECVCNSWFTFEIVTRFSVTPDKFEFLKSPVNIIDFIATLSFYMDLVLNQVLSEAEASYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIHYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMFVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKVAGTGPGSGLLKGAGGAGGNARRFNAMKSGPGLLD-SKLNRLGATT-LQSMM 493          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267GF75 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000359g2 PE=3 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 299/466 (64.16%), Postives = 363/466 (77.90%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMN--LSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGK--QPNGSQKLPKVEKTES 1528
            M D++NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL ILD LDLD+ +   EDLY+KFG  E+ ++  L++WQR +PKLW L +E YSS A+K++   S+ FIV+SI+SFCLK+ PG ++  IS        N +T           H AF+YI+ VCN +FTFE++ R AVT     F++SP+NIID  A +SFY++     V      +  V +FFS+IR+MR+FKLTR+I+GLKIL+ TFKASAKEL LLVFFLIVFIV+FAAL+YYAER   NPEN FDSI IGLWWAI+TMTTVG+GD  P T +GML+GALCA+TGVLT++LPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK++      P G  +   +E  +S
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNELNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLIDENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKLEFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAGPMGPKGPGQRGGLEGMKS 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8FX17 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 299/466 (64.16%), Postives = 363/466 (77.90%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMN--LSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGK--QPNGSQKLPKVEKTES 1528
            M D++NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL ILD LDLD+ +   EDLY+KFG  E+ ++  L++WQR +PKLW L +E YSS A+K++   S+ FIV+SI+SFCLK+ PG ++  IS        N +T           H AF+YI+ VCN +FTFE++ R AVT     F++SP+NIID  A +SFY++     V      +  V +FFS+IR+MR+FKLTR+I+GLKIL+ TFKASAKEL LLVFFLIVFIV+FAAL+YYAER   NPEN FDSI IGLWWAI+TMTTVG+GD  P T +GML+GALCA+TGVLT++LPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK++      P G  +   +E  +S
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLIDENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAGPMGPKGPGQRGGLEGMKS 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267EKG7 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004927g1 PE=3 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 299/466 (64.16%), Postives = 363/466 (77.90%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMN--LSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGK--QPNGSQKLPKVEKTES 1528
            M D++NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL ILD LDLD+ +   EDLY+KFG  E+ ++  L++WQR +PKLW L +E YSS A+K++   S+ FIV+SI+SFCLK+ PG ++  IS        N +T           H AF+YI+ VCN +FTFE++ R AVT     F++SP+NIID  A +SFY++     V      +  V +FFS+IR+MR+FKLTR+I+GLKIL+ TFKASAKEL LLVFFLIVFIV+FAAL+YYAER   NPEN FDSI IGLWWAI+TMTTVG+GD  P T +GML+GALCA+TGVLT++LPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK++      P G  +   +E  +S
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLIDENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAGPVGPKGPGQRGGLEGMKS 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267FAP8 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025928g1 PE=3 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 299/466 (64.16%), Postives = 363/466 (77.90%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMN--LSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGK--QPNGSQKLPKVEKTES 1528
            M D++NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR T++TL ILD LDLD+ +   EDLY+KFG  E+ ++  L++WQR +PKLW L +E YSS A+K++   S+ FIV+SI+SFCLK+ PG ++  IS        N +T           H AF+YI+ VCN +FTFE++ R AVT     F++SP+NIID  A +SFY++     V      +  V +FFS+IR+MR+FKLTR+I+GLKIL+ TFKASAKEL LLVFFLIVFIV+FAAL+YYAER   NPEN FDSI IGLWWAI+TMTTVG+GD  P T +GML+GALCA+TGVLT++LPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK++      P G  +   +E  +S
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLIDENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEVLEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAGPMGPKGPGQRGGLEGMKS 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 338.191 bits (866), Expect = 9.127e-108
Identity = 197/446 (44.17%), Postives = 280/446 (62.78%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRIL-----DALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            DSE R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L        +A D D+  +   D   ++  + ED+  + WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N   T  E      T +         Y++ VC V+FT E+  R+      + F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   34 DSE-RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTENVTVGNV--TREEIVYEVVTDS------WLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000049045.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 338.576 bits (867), Expect = 1.633e-107
Identity = 197/446 (44.17%), Postives = 280/446 (62.78%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRIL-----DALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            DSE R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L        +A D D+  +   D   ++  + ED+  + WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N   T  E      T +         Y++ VC V+FT E+  R+      + F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   34 DSE-RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTENVTVGNV--TREEIVYEVVTDS------WLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000012289.2 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 337.806 bits (865), Expect = 1.918e-107
Identity = 197/446 (44.17%), Postives = 280/446 (62.78%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRIL-----DALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            DSE R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L        +A D D+  +   D   ++  + ED+  + WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N T    E  V        +      Y++ VC V+FT E+  R+      + F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    6 DSE-RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTENVTVGNVT---REEIVYEV-----VTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000031881.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 338.576 bits (867), Expect = 2.744e-107
Identity = 197/446 (44.17%), Postives = 280/446 (62.78%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRIL-----DALDLDSIRSKPEDL-YRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            DSE R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L        +A D D+  +   D   ++  + ED+  + WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N T    E  V        +      Y++ VC V+FT E+  R+      + F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   34 DSE-RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTENVTVGNVT---REEIVYEV-----VTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc3a (potassium voltage-gated channel, Shaw-related subfamily, member 3a [Source:ZFIN;Acc:ZDB-GENE-100901-1])

HSP 1 Score: 333.183 bits (853), Expect = 1.122e-105
Identity = 192/446 (43.05%), Postives = 278/446 (62.33%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDA------LDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            DSE ++V+N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+ F+ ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L   +        D  ++    +   ++  + ED    SWW   +P++W L E+ YSS+ ++ +   S+ FI++SI +FCL++   F     + +N+++ N   T  E +    T +         Y++ +C ++FT E+  R+      + F +S LNIID  A++ FYLE    V++  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++PE+        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   34 DSE-KIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPNTFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPEVPEDDPALTGGADGDLKRLCLQEDGRKPSWWSIWQPRIWNLFEDPYSSKYARYVAFGSLLFILISISTFCLETHEAFNTIYNKTENVTVGNV--TREEVSFEVVTDS------WLTYVEGMCVIWFTIEVFTRVIFCPDKAEFFKSSLNIIDFVAILPFYLE----VALSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPEDPTASAHTAFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 345.125 bits (884), Expect = 9.248e-111
Identity = 200/438 (45.66%), Postives = 277/438 (63.24%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTE--ALAN--YDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPED--LYRKFGILE---DDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSF-YVSVHPINNNAVFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            D   RVV+NVGG RHETY+ TL+ +P TRLS LTE  A AN  YD   NE+FFDRHP VF+ ILNYYR GKLH P +VCGPLFEEEL FWG+D   VEPCCWM Y  HR  E+ L   +  D++      ED  + ++FG+ E   D   L + +R +P++W L E+ YSSRA++++   S+ FI++SI +FCL++   F        N T   N TT   +           +Y++ VC  +F+FE L+R+        FI++ LN+ID  A++ FYLE     ++  P  +  V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA +++YAERF +NP +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NFSM+YS   A
Sbjct:   33 DENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAFNTVLNKTENYTIN-NVTTQKVYVDVE--TDPVLMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARD--VLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.662 bits (618), Expect = 4.155e-74
Identity = 160/435 (36.78%), Postives = 236/435 (54.25%), Query Frame = 2
Query:  164 RVVLNVGGIRHETYKATLKKIPATRLSRL---------TEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPI----NNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKER 1429
            RV LNVGG+ HE    TL+++P TRL RL         +E   +Y  A NEYFFDRHP  F+ +LN+YR G+LH   ++C   F +ELD+WG+D   +E CC   Y  H+  E           + +R + E    + G   D+   +     R KLW+L+E   SS A+K +   SI FIV+S I+  L ++P  Q             ++   ++      +A      ++AVC  +FT E L+R         F +  LN+IDL A++ +Y+      S   +    N   V Q F ++R++R+ KL R+ +GL+ L  T + S  EL LL+ FL + I+IF++LV++AE+    P+ KF SI    WWA ITMTTVG+GD  P+T  G +IG LC + GVL ++LP+P+IV+NFS FY   + + K  K R
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARY--HQKKEQMS--------EELRREAESAREREG---DEFEGTCCADKRRKLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLPDLQ-------------HKDEFSHIIDNPKLAQ-----VEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVSQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEK--DEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRR 402          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 201.06 bits (510), Expect = 5.899e-59
Identity = 146/421 (34.68%), Postives = 225/421 (53.44%), Query Frame = 2
Query:  140 QPMCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVG-KLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNAT-FTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYV-SVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYS 1393
            Q  CD  NRVV+NV G R ET   TL + P + L    +    +DP  NEYFFDR    F  IL YY+ G +L  P+DV   +F EE++F+ L    V           +  E+TL              PE         E++++   +Q++   +W+L E    S A+K+++  S    ++SI   CL+++P F+  N    N T F+   +  N            F  ++  C V+F FEL +R       ++F++  +N ID+ A++ +++     +          + +   ++R++R+FKL+R+   L+IL +T KAS +EL++L FFL V +VIF+  +YY E    +P+  F SI    WWA++TMT VG+GD  P+T  G ++GALCA+TGVLT+SLPVPVIVSNF  FY+
Sbjct:    4 QLTCD--NRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTL------------DTPE---------EENVHGKDFQQH---VWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNL---------DPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 377          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 197.208 bits (500), Expect = 1.949e-57
Identity = 142/414 (34.30%), Postives = 221/414 (53.38%), Query Frame = 2
Query:  161 NRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVG-KLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNAT-FTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYV-SVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYS 1393
             RVV+NV G R ET   TL + P + L    +    +DP  NEYFFDR    F  IL YY+ G +L  P+DV   +F EE++F+ L    V           +  E+TL              PE         E++++   +Q++   +W+L E    S A+K+++  S    ++SI   CL+++P F+  N    N T F+   +  N            F  ++  C V+F FEL +R       ++F++  +N ID+ A++ +++     +          + +   ++R++R+FKL+R+   L+IL +T KAS +EL++L FFL V +VIF+  +YY E    +P+  F SI    WWA++TMT VG+GD  P+T  G ++GALCA+TGVLT+SLPVPVIVSNF  FY+
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTL------------DTPE---------EENVHGKDFQQH---VWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNL---------DPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 369          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 196.823 bits (499), Expect = 2.434e-57
Identity = 142/414 (34.30%), Postives = 221/414 (53.38%), Query Frame = 2
Query:  161 NRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVG-KLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNAT-FTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYV-SVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYS 1393
             RVV+NV G R ET   TL + P + L    +    +DP  NEYFFDR    F  IL YY+ G +L  P+DV   +F EE++F+ L    V           +  E+TL              PE         E++++   +Q++   +W+L E    S A+K+++  S    ++SI   CL+++P F+  N    N T F+   +  N            F  ++  C V+F FEL +R       ++F++  +N ID+ A++ +++     +          + +   ++R++R+FKL+R+   L+IL +T KAS +EL++L FFL V +VIF+  +YY E    +P+  F SI    WWA++TMT VG+GD  P+T  G ++GALCA+TGVLT+SLPVPVIVSNF  FY+
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTL------------DTPE---------EENVHGKDFQQH---VWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNL---------DPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 373          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 335.495 bits (859), Expect = 8.350e-110
Identity = 198/435 (45.52%), Postives = 279/435 (64.14%), Query Frame = 2
Query:  161 NRVVLNVGGIRHETYKATLKKIPATRLSRLTEA---LANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPE--DLYRKFGI---LEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAV--FQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRR 1435
            +RV +NVGG+RHETYK+TLK IP TRLS + EA    A++DP+  EYFFDRHP VF+ +LNYYR GKLH P+DVCGPLFE+EL FWG+D  QVE CCW+TY  HR  ++TL   + ++ ++     E  DL R +G     E + + +WW+R +P++W LMEE +SS  +KVI   ++T I+VS+  FCL+S+  F  + +  +                         + ++ +C V+FT EL++R         F +  +N ID  A++ FY+   F       NNN +       +IR+ R+FKL+R+ SGL+IL  T +AS +EL LL+FFL++ +V+FA+L++Y E+    P  KF  I    WWA++TMTTVG+GD  P + SG  IG+LCAV GVLT++LPVPVIV+NFS++YSH QAR KLPK+RRR
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGR-YGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESMEKFSEKYLKDL------------------------LVILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSLGF-----NNNNNDIDALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEK--KIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 329.717 bits (844), Expect = 2.988e-107
Identity = 189/434 (43.55%), Postives = 270/434 (62.21%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDM---NLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYI-DAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERR 1432
            ++ +RVV+NVGG +HETY  TLK IP TRL  +TE    L  +DP  +E+FFDRHP VF+Q+LN+YR GKLH P DVCGPLFE+EL FWG+D  QVEPCCW+ Y  HR  +  L   D  D D+      D+   +G++ D +   N +WW++ +P++W + EE YSS  ++V+   ++  I+ S+  FCL+++P F              N  T   F           +YI +AVC  +FT E L RL       +F + P+N IDL A++ FYL  +  V         V +   +IR+ R+FKL+R+  GL+IL  T ++S  EL LLVFFL + +VIF+++++YAE+        F +I    WWA++TMTT+G+GD VP+T  G ++G+LCAV GVL ++LPVPVIVSNFS++YSH +AR KLP+ +R
Sbjct:   13 NAGDRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDM-SVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKFD-------------NPKTSEGFV----------LYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYL--TLIVRESNFKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEK--DTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRKR 418          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 306.99 bits (785), Expect = 1.205e-98
Identity = 170/426 (39.91%), Postives = 257/426 (60.33%), Query Frame = 2
Query:  161 NRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP-EDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRR 1435
            +R+++NVGG RHET  +TL+ IP TRLS + E     +    EYFFDRHP  F Q+LN+YR GKLH P ++CGP+FEEEL FWG+D  Q+EPCCW TYT HR  E+ L+       + ++ +P E+    +G + +   L+ W+R +P+LW+ ++E +SS+ +K+ +  S  FI +SI +FC  ++P  +  NI                       +     +I+  C++FF+FEL +RL       +F +  +N ID  A+I FY+   FY        N + + F VIR+MR+F+  +   GL+I++ T KAS+ EL LL+  +++ +V+F+++VYY E        +F S+    WW +ITMTTVG+GD  P T  G +IG  CA+ GVL V+LP+ VI SNF+++Y+H QAR KLP ++RR
Sbjct:   16 SRIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLKDEPAENHMGSYGSINE---LNCWKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIRKNNIMG---------------------SREGLDHIEMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNI-FY-------PNPIVRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLKLPVKQRR 409          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 281.567 bits (719), Expect = 5.039e-89
Identity = 178/441 (40.36%), Postives = 261/441 (59.18%), Query Frame = 2
Query:  155 SENRVVLNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNR-PKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRY---ISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNS-------NPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRR 1435
             ++RV+LNVGG RHETY +TL+ +P +RL+ + E     A+YDP  NE FFDRHP VF+ +LNYYR GKLH P DVCGPLFEEEL FWG++  Q+EPCCW  YT HR  + TL+  + L  D+  S+ E   R          L+  Q+ +  + W L+E+ YSS+ ++++   S+  I++S+ +FC++S+P                           A    + F  ++ +  V+FTFE + R         FI++ +  +D+ ++I  Y+ F+          +    F  V+RL+R+F+L R+   +SG++++  T +ASA+EL LLV  L++ +VIF+ LV+YAE+  S       N + +F SI    WWAIITMTTVG+GD  P T  G  IG LCA  GVL V+LPV VI SNF++FYSH QA+ KLPK++ +
Sbjct:    4 GKDRVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCWSNYTQHRDAQATLKAFEGLQKDTEDSEYEAGER----------LARRQKTKMQQFWALLEQPYSSKYAQILAMVSLVIIILSVTTFCIESMP--------------------------FADAFKKEFQILEILYCVWFTFEFVARAIACPSKVEFIKNFMTWVDVLSIIPLYISFA--------KGDQTLDFLFVLRLVRIFRLFRFFRTMSGMQVIGHTLRASARELFLLVLILLIPMVIFSTLVFYAEKSVSKFLNQRINSKGEFPSIPDAFWWAIITMTTVGYGDVTPKTPHGRFIGTLCACIGVLIVALPVSVIGSNFTLFYSHAQAQLKLPKKKHK 400          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO48067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ6])

HSP 1 Score: 278.87 bits (712), Expect = 1.051e-87
Identity = 165/437 (37.76%), Postives = 260/437 (59.50%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTE--ALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLV-----NATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAE-RFNSNPEN-KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRR 1435
            D  +RVV+N GG R E Y +TLK I    LS++TE     +YD    EYFFDRHP VF+Q+LNY + GKLH P +VCGPLFE+EL +WG+D  Q+E CCW  YT HR  +++L+ LD       R + ++   +  +  DD NLSWWQR++P +W++++E YSS  +K  T       +VSI + C+ ++  F+  + ++      NAT   N TT +Y+   + +     + ID+VC  +FT E L+RL        FI +  N IDL  +I  YL  +       +  + V    + +R++R+F+  + +  L+IL  T KAS + L +L+  L++ +++F++LV Y+E R+ S+    +F ++   +WW +ITMTT+G+GD VP +  G +IG + ++ GV+ +S    VI S FS++Y+  QA+ KLP +RR+
Sbjct:    1 DHRDRVVINCGGKRFEPYLSTLKNITDLPLSKITENKIKLDYDEESGEYFFDRHPAVFAQVLNYLQTGKLHCPRNVCGPLFEQELAYWGIDEQQMESCCWSNYTKHRDAQESLKALD------FRPRYDEDEERRKVHYDDPNLSWWQRHQPIVWEILDEPYSSSTAKDYT-----PFLVSIFTICIWTVEMFKGDSKTVTRNVTRNATHG-NTTTKSYYMPVSDVPRYVLMIIDSVCTGWFTLEFLLRLVFCPSKLKFILTLQNWIDLIVIIPLYLMLA-------MEKSFVLDVLNTMRIVRIFRFFKLLYDLQILTKTVKASRQHLMILLIILMIPVIVFSSLVLYSEKRWGSDKSKAQFYNVPNSVWWGLITMTTIGYGDMVPTSFMGKVIGGIASICGVIILSTSASVIGSTFSLYYNLAQAQLKLPTKRRK 418          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 350.517 bits (898), Expect = 9.251e-113
Identity = 204/467 (43.68%), Postives = 291/467 (62.31%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDAL------------DLDSIRSKPEDLYRKF--GILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTP---NETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            + D ++R+V+NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L                  + +    + +++ R+   G   D  + S W R + ++W L E+ YSS+ ++ I   S+ FI+VSI +FCL++   F      +VN T+     N TT N +      A+    YI+ VC V+FTFE L+R+       +FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP +       +F +I IG WWA++TMTT+G+GD  P T  GML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLPK++ R +P
Sbjct:    3 LSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFN----PIVNRTYVEHLDNITTENTYQETETAAY--LTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 350.517 bits (898), Expect = 1.411e-112
Identity = 204/467 (43.68%), Postives = 291/467 (62.31%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDAL------------DLDSIRSKPEDLYRKF--GILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTP---NETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            + D ++R+V+NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHP VF+ ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  E+ L                  + +    + +++ R+   G   D  + S W R + ++W L E+ YSS+ ++ I   S+ FI+VSI +FCL++   F      +VN T+     N TT N +      A+    YI+ VC V+FTFE L+R+       +FI++ LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  +NP +       +F +I IG WWA++TMTT+G+GD  P T  GML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLPK++ R +P
Sbjct:    3 LSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFN----PIVNRTYVEHLDNITTENTYQETETAAY--LTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 345.895 bits (886), Expect = 1.417e-110
Identity = 196/456 (42.98%), Postives = 281/456 (61.62%), Query Frame = 2
Query:  152 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKP------EDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLP 1444
            DSE ++V+N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP  F+ ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L   +  + D+    P      +   ++  + ED    + WQ  +P +W L E+ YSS+ ++ +   S+ FI++SI +FCL++   F     + +N+++ N  FT  E      T           Y++ VC ++FT E++ R+      + F +S LNIID  A++ FYLE +    +       +  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P +        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A+ KLPK+R + +P
Sbjct:    7 DSE-KIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPEDDPALTGCADGDLKRLCMQEDGRRATRWQVWQPWMWALFEDPYSSKYARYVAFASLFFILLSISTFCLETHEAFNTIYNKTENVTVGN--FTHEEIVYEVVTDG------WLTYVEGVCVIWFTIEVMARVIFCPDKAEFFRSALNIIDFVAIVPFYLEVAL-SGLSSKTAKDILSFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPNDPTAAAHTTFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRNKHIP 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000008692.2 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 334.339 bits (856), Expect = 8.956e-107
Identity = 195/448 (43.53%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  149 CDSEN-RVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDA------LDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            C SE+ ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L   +        D  ++     DL ++  + ED     WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N   T  E      T +         Y++ VC ++FT E+L+R+        F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:    3 CPSESEKIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPDDDPALGGADGDL-KRLCMQEDARRAGWWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNTIYNKTENVTIGNV--TREEIVYEVVTDS------WLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 437          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000039227.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 334.724 bits (857), Expect = 1.711e-106
Identity = 195/448 (43.53%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  149 CDSEN-RVVLNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDA------LDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGF-----QIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNA---VFQFFSV---IRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPEN-------KFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQA 1405
            C SE+ ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VFS ILNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWM Y  HR  E+ L   +        D  ++     DL ++  + ED     WW+  +P++W L E+ YSS+ ++ +   S+ FI++SI +FC+++   F     + +N+++ N   T  E      T +         Y++ VC ++FT E+L+R+        F +S LNIID  A++ FYLE    V +  +++ A   V  F  V   +R++R+FKLTR+  GL++L  T +AS  E  LL+ FL + ++IFA ++YYAER  ++P++        F +I IG WWA++TMTT+G+GD  P T SGML+GALCA+ GVLT+++PVPVIV+NF M+YS   A
Sbjct:   31 CPSESEKIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPDDDPALGGADGDL-KRLCMQEDARRAGWWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNTIYNKTENVTIGNV--TREEIVYEVVTDS------WLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLE----VGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000039493.1 (SMESG000039493.1)

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 543/552 (98.37%), Postives = 544/552 (98.55%), Query Frame = 2
Query:  113 HSSIDFYY*---QPMCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF 1759
            H  I F+Y     PMCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF
Sbjct:   82 HFQISFFYVILDTPMCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF 633          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000039493.1 (SMESG000039493.1)

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 538/538 (100.00%), Postives = 538/538 (100.00%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF 1759
            MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF
Sbjct:    1 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVTGRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF 538          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000059794.1 (SMESG000059794.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 296/449 (65.92%), Postives = 366/449 (81.51%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSW--WQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPI---AHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPG 1477
            M DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHPHVF QILNYYR GKLHYP DVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHR+T++T+ +LD L+LD+ +   E LY KFG+ E  +N S   WQ+ RP+LWQ++EE YSS ++K+++  S+ FI++SI  FC+K++PG  I  ++  N +++ + T  +   S  P+     ++   IDA+CN++FT EL+ RL ++  +  FIQSPLNIID  +L+SFY +F+F  S   +  N   +F S+IRLMRVFKLTR+ISGLKIL++TFKASAKELSLLVFFL+VFIV+FAAL+YYAERF  +  NKFDSII+GLWWAI+TMTTVG+GD+ P + +GM++GALCAVTGVLT+SLPVPVIVSNFS FYSHTQARSKLPK+RRRVLP+E++RPKTK G
Sbjct:    1 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYSSLSAKILSSLSVIFIILSIAIFCIKTVPG--INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMSFYFDFAFASSSSQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIVLFAALIYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTG 447          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000013590.1 (SMESG000013590.1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 293/449 (65.26%), Postives = 360/449 (80.18%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILE--DDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQP 1486
            M D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDP LNEYFFDRHP+VFSQILNYYR GKLHYP DVCGPLFEEELDFWGLDSNQVEPCCWMTYT+HRST+D L ILD +D+DS +   EDLY+KFG+L+   D  +S WQRN+PKLWQ MEE YSS+ +K++   S+ FI++S+I+FCLKS+P  ++ NI  VN T + N   +       P  + AF+Y++ +CN +FT EL++RL  T  +  F +SP+N+ID+FAL SFYL    Y    P+  N   + F+V+RL R+FKLTR+ISGLKIL++TF+AS KEL LL+FFL VFIV+FAA +YYAER +SN + +F SII GLWW++ITMTTVG+GDY P +  GML+GALCAVTGVLT+SLP+PVIVSNFSMFYSHTQAR+KLPK+RRRVLP+E++RPK   GK P
Sbjct:    1 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTLHRSTQDILTILDKVDIDSDKMSEEDLYKKFGLLDRFQDNEMSIWQRNQPKLWQTMEEPYSSQLAKILGYISVFFIIISLIAFCLKSVPVLKVANIVSVNIT-SSNTWAITAKDGVGPDPYIAFLYVELICNSYFTIELIVRLFATPSIFAFFKSPINLIDIFALFSFYLYLVLYYLNSPVRFNIYLETFNVVRLFRIFKLTRHISGLKILILTFQASMKELILLMFFLFVFIVVFAAFIYYAERLDSNIDTQFMSIIDGLWWSLITMTTVGYGDYSPRSLPGMLVGALCAVTGVLTISLPIPVIVSNFSMFYSHTQARAKLPKQRRRVLPVEAVRPK---GKGP 445          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 294/481 (61.12%), Postives = 368/481 (76.51%), Query Frame = 2
Query:  146 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILE--DDMNLSWWQRNRPKLWQLMEESYSSRASKVITGXXXXXXXXXXXXXCLKSIPGFQIQNISLVNATFT---PNETTVNYFTSAAPIA-HRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGSQKLPKVEKTESKTYNTPKRSPSTID 1570
            M D+ENRV+LNVGGIRHETYKATLKKIPATRLS+LTEALANYDP LNEYFFDRHP VF+QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HRST+DTL+ILD +D+D+ R+   +LY++FG+ E  +D  LS+WQ+ RP++W ++EE YSS  +K+++G  I+ I++SIISFC+K+ PG+ I  I  +N T+      +   ++  S   I  H  F Y + +CN +F+ EL++R+ VT    +F    LNIID+FAL+SFY++ SF      I  + + +F S++R+MR+FKLTR+ISGLKIL++TFKASAKELSLLVFFL+VFI +FAAL+YYAE+F  N  N F SI  GLWWAI TMTTVG+GD VP T  GML+GALCAVTGVLT+SLPVPVIVSNFSMFYSHTQARSKLPK+RRRVLP+E++RPK K    PN           +++      + PS ID
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRSTQDTLQILDRIDIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKTYPGYSIPLI--LNHTYNVSIGGDLFQSWSLSQKEIQPHTVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDVSFV--YFNIEKSHLIEFMSILRIMRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIAVFAALIYYAEKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFKGA--PNNFLTSSNAAWVQNRRLAITGKGPSLID 475          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC28.811e-10940.75potassium voltage-gated channel subfamily C member... [more]
KCNC22.390e-10840.75potassium voltage-gated channel subfamily C member... [more]
KCNC23.235e-10840.75potassium voltage-gated channel subfamily C member... [more]
KCNC13.535e-10843.63potassium voltage-gated channel subfamily C member... [more]
KCNC25.147e-10840.75potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-11.711e-16456.95SHaW family of potassium channels [Source:UniProt... [more]
shw-12.386e-16455.06SHaW family of potassium channels [Source:UniProt... [more]
shw-12.386e-16455.06SHaW family of potassium channels [Source:UniProt... [more]
shw-13.406e-16455.06SHaW family of potassium channels [Source:UniProt... [more]
shw-13.530e-16455.06SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw0.000e+061.95gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw0.000e+061.95gene:FBgn0003386 transcript:FBtr0289989[more]
Shaw0.000e+058.25gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw0.000e+057.43gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw0.000e+061.92gene:FBgn0003386 transcript:FBtr0089274[more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc23.386e-10944.25potassium voltage-gated channel, Shaw-related subf... [more]
kcnc21.507e-10844.25potassium voltage-gated channel, Shaw-related subf... [more]
kcnc49.013e-10843.28potassium voltage-gated channel, Shaw-related subf... [more]
kcnc41.061e-10743.28potassium voltage-gated channel, Shaw-related subf... [more]
kcnc41.061e-10743.28potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC22.939e-11544.54potassium channel, voltage gated Shaw related subf... [more]
KCNC29.862e-11544.54potassium channel, voltage gated Shaw related subf... [more]
tamm416.190e-11044.85TAM41 mitochondrial translocator assembly and main... [more]
tamm417.399e-11044.85TAM41 mitochondrial translocator assembly and main... [more]
tamm418.138e-11044.85TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc11.467e-10843.63potassium voltage gated channel, Shaw-related subf... [more]
Kcnc17.650e-10843.51potassium voltage gated channel, Shaw-related subf... [more]
Kcnc35.021e-10641.91potassium voltage gated channel, Shaw-related subf... [more]
Kcnc36.920e-10641.91potassium voltage gated channel, Shaw-related subf... [more]
Kcnc37.950e-10641.91potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME0.000e+061.92Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL6.398e-15155.00Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P15388|KCNC1_MOUSE1.026e-10743.63Potassium voltage-gated channel subfamily C member... [more]
sp|P48547|KCNC1_HUMAN1.698e-10743.63Potassium voltage-gated channel subfamily C member... [more]
sp|P25122|KCNC1_RAT5.351e-10743.51Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FE930.000e+062.25BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267GF750.000e+064.16BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8FX170.000e+064.16BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267EKG70.000e+064.16BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267FAP80.000e+064.16BTB domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048024.19.127e-10844.17potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000049045.11.633e-10744.17potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000012289.21.918e-10744.17potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000031881.12.744e-10744.17potassium voltage-gated channel subfamily C member... [more]
kcnc3a1.122e-10543.05potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a9.248e-11145.66potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.14.155e-7436.78pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcna1b5.899e-5934.68potassium voltage-gated channel, shaker-related su... [more]
kcna1b1.949e-5734.30potassium voltage-gated channel, shaker-related su... [more]
kcna1b2.434e-5734.30potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427248.350e-11045.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398042.988e-10743.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382371.205e-9839.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480665.039e-8940.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480671.051e-8737.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1b9.251e-11343.68potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.411e-11243.68potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000045623.11.417e-11042.98potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000008692.28.956e-10743.53potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000039227.11.711e-10643.53potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039493.10.000e+098.37SMESG000039493.1[more]
SMESG000039493.10.000e+0100.00SMESG000039493.1[more]
SMESG000059794.10.000e+065.92SMESG000059794.1[more]
SMESG000013590.10.000e+065.26SMESG000013590.1[more]
SMESG000054802.10.000e+061.12SMESG000054802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021870 ID=SMED30021870|Name=Potassium voltage-gated channel protein Shaw|organism=Schmidtea mediterranea sexual|type=transcript|length=1879bp
GTTCATGACTGTGACACTAAAGTGATTAAAGAAAGAGATTTTTCTTGCTT
CTCAGTTTAATTTCTTGAACAAAAACTCTACCGTTTGTATTCATCTAACC
GAAGCCATTTAACACAGTTCAATTGATTTTTATTACTAACAACCGATGTG
CGATTCTGAAAATCGGGTCGTTCTCAATGTCGGAGGAATCAGACACGAAA
CGTATAAAGCGACTTTGAAAAAAATTCCCGCAACGAGATTGTCAAGACTT
ACAGAAGCGTTGGCTAATTATGATCCAGCTTTAAATGAATATTTCTTTGA
TCGACATCCTCATGTCTTTTCTCAGATTTTGAACTACTACCGCGTTGGTA
AATTGCATTATCCCATGGATGTTTGTGGACCTTTATTTGAAGAAGAACTG
GATTTCTGGGGACTAGATTCAAATCAGGTGGAACCATGTTGCTGGATGAC
ATACACAATTCACAGGAGTACTGAAGACACCTTGAGGATTCTTGATGCTT
TAGATCTTGATAGTATTCGATCGAAACCTGAAGACCTTTATAGAAAATTT
GGTATTTTAGAAGATGACATGAATCTATCTTGGTGGCAAAGAAATCGCCC
AAAATTATGGCAATTAATGGAAGAATCATACTCATCGAGAGCGTCAAAAG
TTATTACTGGATTTTCAATAACATTTATTGTCGTGTCAATAATTTCGTTT
TGTCTGAAGTCTATTCCTGGATTTCAAATACAAAATATAAGTCTCGTAAA
TGCCACCTTTACTCCCAATGAAACAACAGTGAATTATTTCACCTCCGCTG
CTCCAATTGCTCACAGGGCATTCATTTATATAGATGCAGTTTGCAACGTA
TTTTTTACATTTGAACTATTAATTCGTCTGGCGGTCACGACTCGGCTCAG
CAATTTCATTCAGTCCCCCCTCAATATTATCGACCTGTTTGCTTTGATCA
GTTTTTATTTGGAATTTTCATTCTACGTCTCAGTCCATCCAATCAACAAC
AATGCGGTTTTCCAATTTTTCAGTGTCATCAGATTAATGAGAGTTTTCAA
GCTTACTCGTTACATATCCGGTTTAAAAATACTCGTGGTCACTTTTAAGG
CCAGCGCCAAAGAACTCAGCCTTTTGGTGTTTTTTCTCATTGTTTTCATA
GTGATTTTTGCGGCTTTGGTTTATTATGCTGAAAGATTTAACAGTAATCC
TGAAAACAAATTCGATTCTATTATTATTGGACTTTGGTGGGCAATTATCA
CTATGACGACGGTTGGTTTTGGAGATTATGTGCCGGTTACGAATTCAGGA
ATGTTAATTGGAGCTCTTTGTGCAGTAACTGGTGTTCTCACTGTTTCATT
GCCTGTGCCAGTTATTGTAAGTAATTTCTCAATGTTTTATTCACATACCC
AAGCTCGATCAAAGTTGCCAAAAGAGAGACGAAGAGTATTGCCAATCGAA
TCTATCAGACCAAAAACAAAACCAGGAAAGCAACCAAACGGTTCTCAAAA
ATTACCAAAAGTAGAAAAGACAGAAAGTAAAACCTATAACACACCGAAAC
GATCTCCATCAACTATAGATACTTCAAAGCCGAGTGAGCTGGCATCAATT
TCCGAGTATCAAAAGATGATGCAAGTTCGAAATTCGATTGTCACCGGAAG
GTTGCCCTCAAGTGTCGATGTCAGAGCAAACATATCAGTTAGACGTCAAA
GCATAAATCGTATCAATGATCCGAACCATGTCGTAAATGTCAAAACCGAT
TCAGTATTTTAGAGCACTTTTTAGAAGAAAAAAACACAAATCTAGATCGT
CAGAAATAGATGATATCGAATTTTACATATCATTTTTAGTCAAGATGTTT
TTTATTTATTGTTTTATATTATGGAATCG
back to top

protein sequence of SMED30021870-orf-1

>SMED30021870-orf-1 ID=SMED30021870-orf-1|Name=SMED30021870-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYF
FDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCW
MTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSWWQRN
RPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISL
VNATFTPNETTVNYFTSAAPIAHRAFIYIDAVCNVFFTFELLIRLAVTTR
LSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRV
FKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNS
NPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTV
SLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPGKQPNGS
QKLPKVEKTESKTYNTPKRSPSTIDTSKPSELASISEYQKMMQVRNSIVT
GRLPSSVDVRANISVRRQSINRINDPNHVVNVKTDSVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015572Shaw_inv
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR003974K_chnl_volt-dep_Kv3
IPR000210BTB/POZ_dom
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR027359Volt_channel_dom_sf
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0030431sleep
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0022843voltage-gated cation channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 48..67
score: 59.59
coord: 323..346
score: 51.25
coord: 356..378
score: 59.79
coord: 294..320
score: 46.85
coord: 385..411
score: 60.67
coord: 161..189
score: 35.83
coord: 228..251
score: 33.51
coord: 254..274
score: 37.65
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 2..116
e-value: 1.1E-50
score: 172.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 307..419
e-value: 6.4E-30
score: 105.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 465..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..480
NoneNo IPR availableCDDcd18416BTB_Shaw-likecoord: 5..116
e-value: 1.17212E-81
score: 247.953
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 164..412
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 359..381
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 49..62
score: 73.02
coord: 82..103
score: 79.55
coord: 421..435
score: 51.11
coord: 158..170
score: 45.73
coord: 64..79
score: 83.33
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 323..337
score: 48.33
coord: 299..307
score: 51.76
coord: 396..407
score: 71.88
coord: 48..58
score: 71.59
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 6..106
e-value: 2.5E-11
score: 53.6
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 8..98
e-value: 1.8E-28
score: 98.7
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 138..306
e-value: 1.9E-39
score: 136.7
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 170..418
e-value: 1.1E-35
score: 123.0
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 3..478
IPR015572Potassium channel, voltage dependent, Shaw, invertebratePANTHERPTHR11537:SF257POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAWcoord: 3..478
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 6..106