coiled-coil domain-containing protein 39

Overview
Namecoiled-coil domain-containing protein 39
Smed IDSMED30021868
Uniprot Best hitCoiled-coil domain-containing protein 39 OS=Xenopus tropicalis OX=8364 GN=ccdc39 PE=2 SV=1 (E=0)
Length (bp)3222
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 39 (SMED30021868) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 39 (SMED30021868) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 39 (SMED30021868) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 39 (SMED30021868) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021868

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021868SMESG000072035.1 SMESG000072034.1 SmedASXL_016266SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v6_5955_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021868SMESG000072035.1 SMESG000072034.1 SMESG000067391.1 SMESG000067387.1 OX_Smed_1.0.06934ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021868SMESG000072035.1 SMESG000072034.1 dd_Smed_v4_5955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Human
Match: CCDC39 (coiled-coil domain containing 39 [Source:HGNC Symbol;Acc:HGNC:25244])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 359/878 (40.89%), Postives = 564/878 (64.24%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENL-----NKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEI--LESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPST 2725
            S  L  L W+D  A+P+ANEENK L   +   + +  + ++EL +  E++NSM++H KN +QEL  +  L  A+  + +SE+H   +++RE+GR+K E +R +++M  + + K+  EN +FK T +++ L+ QM WDQQALEAWLEES  K  D +++QKYA+QD+ KI+ + L++ERLT   N+KR  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q+++RD +ID+ + +LA ++ E  + E  +K + +F E+ +  N E +K I + +R+  K R   +D ET R     EL++LK T +RT+SDLE  R  IS++KK+  E+  R  +    +  ++ +LK +    ++ E++A   + ML+E+E++  + +  L   + + FK AQEL    + ++ + + I+G  ++++++N  + +LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K LE        L TQ+K++ +D+   K    K + E  ++  K+ E+NL  + S++EL K++  K+ LM+EDN++KLEVKR R+ L+SKAE+VLSL+KR+ QL  A++ER  EI++HK ML SQ R  ++E+  IS++ + R+SKI+KL+ R+EILTV M PPEGEEE++QAYYVIKAAQ+KE LQR+GD LD KI KAEKEI ALENTL ++NSCN NY+QS  KVT +S E   K  L  Q R V +K  +K++Q+ +L++D Q ++ TL+ +     N  E L   Q         Q  KE ++Q  K+ER      +L  EI  L+ +K E  +  E DIK R+ K+F+++ ++E+L  I     +I    + Y +   L   T ST
Sbjct:    3 SEFLAELHWEDGFAIPVANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLERLTLECNQKRKILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADRKLLKCRTAYQDHETSRIQLKGELDSLKATVNRTSSDLEALRKNISKIKKDIHEETARLQKTKNHNEIIQTKLKEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQTETMKEKAVLSEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSEEKQALEAKIVELRKSLEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFIDRSEKELDKAKGFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERTEEIKVHKTMLASQIRYVDQERENISTEFRERLSKIEKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQEKEELQREGDCLDAKINKAEKEIYALENTLQVLNSCNNNYKQSFKKVTPSSDEYELKIQLEEQKRAVDEKYRYKQRQIRELQEDIQSMENTLDVIEHLANNVKEKLSEKQAYSF-----QLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETME--EQDIKLREMKQFHKV-IDEMLVDIIEENTEIRIILQTYFQQSGLELPTAST 872          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Human
Match: CCDC39 (coiled-coil domain containing 39 [Source:HGNC Symbol;Acc:HGNC:25244])

HSP 1 Score: 506.523 bits (1303), Expect = 1.668e-163
Identity = 340/881 (38.59%), Postives = 533/881 (60.50%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDL--EQARVAISQXXXXXXXXXXXXXXAVQKHAD-LEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENL-----NKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEI--LESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPST 2725
            S  L  L W+D  A+P+ANEENK L   +   + +  + ++EL +  E++NSM++H KN +QEL  +  L  A+  + +SE+H   +++RE+GR+K E +R +++M  + + K+  EN +FK T +++ L+ QM WDQQALEAWLEES  K  D +++QKYA+QD+ KI+ + L++ERLT   N+KR  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q+++RD +ID+     ALL        +++KA                     V R +                  S+LEAL++   +   D+  E AR+                 +  + H + ++ +LK +    ++ E++A   + ML+E+E++  + +  L   + + FK AQEL    + ++ + + I+G  ++++++N  + +LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K LE        L TQ+K++ +D+   K    K + E  ++  K+ E+NL  + S++EL K++  K+ LM+EDN++KLEVKR R+ L+SKAE+VLSL+KR+ QL  A++ER  EI++HK ML SQ R  ++E+  IS++ + R+SKI+KL+ R+EILTV M PPEGEEE++QAYYVIKAAQ+KE LQR+GD LD KI KAEKEI ALENTL ++NSCN NY+QS  KVT +S E   K  L  Q R V +K  +K++Q+ +L++D Q ++ TL+ +     N  E L   Q         Q  KE ++Q  K+ER      +L  EI  L+ +K E  +  E DIK R+ K+F+++ ++E+L  I     +I    + Y +   L   T ST
Sbjct:    3 SEFLAELHWEDGFAIPVANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLERLTLECNQKRKILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDN----CALL--------DSLKA--------------------TVNRTS------------------SDLEALRKNISKIKKDIHEETARL-----------------QKTKNHNEIIQTKLKEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQTETMKEKAVLSEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSEEKQALEAKIVELRKSLEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFIDRSEKELDKAKGFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERTEEIKVHKTMLASQIRYVDQERENISTEFRERLSKIEKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQEKEELQREGDCLDAKINKAEKEIYALENTLQVLNSCNNNYKQSFKKVTPSSDEYELKIQLEEQKRAVDEKYRYKQRQIRELQEDIQSMENTLDVIEHLANNVKEKLSEKQAYSF-----QLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETME--EQDIKLREMKQFHKV-IDEMLVDIIEENTEIRIILQTYFQQSGLELPTAST 808          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Fly
Match: CG17387 (gene:FBgn0037276 transcript:FBtr0078880)

HSP 1 Score: 147.132 bits (370), Expect = 1.444e-35
Identity = 165/719 (22.95%), Postives = 352/719 (48.96%), Query Frame = 2
Query:  122 LTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQ---ELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALE-EKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTS 2266
            +  +GW     +P+A+ EN  +L  +   +   L  +  ++ L+E+  ++  H +N    +Q +L L ++  +    E H  ++   E  ++K++ ++ + +++E  +   V E  + +   E++EL +++K  +  L  W E  E        ++KY   D+ K +E+N++ + L + I+++R ++     E  T +  LE+T   +R+AH ER  ++  W++ + Q+ +R+ +I     + A L  +A +  +  K  +     ++  N++++  I+ +  ++  ++ + + +         E++ L+R  +  ++ +   R+      K++ EK             +  RLK V +  L AEQR  + ++M++ +E      ++  +   ++ ++T +   EL D E   +    S+  N  AI   N +  ++++ L +Q EI Y+  F   + ERR+  ++G   + E EA    ++N L +E E   +++AT   Q K++  ++            E   +  K++E  +  E + + LR+ R +  +L+V+ N++K+    L   +    +    L++ RL   +AIK+R  E+R  +D+L  + +   EE + + +DL  R  +I+ ++ RFE+    +   E     +     + +AQ+++ L  +GD L+ K+ KAEKE+ ALENTL   +  N NYR++   V + S
Sbjct:   20 MASVGWAVDSDIPMASAENLAILKELTALRALKLELQQHMNSLDEREMAVERHTRNIEGTIQQNLTLYSSLKDDVIKEAHNVQLVILERNKIKEDLRKNNKELEEYTEYVKVTERKICQSKREIDELTSRIKSAKTTLVEWTEAMEDGNKGYQLIEKYYLDDQQKARELNIKRQLLQADIDKRRKQVVLLYDEQMTLEKNLERTACLYRSAHAERRQMVETWKSAVNQMTQREHDIQRSEIECAELAQKAQQTAQTYKEYDNQLTEVIENNRQVELAIESLNEESSDMKNQIQILIDATLLKEREIDGLRRELENLSNRVHLQRMDNRSQMKKRDEKAKELENFASVMEKVNARLKSVQNKALNAEQRLQILEEMMQAEETALRNLDKEQEKVNEMLYRTQRQVIELQDEEKVLKVQNDSLNSNLAAI---NRNQQQVNNELKRQTEIHYSLSFKCLEAERRLAEIKGLADDPEVEATNMARLNTLEQEYEKLQRLIATTEAQNKKLNYNMNNLVVQYNADEKELEMVRFKIKEAQVYCEGTVKRLRQIRYENSELIVDLNMVKMRCSDLEVGIGGCEQGTYDLEQHRLAFRRAIKDRTVELRSQEDVLLLKKKHLNEELSTLRADLGERKKQIEAMKARFELTAQLLGKNEDGSIMTSTQLKVVSAQERQMLADEGDALNKKVLKAEKEVVALENTLRQFDKSNDNYRKTFRSVDENS 735          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Zebrafish
Match: CCDC39 (coiled-coil domain containing 39 [Source:HGNC Symbol;Acc:HGNC:25244])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 343/754 (45.49%), Postives = 512/754 (67.90%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQV 2374
            S++L  +GWD   A+P+AN ENK L   I  KQK  LN  N+L+K  + +N+++ HLKN +QE+ H+  L  AK ++ +SE H+  ++ERE GRLKQE  R +S++  L++ KN  EN++FK T +++EL +Q+ WDQQ LEA+L+ES  K +D M++ KYA+QDE KIKE+ L +E+LT   N+KR  L+ E+ ET T+Q+ L+KT E FR AH ER+ L+ QWE TI Q+++RD++I   +  LA L     +  + +K R +F E  +  NKE+++NI  VERQA +LR + ++ E  +     E+E LK T DRTA+D+E +R  +S +KK+  +K  +  EA   +A LEE+L+ V    L  E++A   +Q+L EQE+N  + +  L   ++L FK +QE+      ++N+TA I    TA+ N+++ + +LD + L+QQ I+ NQDF IQ LER+   +QG  + EEK+ALE+K+  L   LE   K  A L  QLK++QDDIR  K D EKI  E TN++ K++EV L  ETS++E +KSR  K+  MVE  ++K+EV+RLR+ LY +A+ VL+L+KRRLQL+ A+KER  EIR+H++ML  Q +  E+E+  +S+ +   +SKIDK  KR+E+L+VS+APPEGEE++SQAY++IKAAQ+KE LQR+GDELD KIRK EKEI ALENTL ++N+CN  +R++++KVT++S     K  L  Q R   +K  +KR+Q ++L++D +V
Sbjct:    3 SALLEEVGWDADFAIPVANAENKALEEQIRKKQKDILNLDNKLNKHKDVINALTEHLKNLKQEVSHNQALCKAKEKETESEVHLKALAERETGRLKQEITRLESQLTTLNEKKNAQENSIFKATQKIDELTSQLNWDQQTLEAFLQESAHKDEDTMAIIKYAKQDERKIKELTLNIEKLTLESNQKRKTLDNELTETVTSQIALDKTAESFRQAHTERQELISQWENTIEQMRKRDQDIQQCAMMLAELNQTIREKNDLIKERKDFLEREIENNKELERNIGTVERQAFRLRQQLQEEEKNQRRLQDEVEVLKGTVDRTATDVETSRSQLSSMKKDIQDKTTKVEEAQLHNAALEEKLRMVTEAVLNGEEQAAQMEQLLREQEQNIKEIDSQLLRQKELLFKKSQEVQALRDKEKNVTAEICATRTALSNLDSKLRKLDQNFLQQQMIISNQDFQIQMLERKTLHLQGKVNTEEKKALEKKVADLAASLEEKKKTAANLNKQLKKLQDDIRCIKKDTEKIGAEKTNLSTKIQEVELFIETSEKERKKSRLKKQDSMVEKGLLKMEVQRLRNLLYDRADGVLTLEKRRLQLQTAMKEREEEIRVHREMLNKQVKLTEQERQGLSAAVNEAMSKIDKQRKRYEVLSVSLAPPEGEEDKSQAYFIIKAAQEKEELQRKGDELDAKIRKTEKEIHALENTLQVVNNCNSTHRKALTKVTESSPAHQEKLKLEEQRRAAEEKYKYKRRQTQELQEDIEV 756          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Zebrafish
Match: CCDC39 (coiled-coil domain containing 39 [Source:HGNC Symbol;Acc:HGNC:25244])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 320/703 (45.52%), Postives = 480/703 (68.28%), Query Frame = 2
Query:  266 SMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQV 2374
            +++ HLKN +QE+ H+  L  AK ++ +SE H+  ++ERE GRLKQE  R +S++  L++ KN  EN++FK T +++EL +Q+ WDQQ LEA+L+ES  K +D M++ KYA+QDE KIKE+ L +E+LT   N+KR  L+ E+ ET T+Q+ L+KT E FR AH ER+ L+ QWE TI Q+++RD++I   +  LA L     +  + +K R +F E  +  NKE+++NI  VERQA +LR + ++ E  +     E+E LK T DRTA+D+E +R  +S +KK+  +K  +  EA   +A LEE+L+ V    L  E++A   +Q+L EQE+N  + +  L   ++L FK +QE+      ++N+TA I    TA+ N+++ + +LD + L+QQ I+ NQDF IQ LER+   +QG  + EEK+ALE+K+  L   LE   K  A L  QLK++QDDIR  K D EKI  E TN++ K++EV L  ETS++E +KSR  K+  MVE  ++K+EV+RLR+ LY +A+ VL+L+KRRLQL+ A+KER  EIR+H++ML  Q +  E+E+  +S+ +   +SKIDK  KR+E+L+VS+APPEGEE++SQAY++IKAAQ+KE LQR+GDELD KIRK EKEI ALENTL ++N+CN  +R++++KVT++S     K  L  Q R   +K  +KR+Q ++L++D +V
Sbjct:   22 ALTEHLKNLKQEVSHNQALCKAKEKETESEVHLKALAERETGRLKQEITRLESQLTTLNEKKNAQENSIFKATQKIDELTSQLNWDQQTLEAFLQESAHKDEDTMAIIKYAKQDERKIKELTLNIEKLTLESNQKRKTLDNELTETVTSQIALDKTAESFRQAHTERQELISQWENTIEQMRKRDQDIQQCAMMLAELNQTIREKNDLIKERKDFLEREIENNKELERNIGTVERQAFRLRQQLQEEEKNQRRLQDEVEVLKGTVDRTATDVETSRSQLSSMKKDIQDKTTKVEEAQLHNAALEEKLRMVTEAVLNGEEQAAQMEQLLREQEQNIKEIDSQLLRQKELLFKKSQEVQALRDKEKNVTAEICATRTALSNLDSKLRKLDQNFLQQQMIISNQDFQIQMLERKTLHLQGKVNTEEKKALEKKVADLAASLEEKKKTAANLNKQLKKLQDDIRCIKKDTEKIGAEKTNLSTKIQEVELFIETSEKERKKSRLKKQDSMVEKGLLKMEVQRLRNLLYDRADGVLTLEKRRLQLQTAMKEREEEIRVHREMLNKQVKLTEQERQGLSAAVNEAMSKIDKQRKRYEVLSVSLAPPEGEEDKSQAYFIIKAAQEKEELQRKGDELDAKIRKTEKEIHALENTLQVVNNCNSTHRKALTKVTESSPAHQEKLKLEEQRRAAEEKYKYKRRQTQELQEDIEV 724          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Xenopus
Match: ccdc39 (coiled-coil domain containing 39 [Source:NCBI gene;Acc:779795])

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 379/871 (43.51%), Postives = 580/871 (66.59%), Query Frame = 2
Query:  119 ILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTAS 2731
            +L  L WDD  A+P+AN ENK L   +  K+K+ +   N++    E++ +M++HL+N RQEL ++  L  A+  + +SE+H   +SEREIGRLKQE +R ++++  L + KN  ENN+FK T ++E L+ Q+ WDQQ LEAWLEES RK +D M++QKY+++D+ KIKE++L +E+LT    +KR  ++ E+ ET TAQ+EL+KT E+FR AH ER+ L+ QWE+TIGQ+++RD +IDH +  LA ++ E  + E  +K + +F ++ ++ NKE +K I   ERQA KLR+E ++ E  R     EL++LK   DRTASDLE  R  ++ LKK+   +++R   A + +  L ++L  V    L+ E+RA   ++M +EQE+     E  LK  R++ FK +QELH+ +  ++++ A I G    ++N+N+ + +LD   LKQQ I+YNQDF IQQLERR++R++G+ + +EK+ALE +++QLTK  E     +  L TQ K++Q D+R  K ++EK   E  ++  K EE NL N  S++ L+K +A K+ LMVEDNI+KLE+KRLRD LYSKA+ V SL+KR+LQL+ A+KER  EI +HK+ML+S  R  ++E+  ISS L  R++K++K+ KRFEILT++M PPEGEEE+SQAYYV+KAAQ+KE LQR GD+LD KIRKAEKEIRALENTL ++N CN ++++S SK+T+TS E   K  L  + +   +K  +K++Q+ +L++D QV+K T +++  +E+ Y ++   +L  + Q  KE + Q +K+ER      +L   +  + K++E    E DI  RD ++FN+ ++N++L       PD+    + Y     L    P+  S
Sbjct:    5 VLDELRWDDGYAIPVANAENKTLEEEMQKKEKEKIQLSNQVKGFEERIQAMADHLRNVRQELTYTQSLVRARENETESEEHFKTLSEREIGRLKQEIQRLENELVSLREKKNSHENNIFKTTQKLENLKRQLNWDQQTLEAWLEESARKDEDSMAIQKYSQKDDGKIKELSLLIEKLTLEAGQKRKLMDNELTETITAQIELDKTAEDFRKAHTERQQLISQWESTIGQMQKRDRDIDHCAMLLAQVKQELREKESIIKEKIQFLQSEIDNNKEYEKKISAAERQAAKLRLELQEQEIIRGRLQDELDSLKGVVDRTASDLETMRTEVTSLKKDIRNRQNRLQMAQEYNDGLSDKLNFVTESALSLEERALRMEEMFKEQEKTVKDLEVQLKQIREILFKKSQELHECKAKEKDVIAEINGGQVTLKNLNSQLQKLDSHALKQQGIMYNQDFQIQQLERRLSRLKGEVNTDEKQALEMRVSQLTKVFEERRAALKLLNTQHKKLQGDVRYIKRELEKTGQEKGDLISKKEEFNLFNMMSEKTLKKIKASKQDLMVEDNILKLEIKRLRDMLYSKADDVFSLEKRKLQLQTAMKERTEEISVHKEMLKSHIRYVDQERQNISSQLHERLAKVEKMRKRFEILTIAMMPPEGEEEKSQAYYVVKAAQEKEELQRVGDDLDGKIRKAEKEIRALENTLRVINGCNTSFKKSFSKITETSEEYDEKVQLEEEKKAAEEKHRYKQRQIRELQEDTQVMKNTFDSMINEELSYQEKAKELLPAITQLNKETEDQKQKLERVLKQYSKLSKHVRNAKKSKEETQEEKDINVRDLRDFNQ-SLNKMLAQAMEKNPDLATALQLYFHQFGL--EIPTIGS 872          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Mouse
Match: Ccdc39 (coiled-coil domain containing 39 [Source:MGI Symbol;Acc:MGI:1289263])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 324/762 (42.52%), Postives = 513/762 (67.32%), Query Frame = 2
Query:  107 VISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLE 2392
            + S  L+ L W+D  A+P+AN+ENK L   +   +++  N +++L    E++NSM++HLKN  QE   +  L  A+  + +SE+H   ++ERE+GR+K E +  + +M  + + K+  ENN+FK T ++++L+ QM WDQQALEAWLEES  K  D +++QKY++QD+ KI+ + L++E+LT   NEKR  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q++RRD+EID+ +  L+ ++ EA + E  +K + +F EN V  N E ++ I + ER+  K RM+ +  E  R     EL+ LK T +RT+SDL+  R  IS++KK+  ++  R  +    +  ++ +LK +    L+ E++A   + ML+E+E+   + E  L   +D+ FK  QEL +    ++ + + I+G  ++++++N  +H+LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K ++     ++ L +Q+K++ +D+   K    K   E  ++  K+ E+NL  + S++EL K++A KE +M+EDN++KL+VKR R+ LYSKAE+VLSL+KR+ QL + ++ER  EI++HK ML SQ R  E+++  +SS+   R+SKIDKL+ R+EILTV M PPEGEEE++Q+YYVIKAAQ+KE LQR+GD LD KI KAEKEI AL+NTL ++NSCN NY+QS  KVT +S E + K  L  Q RT  ++   K++Q+ +L++D Q ++ T E
Sbjct:    1 MCSEFLSELHWEDGFAIPVANQENKILEDQLAKLREEKSNLQDQLHDYEERINSMTSHLKNVNQEFLFTQSLYKARESEIESEEHFKAIAERELGRVKNETQLLEKEMAIIRERKSQMENNIFKTTQKLDDLKCQMNWDQQALEAWLEESAHKDSDSLTLQKYSQQDDNKIRALTLQLEKLTMEYNEKRKLLDSELTETLSAQLELDKAAQDFRKIHLERQELIQQWENTIEQMQRRDQEIDNCALALSRIKQEAREKEGVVKEKIKFLENEVENNIEYERKISVAERKVSKCRMDYQRHEGNRSQLKDELDTLKTTLNRTSSDLQALRKNISKVKKDIFDETLRLQKLKHHNEVVKHKLKMITEKTLSIEEKATNMEDMLKEEEKGLKEVEVQLGIVKDVLFKKVQELQNEIAKEKALVSEIEGTRSSLKHLNKQLHKLDFETLKQQEIMYSQDFYIQQVERRMSRLKGEINSEEKQALEAKILELKKTMDEKKSTLSLLESQIKKLHNDLYFIKKSNGKNNDEKESLMNKISELNLFIDRSEKELSKAKAVKEDMMIEDNLLKLQVKRARELLYSKAEEVLSLEKRKQQLGKDMEERAEEIKVHKAMLTSQIRCVEQQRKTMSSEFHERLSKIDKLKNRYEILTVVMLPPEGEEEKTQSYYVIKAAQEKEELQREGDSLDAKINKAEKEIYALQNTLQVLNSCNSNYKQSFKKVTPSSDEYALKIQLEEQKRTADERYRCKQRQIRELQEDIQSMENTFE 762          
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Match: sp|Q0V9R4|CCD39_XENTR (Coiled-coil domain-containing protein 39 OS=Xenopus tropicalis OX=8364 GN=ccdc39 PE=2 SV=1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 379/871 (43.51%), Postives = 580/871 (66.59%), Query Frame = 2
Query:  119 ILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTAS 2731
            +L  L WDD  A+P+AN ENK L   +  K+K+ +   N++    E++ +M++HL+N RQEL ++  L  A+  + +SE+H   +SEREIGRLKQE +R ++++  L + KN  ENN+FK T ++E L+ Q+ WDQQ LEAWLEES RK +D M++QKY+++D+ KIKE++L +E+LT    +KR  ++ E+ ET TAQ+EL+KT E+FR AH ER+ L+ QWE+TIGQ+++RD +IDH +  LA ++ E  + E  +K + +F ++ ++ NKE +K I   ERQA KLR+E ++ E  R     EL++LK   DRTASDLE  R  ++ LKK+   +++R   A + +  L ++L  V    L+ E+RA   ++M +EQE+     E  LK  R++ FK +QELH+ +  ++++ A I G    ++N+N+ + +LD   LKQQ I+YNQDF IQQLERR++R++G+ + +EK+ALE +++QLTK  E     +  L TQ K++Q D+R  K ++EK   E  ++  K EE NL N  S++ L+K +A K+ LMVEDNI+KLE+KRLRD LYSKA+ V SL+KR+LQL+ A+KER  EI +HK+ML+S  R  ++E+  ISS L  R++K++K+ KRFEILT++M PPEGEEE+SQAYYV+KAAQ+KE LQR GD+LD KIRKAEKEIRALENTL ++N CN ++++S SK+T+TS E   K  L  + +   +K  +K++Q+ +L++D QV+K T +++  +E+ Y ++   +L  + Q  KE + Q +K+ER      +L   +  + K++E    E DI  RD ++FN+ ++N++L       PD+    + Y     L    P+  S
Sbjct:    5 VLDELRWDDGYAIPVANAENKTLEEEMQKKEKEKIQLSNQVKGFEERIQAMADHLRNVRQELTYTQSLVRARENETESEEHFKTLSEREIGRLKQEIQRLENELVSLREKKNSHENNIFKTTQKLENLKRQLNWDQQTLEAWLEESARKDEDSMAIQKYSQKDDGKIKELSLLIEKLTLEAGQKRKLMDNELTETITAQIELDKTAEDFRKAHTERQQLISQWESTIGQMQKRDRDIDHCAMLLAQVKQELREKESIIKEKIQFLQSEIDNNKEYEKKISAAERQAAKLRLELQEQEIIRGRLQDELDSLKGVVDRTASDLETMRTEVTSLKKDIRNRQNRLQMAQEYNDGLSDKLNFVTESALSLEERALRMEEMFKEQEKTVKDLEVQLKQIREILFKKSQELHECKAKEKDVIAEINGGQVTLKNLNSQLQKLDSHALKQQGIMYNQDFQIQQLERRLSRLKGEVNTDEKQALEMRVSQLTKVFEERRAALKLLNTQHKKLQGDVRYIKRELEKTGQEKGDLISKKEEFNLFNMMSEKTLKKIKASKQDLMVEDNILKLEIKRLRDMLYSKADDVFSLEKRKLQLQTAMKERTEEISVHKEMLKSHIRYVDQERQNISSQLHERLAKVEKMRKRFEILTIAMMPPEGEEEKSQAYYVVKAAQEKEELQRVGDDLDGKIRKAEKEIRALENTLRVINGCNTSFKKSFSKITETSEEYDEKVQLEEEKKAAEEKHRYKQRQIRELQEDTQVMKNTFDSMINEELSYQEKAKELLPAITQLNKETEDQKQKLERVLKQYSKLSKHVRNAKKSKEETQEEKDINVRDLRDFNQ-SLNKMLAQAMEKNPDLATALQLYFHQFGL--EIPTIGS 872          
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Match: sp|P0CK98|CCD39_DANRE (Coiled-coil domain-containing protein 39 OS=Danio rerio OX=7955 GN=ccdc39 PE=3 SV=2)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 366/851 (43.01%), Postives = 558/851 (65.57%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDI 2665
            S++L  +GWD   A+P+AN ENK L   I  KQK  LN  N+L+K  + +N+++ HLKN +QE+ H+  L  AK ++ +SE H+  ++ERE GRLKQE  R +S++  L++ KN  EN++FK T +++EL +Q+ WDQQ LEA+L+ES  K +D M++ KYA+QDE KIKE+ L +E+LT   N+KR  L+ E+ ET T+Q+ L+KT E FR AH ER+ L+ QWE TI Q+++RD++I   +  LA L     +  + +K R +F E  +  NKE+++NI  VERQA +LR + ++ E  +     E+E LK T DRTA+D+E +R  +S +KK+  +K  +  EA   +A LEE+L+ V    L  E++A   +Q+L EQE+N  + +  L   ++L FK +QE+      ++N+TA I    TA+ N+++ + +LD + L+QQ I+ NQDF IQ LER+   +QG  + EEK+ALE+K+  L   LE   K  A L  QLK++QDDIR  K D EKI  E TN++ K++EV L  ETS++E +KSR  K+  MVE  ++K+EV+RLR+ LY +A+ VL+L+KRRLQL+ A+KER  EIR+H++ML  Q +  E+E+  +S+ +   +SKIDK  KR+E+L+VS+APPEGEE++SQAY++IKAAQ+KE LQR+GDELD KIRK EKEI ALENTL ++N+CN  +R++++KVT++S     K  L  Q R   +K  +KR+Q ++L++D + +  TLE L ++E +  + +      ++   K+   Q EKI RA     +   EI    ++ E    E DI+ R+ ++FN+ ++N++L       P++
Sbjct:    3 SALLEEVGWDADFAIPVANAENKALEEQIRKKQKDILNLDNKLNKHKDVINALTEHLKNLKQEVSHNQALCKAKEKETESEVHLKALAERETGRLKQEITRLESQLTTLNEKKNAQENSIFKATQKIDELTSQLNWDQQTLEAFLQESAHKDEDTMAIIKYAKQDERKIKELTLNIEKLTLESNQKRKTLDNELTETVTSQIALDKTAESFRQAHTERQELISQWENTIEQMRKRDQDIQQCAMMLAELNQTIREKNDLIKERKDFLEREIENNKELERNIGTVERQAFRLRQQLQEEEKNQRRLQDEVEVLKGTVDRTATDVETSRSQLSSMKKDIQDKTTKVEEAQLHNAALEEKLRMVTEAVLNGEEQAAQMEQLLREQEQNIKEIDSQLLRQKELLFKKSQEVQALRDKEKNVTAEICATRTALSNLDSKLRKLDQNFLQQQMIISNQDFQIQMLERKTLHLQGKVNTEEKKALEKKVADLAASLEEKKKTAANLNKQLKKLQDDIRCIKKDTEKIGAEKTNLSTKIQEVELFIETSEKERKKSRLKKQDSMVEKGLLKMEVQRLRNLLYDRADGVLTLEKRRLQLQTAMKEREEEIRVHREMLNKQVKLTEQERQGLSAAVNEAMSKIDKQRKRYEVLSVSLAPPEGEEDKSQAYFIIKAAQEKEELQRKGDELDAKIRKTEKEIHALENTLQVVNNCNSTHRKALTKVTESSPAHQEKLKLEEQRRAAEEKYKYKRRQTQELQEDIESMSNTLEGLLQEEKVLNEGIERTQAHVLSLNKDILSQEEKINRAVKQCAKYTKEIRSGKQSTEKTFEERDIELRELRDFNK-SINKMLLDAMEGNPEL 852          
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Match: sp|Q9UFE4|CCD39_HUMAN (Coiled-coil domain-containing protein 39 OS=Homo sapiens OX=9606 GN=CCDC39 PE=2 SV=3)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 359/878 (40.89%), Postives = 564/878 (64.24%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENL-----NKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEI--LESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPST 2725
            S  L  L W+D  A+P+ANEENK L   +   + +  + ++EL +  E++NSM++H KN +QEL  +  L  A+  + +SE+H   +++RE+GR+K E +R +++M  + + K+  EN +FK T +++ L+ QM WDQQALEAWLEES  K  D +++QKYA+QD+ KI+ + L++ERLT   N+KR  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q+++RD +ID+ + +LA ++ E  + E  +K + +F E+ +  N E +K I + +R+  K R   +D ET R     EL++LK T +RT+SDLE  R  IS++KK+  E+  R  +    +  ++ +LK +    ++ E++A   + ML+E+E++  + +  L   + + FK AQEL    + ++ + + I+G  ++++++N  + +LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K LE        L TQ+K++ +D+   K    K + E  ++  K+ E+NL  + S++EL K++  K+ LM+EDN++KLEVKR R+ L+SKAE+VLSL+KR+ QL  A++ER  EI++HK ML SQ R  ++E+  IS++ + R+SKI+KL+ R+EILTV M PPEGEEE++QAYYVIKAAQ+KE LQR+GD LD KI KAEKEI ALENTL ++NSCN NY+QS  KVT +S E   K  L  Q R V +K  +K++Q+ +L++D Q ++ TL+ +     N  E L   Q         Q  KE ++Q  K+ER      +L  EI  L+ +K E  +  E DIK R+ K+F+++ ++E+L  I     +I    + Y +   L   T ST
Sbjct:    3 SEFLAELHWEDGFAIPVANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLERLTLECNQKRKILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADRKLLKCRTAYQDHETSRIQLKGELDSLKATVNRTSSDLEALRKNISKIKKDIHEETARLQKTKNHNEIIQTKLKEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQTETMKEKAVLSEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSEEKQALEAKIVELRKSLEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFIDRSEKELDKAKGFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERTEEIKVHKTMLASQIRYVDQERENISTEFRERLSKIEKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQEKEELQREGDCLDAKINKAEKEIYALENTLQVLNSCNNNYKQSFKKVTPSSDEYELKIQLEEQKRAVDEKYRYKQRQIRELQEDIQSMENTLDVIEHLANNVKEKLSEKQAYSF-----QLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETME--EQDIKLREMKQFHKV-IDEMLVDIIEENTEIRIILQTYFQQSGLELPTAST 872          
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Match: sp|Q9D5Y1|CCD39_MOUSE (Coiled-coil domain-containing protein 39 OS=Mus musculus OX=10090 GN=Ccdc39 PE=1 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 324/762 (42.52%), Postives = 513/762 (67.32%), Query Frame = 2
Query:  107 VISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLE 2392
            + S  L+ L W+D  A+P+AN+ENK L   +   +++  N +++L    E++NSM++HLKN  QE   +  L  A+  + +SE+H   ++ERE+GR+K E +  + +M  + + K+  ENN+FK T ++++L+ QM WDQQALEAWLEES  K  D +++QKY++QD+ KI+ + L++E+LT   NEKR  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q++RRD+EID+ +  L+ ++ EA + E  +K + +F EN V  N E ++ I + ER+  K RM+ +  E  R     EL+ LK T +RT+SDL+  R  IS++KK+  ++  R  +    +  ++ +LK +    L+ E++A   + ML+E+E+   + E  L   +D+ FK  QEL +    ++ + + I+G  ++++++N  +H+LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K ++     ++ L +Q+K++ +D+   K    K   E  ++  K+ E+NL  + S++EL K++A KE +M+EDN++KL+VKR R+ LYSKAE+VLSL+KR+ QL + ++ER  EI++HK ML SQ R  E+++  +SS+   R+SKIDKL+ R+EILTV M PPEGEEE++Q+YYVIKAAQ+KE LQR+GD LD KI KAEKEI AL+NTL ++NSCN NY+QS  KVT +S E + K  L  Q RT  ++   K++Q+ +L++D Q ++ T E
Sbjct:    1 MCSEFLSELHWEDGFAIPVANQENKILEDQLAKLREEKSNLQDQLHDYEERINSMTSHLKNVNQEFLFTQSLYKARESEIESEEHFKAIAERELGRVKNETQLLEKEMAIIRERKSQMENNIFKTTQKLDDLKCQMNWDQQALEAWLEESAHKDSDSLTLQKYSQQDDNKIRALTLQLEKLTMEYNEKRKLLDSELTETLSAQLELDKAAQDFRKIHLERQELIQQWENTIEQMQRRDQEIDNCALALSRIKQEAREKEGVVKEKIKFLENEVENNIEYERKISVAERKVSKCRMDYQRHEGNRSQLKDELDTLKTTLNRTSSDLQALRKNISKVKKDIFDETLRLQKLKHHNEVVKHKLKMITEKTLSIEEKATNMEDMLKEEEKGLKEVEVQLGIVKDVLFKKVQELQNEIAKEKALVSEIEGTRSSLKHLNKQLHKLDFETLKQQEIMYSQDFYIQQVERRMSRLKGEINSEEKQALEAKILELKKTMDEKKSTLSLLESQIKKLHNDLYFIKKSNGKNNDEKESLMNKISELNLFIDRSEKELSKAKAVKEDMMIEDNLLKLQVKRARELLYSKAEEVLSLEKRKQQLGKDMEERAEEIKVHKAMLTSQIRCVEQQRKTMSSEFHERLSKIDKLKNRYEILTVVMLPPEGEEEKTQSYYVIKAAQEKEELQREGDSLDAKINKAEKEIYALQNTLQVLNSCNSNYKQSFKKVTPSSDEYALKIQLEEQKRTADERYRCKQRQIRELQEDIQSMENTFE 762          
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Match: sp|E2R1I5|CCD39_CANLF (Coiled-coil domain-containing protein 39 OS=Canis lupus familiaris OX=9615 GN=CCDC39 PE=3 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 356/883 (40.32%), Postives = 564/883 (63.87%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENL-----NKDEVL-----YGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEI--LESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPST 2725
            S +L  L WDD  A+P+ANEENK L   +   Q++  + +++L    +++N+M++H KN +QE   +  L  A+  + +SE+H   ++ERE+GR+K E +R +++M  + + K+  ENN+FK T +++ L+ Q+ WDQQALEAWLEES  K  D +++QKYA+QD+ KI+ + L++ERLT   N++R  L+ E+ ET +AQ+EL+K  ++FR  H ER+ L+ QWE TI Q+++RD +ID+ +  LA ++ E  + E  +K + +F E+ +  N E +K I + +R+  K R E +  ET R     EL++LK T +R++SDLE  R  IS++KK+  E+  R  +    +  ++++LK++    ++ E++A   + ML E+E++  + E  L   +D+ FK  QEL    + ++ + + I+G  ++++++N  +H+LD   LKQQEI+Y+QDF IQQ+ERR++R++G+ ++EEK+ALE KI +L K LE        L +Q+K++ +D+   K    K   E   +  K+ E+NL N+ S++EL K++A K+ LM+EDN++KLEVKR R+ L+SKAE+VLSL+KR+ QL  A++ER  EI++HK ML SQ R  ++E+  +S++   R+SKIDKL+ R+EILTV M PPEGEEE++QAYYVIKAAQ+KE LQR+GD LD KI KAEKEI ALENTL ++ SCN NY+QS  K+T +S E   K  L  Q R + +K  +K++Q+ +L++D Q ++ TLE +     N  E L     Y  Q+N          +E ++Q  K+ER      +L  EI  L+ +K E  +  E DIK R+ K F++I ++E+L  +     +I    + Y +   L   T  T
Sbjct:    3 SELLEELHWDDGFAIPVANEENKMLEDQLSKLQEERASLQDQLRDYEDRINAMTSHFKNVKQEFSFTQSLCKAREHEIESEEHFKIIAERELGRIKDEIQRLENEMTSIREKKSDKENNIFKTTQKLDGLKCQINWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLERLTLECNQRRKVLDNELTETLSAQLELDKAAQDFRKIHNERQELIKQWENTIEQMRKRDRDIDNGALALARIKQELREKENLVKEKIKFLESEIGNNTEYEKRISVADRKLLKCRTEYQHHETNRNQLKDELDSLKATVNRSSSDLEALRKNISKIKKDIQEETARLQKIKNHNQSVKKKLKQITEKTMSVEEKATNLEDMLREEEKSVKEVEVQLNIVKDVLFKKVQELQTEAMKEKAVVSEIEGTRSSLKHLNHQLHKLDFETLKQQEIMYSQDFYIQQVERRMSRLKGEINSEEKQALETKIVELKKILEEKKSTFDLLESQIKKLHNDLYFIKKSNSKNCDEKQFLMTKVNELNLFNDRSEKELNKTKALKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLHTAMEERMEEIKVHKTMLASQIRYIDQERQNLSAEFHERLSKIDKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQEKEELQREGDSLDAKINKAEKEIYALENTLQVLRSCNNNYKQSFQKITPSSDEYELKIQLEEQKRAIDEKYRYKQRQIRELQEDIQSMENTLEVIEHLTNNVKEKLSEKQAYSSQLN----------RETEEQRPKLERVTKQCAKLTKEIRLLKDTKDETLE--EQDIKLREVKHFHKI-IDEMLAEVTEENAEIHIILQTYFQQNGLELPTAGT 872          
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Match: gnl|BL_ORD_ID|18187604 (tr|A0A1I8GAL7|A0A1I8GAL7_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 417/880 (47.39%), Postives = 626/880 (71.14%), Query Frame = 2
Query:   89 MSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTA 2728
            MS  + V++SIL  L WDD LA+P+AN++NK+L+ L++   K   +  NE++ +++K+ ++  H+KN RQEL  +  L  A++ + ++E H+TKVSERE GRL QE +R D ++     TKN  ENN+FK+T ++EE++ QM W+QQALEAWLEESE+K +D +++QKY RQDE KI+E++L++ERLT   N K+ +L+  V+ET+T QVEL+K  E+FR AH+ER+ L+ QWE TI +++ RD+EI+ L+ +LA  +    + EE +K +  F ++  + N E++K I + ER AGK+R+E ++ E QR NF +EL++LKRT DRT  DLE AR  I+ LK E   K+ +     ++ A LE+ LKRV +D+L+AEQ+A   D++++ +E    + E+ LK  R+ QF++AQ+LHDA+  +R   A+I GN  A+RN+N  I +LDH LLKQQEILYNQDFSIQQL+RRI+RM G+ +++EK ALE +I +L  +L+  V+V  TL+ QL+++QD+IRRCK DM+K   E  +++ K+EE++L N+ S +E  +   +++ +MV++N+M+LEVKRLRD+L ++A++V+S DKR+LQ E A+KER  EI IHK+MLQ+Q RSA++E+ ++SS+L  R +KIDKL+KR+EI+ VSMAPPEGEEE+SQAYYVIKAAQD+E LQR+GD+LD +IRKAEKE RALENTL LMNSCN+NYRQ+ SKV  TS E + +  L+ Q+R V DK   KR+Q+ ++E++ Q ++E LENL KD+ LY +QV  + + + Q+E+E+ +   K+ERA+  I R +   + +        +E DI  R+ +EFNR   +E+LR  Q+   ++ +  + Y++   +   T  T 
Sbjct:    1 MSDRNSVVNSILQELEWDDGLAIPVANDDNKRLIALVESLNKAGTSAGNEIEHVDDKVTALEAHIKNVRQELMQTQALFQARVHEVETEQHITKVSEREEGRLNQEIRRLDKEISNSKATKNQLENNIFKQTAQLEEMKAQMNWNQQALEAWLEESEKKTEDSLALQKYTRQDEGKIRELSLQLERLTDERNAKKVRLDNLVIETQTTQVELDKAAEQFRQAHQERQDLIRQWEGTIKRMETRDKEIELLAAQLARAKQVCREKEELIKEKQNFLDSEKDNNTEMEKRIGVAERNAGKIRLEYQEAEVQRANFQNELDSLKRTVDRTNKDLELARSDITHLKSETAAKKTKLEVTGRERAGLEDHLKRVQNDRLSAEQQAANMDELMKSEEVGQKEMEKELKSLREQQFRSAQQLHDAKTEERMSEATIMGNRAALRNLNAKIAKLDHDLLKQQEILYNQDFSIQQLQRRISRMSGETNSDEKVALEARIKELNADLDQRVQVATTLSGQLRQLQDEIRRCKRDMDKTKQEKGDLSTKIEELSLHNDNSTREAGRIVQERQSVMVDENLMRLEVKRLRDQLNNRADRVMSEDKRKLQFETAMKERREEIGIHKEMLQAQIRSADDERQQVSSELHEREAKIDKLQKRYEIIMVSMAPPEGEEERSQAYYVIKAAQDREELQRRGDQLDAQIRKAEKECRALENTLRLMNSCNENYRQTFSKVGPTSDEAAQREQLDQQMRAVTDKYKAKRRQIREMEEELQTMQEALENLAKDDALYREQVGQLEQLVGQRERERSEHQAKLERADKAIARAKGPSVAAP-------IEADIGLRELREFNRRVASEVLRVAQSTGEEVASTAESYMQQSGVPLPTTGTG 873          
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Match: gnl|BL_ORD_ID|18313679 (tr|A0A267EZT9|A0A267EZT9_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013471g1 PE=4 SV=1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 418/886 (47.18%), Postives = 628/886 (70.88%), Query Frame = 2
Query:   71 ISNLLKMSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTA 2728
            I   + MS  + V++SIL  L WDD LA+P+AN++NK+L+ L++   K   +  NE++ +++K+ ++  H+KN RQEL  +  L  A++ + ++E H+TKVSERE GRL QE +R D ++     TKN  ENN+FK+T ++EE++ QM W+QQALEAWLEESE+K +D +++QKY RQDE KI+E++L++ERLT   N K+ +L+  V+ET+T QVEL+K  E+FR AH+ER+ L+ QWE TI +++ RD+EI+ L+ +LA  +    + EE +K +  F ++  + N E++K I + ER AGK+R+E ++ E QR NF +EL++LKRT DRT  DLE AR  I+ LK E   K+ +     ++ A LE+ LKRV +D+L+AEQ+A   D++++ +E    + E+ LK  R+ QF++AQ+LHDA+  +R   A+I GN  A+RN+N  I +LDH LLKQQEILYNQDFSIQQL+RRI+RM G+ +++EK ALE +I +L  +L+  V+V  TL+ QL+++QD+IRRCK DM+K   E  +++ K+EE++L N+ S +E  +   +++ +MV++N+M+LEVKRLRD+L ++A++V+S DKR+LQ E A+KER  EI IHK+MLQ+Q RSA++E+ ++SS+L  R +KIDKL+KR+EI+ VSMAPPEGEEE+SQAYYVIKAAQD+E LQR+GD+LD +IRKAEKE RALENTL LMNSCN+NYRQ+ SKV  TS E + +  L+ Q+R V DK   KR+Q+ ++E++ Q ++E LENL KD+ LY +QV  + + + Q+E+E+ +   K+ERA+  I R +   + +        +E DI  R+ +EFNR   +E+LR  Q+   ++ +  + Y++   +   T  T 
Sbjct:   15 IPAAVIMSDRNSVVNSILQELEWDDGLAIPVANDDNKRLIALVESLNKAGTSAGNEIEHVDDKVTALEAHIKNVRQELMQTQALFQARVHEVETEQHITKVSEREEGRLNQEIRRLDKEISNSKATKNQLENNIFKQTAQLEEMKAQMNWNQQALEAWLEESEKKTEDSLALQKYTRQDEGKIRELSLQLERLTDERNAKKVRLDNLVIETQTTQVELDKAAEQFRQAHQERQDLIRQWEGTIKRMETRDKEIELLAAQLARAKQVCREKEELIKEKQNFLDSEKDNNTEMEKRIGVAERNAGKIRLEYQEAEVQRANFQNELDSLKRTVDRTNKDLELARSDITHLKSETAAKKTKLEVTGRERAGLEDHLKRVQNDRLSAEQQAANMDELMKSEEVGQKEMEKELKSLREQQFRSAQQLHDAKTEERMSEATIMGNRAALRNLNAKIAKLDHDLLKQQEILYNQDFSIQQLQRRISRMSGETNSDEKVALEARIKELNADLDQRVQVATTLSGQLRQLQDEIRRCKRDMDKTKQEKGDLSTKIEELSLHNDNSTREAGRIVQERQSVMVDENLMRLEVKRLRDQLNNRADRVMSEDKRKLQFETAMKERREEIGIHKEMLQAQIRSADDERQQVSSELHEREAKIDKLQKRYEIIMVSMAPPEGEEERSQAYYVIKAAQDREELQRRGDQLDAQIRKAEKECRALENTLRLMNSCNENYRQTFSKVGPTSDEAAQREQLDQQMRAVTDKYKAKRRQIREMEEELQTMQEALENLAKDDALYREQVGQLEQLVGQRERERSEHQAKLERADKAIARAKGPSVAAP-------IEADIGLRELREFNRRVASEVLRVAQSTGEEVASTAESYMQQSGVPLPTTGTG 893          
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Match: gnl|BL_ORD_ID|18254702 (tr|A0A267E7S6|A0A267E7S6_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013471g4 PE=4 SV=1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 418/886 (47.18%), Postives = 628/886 (70.88%), Query Frame = 2
Query:   71 ISNLLKMSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTA 2728
            I   + MS  + V++SIL  L WDD LA+P+AN++NK+L+ L++   K   +  NE++ +++K+ ++  H+KN RQEL  +  L  A++ + ++E H+TKVSERE GRL QE +R D ++     TKN  ENN+FK+T ++EE++ QM W+QQALEAWLEESE+K +D +++QKY RQDE KI+E++L++ERLT   N K+ +L+  V+ET+T QVEL+K  E+FR AH+ER+ L+ QWE TI +++ RD+EI+ L+ +LA  +    + EE +K +  F ++  + N E++K I + ER AGK+R+E ++ E QR NF +EL++LKRT DRT  DLE AR  I+ LK E   K+ +     ++ A LE+ LKRV +D+L+AEQ+A   D++++ +E    + E+ LK  R+ QF++AQ+LHDA+  +R   A+I GN  A+RN+N  I +LDH LLKQQEILYNQDFSIQQL+RRI+RM G+ +++EK ALE +I +L  +L+  V+V  TL+ QL+++QD+IRRCK DM+K   E  +++ K+EE++L N+ S +E  +   +++ +MV++N+M+LEVKRLRD+L ++A++V+S DKR+LQ E A+KER  EI IHK+MLQ+Q RSA++E+ ++SS+L  R +KIDKL+KR+EI+ VSMAPPEGEEE+SQAYYVIKAAQD+E LQR+GD+LD +IRKAEKE RALENTL LMNSCN+NYRQ+ SKV  TS E + +  L+ Q+R V DK   KR+Q+ ++E++ Q ++E LENL KD+ LY +QV  + + + Q+E+E+ +   K+ERA+  I R +   + +        +E DI  R+ +EFNR   +E+LR  Q+   ++ +  + Y++   +   T  T 
Sbjct:    7 IPAAVIMSDRNSVVNSILQELEWDDGLAIPVANDDNKRLIALVESLNKAGTSAGNEIEHVDDKVTALEAHIKNVRQELMQTQALFQARVHEVETEQHITKVSEREEGRLNQEIRRLDKEISNSKATKNQLENNIFKQTAQLEEMKAQMNWNQQALEAWLEESEKKTEDSLALQKYTRQDEGKIRELSLQLERLTDERNAKKVRLDNLVIETQTTQVELDKAAEQFRQAHQERQDLIRQWEGTIKRMETRDKEIELLAAQLARAKQVCREKEELIKEKQNFLDSEKDNNTEMEKRIGVAERNAGKIRLEYQEAEVQRANFQNELDSLKRTVDRTNKDLELARSDITHLKSETAAKKTKLEVTGRERAGLEDHLKRVQNDRLSAEQQAANMDELMKSEEVGQKEMEKELKSLREQQFRSAQQLHDAKTEERMSEATIMGNRAALRNLNAKIAKLDHDLLKQQEILYNQDFSIQQLQRRISRMSGETNSDEKVALEARIKELNADLDQRVQVATTLSGQLRQLQDEIRRCKRDMDKTKQEKGDLSTKIEELSLHNDNSTREAGRIVQERQSVMVDENLMRLEVKRLRDQLNNRADRVMSEDKRKLQFETAMKERREEIGIHKEMLQAQIRSADDERQQVSSELHEREAKIDKLQKRYEIIMVSMAPPEGEEERSQAYYVIKAAQDREELQRRGDQLDAQIRKAEKECRALENTLRLMNSCNENYRQTFSKVGPTSDEAAQREQLDQQMRAVTDKYKAKRRQIREMEEELQTMQEALENLAKDDALYREQVGQLEQLVGQRERERSEHQAKLERADKAIARAKGPSVAAP-------IEADIGLRELREFNRRVASEVLRVAQSTGEEVASTAESYMQQSGVPLPTTGTG 885          
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Match: gnl|BL_ORD_ID|23921288 (tr|K1QZ54|K1QZ54_CRAGI Coiled-coil domain-containing protein 39 OS=Crassostrea gigas OX=29159 GN=CGI_10018517 PE=4 SV=1)

HSP 1 Score: 760.755 bits (1963), Expect = 0.000e+0
Identity = 439/870 (50.46%), Postives = 608/870 (69.89%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPS 2722
            +SIL+ + WD+ L++P+AN ENK L   I  +QK+ +   N+L++ ++++++MS HLKN RQELQH+  L NA+ ++  +E+HM  +++RE GRLKQE ++ + +++E  + KNVFENN+FK+T ++EE+++QM WDQQALEAWLEES RK +D M++QKY RQDE+KIKE++L MERLT    +K+  LE E  ET TAQ+EL+KT E+FR AH+ER+ L+ QWE TI Q++RRD+E+D L+ KLA ++ E  K EE +K +  F EN +  NKE +K I   ER + K R++ ++ ETQR  F  EL+ALKRT DRTA+DLE  R  +SQLKK+  EK ++   A      L E+LK      L+AE+RA   D++LEE+E+   +++Q LK  RDLQF+  QELH+ +V +RN  A IQG+  AIRN+N+ I ++D   LKQQEI+YNQDF++QQLERRINRMQG+ SNEEK ALE KI  L  +L+        LT QLKR+QDDIRR K D+EK   E  ++T K+EE+NL N++S++ELRK   +K+ +MV+ NI+KLE+KRLR+ L SKA++V  L+KRRLQLE A+ ER  EI IHK+ML +Q R+A  E+ +IS++L  RISKI+KL+ R+EIL VSMAPPEGEEE+SQAYYVIKAAQ+KE LQR+GD+LD KIRKAEKEIRALENTL LMN+ N+ YR+S +KVT++S E   K  L  Q+R VMDK  +KR+Q+ +L++D Q +  TL+NL++DE  Y + +     + +Q  KE      K+ER      +   E+  + KA+     E D   R+ +EFNR  + ++   IQ H PDI      Y    NL   TPS
Sbjct:    6 NSILSEIEWDEGLSMPVANAENKALEDQIQDRQKKVVAATNDLEEFDDRIHAMSEHLKNVRQELQHTQGLTNARKKEIDTENHMLMIAQREEGRLKQEVRKLEKELEEFKEKKNVFENNIFKQTQKLEEMKSQMNWDQQALEAWLEESARKDEDSMAIQKYTRQDESKIKELSLRMERLTDDSKQKKHVLEHETTETLTAQIELDKTAEDFRKAHQERQNLIEQWEHTIEQMQRRDKEMDLLAAKLARVKAEVRKREENIKEKQYFLENEIENNKECEKKISQAERMSAKFRIDYQEAETQRVQFQDELDALKRTVDRTATDLEVTRSQVSQLKKDVQEKTNKLQMAKDLRETLVEKLKIATESTLSAEERAARMDELLEEEEKVQKEYDQKLKALRDLQFRKTQELHECKVKERNTEAEIQGSQAAIRNLNSKISKVDTDALKQQEIIYNQDFAVQQLERRINRMQGERSNEEKIALEAKIKDLNDDLDQRNNTHTLLTLQLKRLQDDIRRVKRDLEKSGAEKGDMTSKIEELNLYNDSSEKELRKIIRNKQDMMVDQNILKLEIKRLREMLNSKADEVFGLEKRRLQLETAMNERHQEIGIHKEMLDAQYRAASAERQQISAELHERISKIEKLKSRYEILMVSMAPPEGEEERSQAYYVIKAAQEKEELQREGDDLDAKIRKAEKEIRALENTLKLMNNRNETYRKSFNKVTESSDEMEEKGQLEEQMRAVMDKFKYKRRQIRELQEDLQTMSNTLDNLSRDEQAYEEMIEEKENKRLQLNKELDDLRNKLERVAKQNSKYARELRSAKKAKGETNEEKDFDVRELREFNRQIMQQIGDVIQKH-PDIGEAVNMYFSQANLPPPTPS 874          
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Match: gnl|BL_ORD_ID|23506780 (tr|A0A210Q7E9|A0A210Q7E9_MIZYE Coiled-coil domain-containing protein 39 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20459 PE=4 SV=1)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 427/873 (48.91%), Postives = 611/873 (69.99%), Query Frame = 2
Query:  113 SSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTAS 2731
            +SIL+ + WD+ L++P+AN +NKKL   +  KQ++ ++NKN ++++ ++L++MS HLKN RQEL H+  L  A+ ++ ++E+HM +++ERE GRL+QE  + +  ++E+ + KN+FENN+FK+T ++EE+++QM WDQQALEAWLEES RK +D M++QKY R DE+KIKE++L M RLT    +KR  L+ E  ET TAQ+EL+KT E+FR AH+ER+ L+ QWE TI Q++RRD E+D L+ +LA ++ E  + EEA+K + +F E  V+ NKE +K I + ER A + R++ ++ ET R  F  EL+ALKRT DRTA+DLE  R  ++ LKK+  +K +R  +A +    L ++LK      L+AE+RA   D+ML++++R   + +Q LKH RDLQF   QELHD+++ +RN  A IQG+  AIRN+N+ I +LD   LKQQEI+YNQDF++QQ+ERRINR+QG+ SNEEK  LE KI  LT +LE        LT QLKR+QDDIRR + ++EK   E  + T K+EE+NL N +S++ELR   + K+ LMV+ NI+KLE+KRLRD L  +A+ VL+++KRRLQL+ A+KER  EI IH +MLQ+Q R A EE+ +IS++L  RISKIDKL+KR+EIL VSMAPPEGEEE+SQAYYVIKAAQ+KE LQR+GD+LD +IRKAEKEIRALENTL LMN+ N+ YR+S +KVTD S +   K  L  Q+R VMDK  +KR+Q+ +L++D Q +  TL+NL +D   Y + ++    +++Q  KE   Q  K+ERA     +   E+  + K++     E D   R+ +EFN+  ++++   IQ H PD+      Y    NL   TP   S
Sbjct:    6 NSILSEIEWDEGLSMPVANADNKKLEDQVQQKQRKIVSNKNNVEEIEDRLHAMSEHLKNVRQELGHTQGLTGARNKEIETENHMLQIAEREEGRLQQEISKLEKDLEEIKEKKNMFENNIFKQTQKLEEMKSQMNWDQQALEAWLEESARKDEDSMAIQKYTRHDESKIKELSLRMVRLTEESQKKRKVLDHETTETLTAQIELDKTAEDFRQAHQERQELIEQWENTIEQMQRRDHEMDLLAAQLARVKAEVRRREEAIKEKMQFLEGEVDNNKEQEKKISIAERVAARTRIDHQEAETNRVQFSDELDALKRTVDRTANDLESTRSQVTYLKKDVQDKSNRLQQAKELRETLVDKLKIATESTLSAEERAARFDEMLQDEDRTQAEIDQQLKHLRDLQFHKTQELHDSKIKERNTEAEIQGSQAAIRNLNSKITKLDTDSLKQQEIIYNQDFAVQQVERRINRIQGERSNEEKVHLESKIKDLTDDLEQKNNTHTLLTLQLKRLQDDIRRVRRELEKSGAEKGDFTSKIEELNLYNTSSERELRNIISSKQNLMVDQNILKLEIKRLRDMLNGRADDVLNMEKRRLQLDTAMKERRHEISIHTEMLQAQIRVANEERGQISAELHERISKIDKLKKRYEILMVSMAPPEGEEERSQAYYVIKAAQEKEELQREGDDLDARIRKAEKEIRALENTLKLMNNRNETYRKSFNKVTDQSDDMEEKQQLEEQMRAVMDKYKYKRRQIRELQEDLQTMSSTLDNLVRDSGAYEEMIDEKKNKVLQLSKEIDDQRAKLERAMKSNSKYARELRSAKKSKGETPEERDFHVRELREFNKSIMSQIGDIIQTH-PDVGETVHLYFSQANLPPPTPRVGS 877          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Cavefish
Match: ENSAMXT00000019717.2 (coiled-coil domain containing 39 [Source:NCBI gene;Acc:103022160])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 342/873 (39.18%), Postives = 559/873 (64.03%), Query Frame = 2
Query:  107 VISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPST 2725
            + S++L+ + WDD  A+P+AN  NK L   +  K K+  N +NEL +  +++++M+ H+K+ +QEL H+  L  A+ ++ KSE H   ++ERE+GRL+QE  + ++++  L + KN  ENN+FK T  +EEL++++ WDQQAL+ WLEES RK +D M++ KYA QDE++I+E+ L +ERLT   N+KR  L+ ++ ET   QV ++KT E FR A+ ER+ L+ QWE TI Q+++RD+E+   +  LA    E  + E  +K +  F    V  NKE ++ I + ERQ  +L+ + ++ E+ R     ELE LK T DR A+++E  R  ++ +KK+   K  +  EA  ++A LEE+L+      L+ E+RA   +Q+L +QE +  + +  LK  R+L F+ +QEL      ++N TA + G+  A+ +++  +++LD S L+Q+ I+Y QDF IQ LER++  ++G+ + EE++ALE++I++L+  LE   +  A L TQLK++QDDIR    + EK   E  ++T K+EE+   ++T ++EL+K    K+  M+++NI+++ VKRLRD LYS A+ + SL+KR+LQL+ A+KER  EIR+H++ML  Q +  ++E+  +S+++  R+SKIDK++KR+EIL  +MAPPEGEE++SQAYY+IKAAQ++E LQR+GDELD +IRK+EKEI A+ENT  ++N+ N  YR+S +KVT++S E   K  L+ Q R   +K   KR+Q+ +L++D Q +  +L +L ++E       + +  ++    KE   Q  K++R      +L  EI  + K +E    E DI  ++ K+ NR  VN++L  +   +PD+    + Y    +L   +P +
Sbjct:    1 MASAVLSEIAWDDGFAIPVANARNKALEEELQRKLKKKANIENELSQHEDRISAMTEHMKDVKQELSHTQALCMAREKEEKSEMHFKALAEREMGRLRQELAQLENELGSLRERKNTRENNIFKATRRIEELKSRLNWDQQALDTWLEESARKDEDTMAIIKYAHQDESRIRELTLSIERLTQEANQKRKTLDNQLTETIMTQVAVDKTTEIFRQANLERQELIHQWENTIEQMRKRDQEMQQCALMLAESNHEIREREALIKEKKNFLSGEVENNKECEREITIAERQFIRLQQQLQEQESSRMRVKDELETLKGTVDRAATEVESMRSKLTSVKKDISNKTTKLEEAWLQNAALEEKLQLATEAALSVEERAEQMEQILSDQELHLKEIDAQLKRQRELLFRKSQELQTLRAKEKNATAELSGSRMALSSLDNRLNKLDQSSLQQEGIMYTQDFQIQLLERKMAHLRGEVNTEERQALEKRISELSSALEEKKETAAMLATQLKKLQDDIRCVSKETEKTGAEKRDLTTKIEELTRFSDTMEKELKKLHLQKQDNMIDNNILRMVVKRLRDHLYSGADGMFSLEKRQLQLQTAMKERQEEIRLHREMLTKQLKITDQERQGLSAEVHERLSKIDKIKKRYEILITAMAPPEGEEDKSQAYYIIKAAQEREELQRKGDELDAQIRKSEKEITAMENTFHVINNRNATYRKSSNKVTESSPEYQEKMKLDEQKRAAEEKYKHKRRQIRELQEDIQGMSSSLNSLLQEESAEKRSSDDVEARIQLLNKELHSQQAKLDRVTKQCSKLTKEIRSAKKTKEQTFEERDIDLKELKDLNR-TVNKMLLEVMEEHPDLQPMLQMYFIQASLPLPSPGS 872          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Nematostella
Match: EDO34870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN80])

HSP 1 Score: 65.4698 bits (158), Expect = 1.360e-11
Identity = 49/165 (29.70%), Postives = 87/165 (52.73%), Query Frame = 2
Query: 2210 MNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNL 2704
            MNS N+ YR+S +KV +TS E   K  L  Q+R VMDK  +KR+Q+ +L++D   ++ TL+ L  DE    + ++   +++   ++E   Q  K ERA   + ++   +  + K+      E DI+ R+ ++FN   + ++   I + YPD+  +   Y     L
Sbjct:    1 MNSRNETYRKSFNKVDETSDEFDEKQRLEEQMRAVMDKYKYKRRQIRELQEDLGTMQVTLDKLTADEQGMVEVIDEKQQKMQNLQRELDDQKGKRERAGKQVSKIARAVRSAKKSRGELHEEKDIELRELRDFNSKTMKQMGEVIHS-YPDLAPSVNMYFGQAGL 164          
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Medaka
Match: ENSORLT00000011041.2 (coiled-coil domain-containing protein 39 [Source:NCBI gene;Acc:101164253])

HSP 1 Score: 323.939 bits (829), Expect = 9.095e-95
Identity = 272/885 (30.73%), Postives = 491/885 (55.48%), Query Frame = 2
Query:  101 SDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQ--------FKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEIL--ESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANT-KQYLEMGNLLTWTPS 2722
            S+ + ++L  + WD   AVP  NEE+K L+ +I  K+KQ        +   E+   M   L++ RQEL+++  L  A  ++ + E H+T ++ERE G L Q   + + +++   +   + E NL +   ++E+ R QM+WDQQ +EA+LEES +K +D M+M K ++Q++ K+K + L +E+    +NE R   E+E+ ET + QV L+   +  +  H + + L+ +WE T+ Q+KR+D E+   + +LA    E  +   A+   N+  + L N NKE +K + +  RQA KL+ E R+ E        +L+  KR  D   S +      IS+ KKE  EK+D+   A   +A L E+L +V   +L  + R    +Q+L E E+       A+K   D+Q        +   ++L   +  ++     I G    +  + + + +L   + ++ ++L NQ+  +  L+ ++ R+QGD   +EKE L+ K+ +LTK+LE   ++   ++ ++K  +  IR  +  +EK   +   + EK EE+ +  + +++EL++    K+  ++E  +++LEV R R+ L+ K + V SL+KR+L+L+ A+KER  EI++  ++++ Q +++E+EK+K++ +L  ++ KID+++ RFE+L +S+  PEGE E+ QA+ + KAA +KE L++Q   LD ++ K E E +ALENT+ + N  N + R+S+ KV ++S E   K  L  QL+       FK++Q+++L+ D + +  +L+ L +D+ +   +++     + + +KE     EKIERA     +L  +I   + +KAE F+  E DI+  + KE N+  VN +L        D+     K + + G LL   PS
Sbjct:    2 SNFVEAVLEEMSWDRRYAVPELNEEHKALIEMIYKKEKQLAEVSARAETKKEQRKMMELKLQHSRQELENTEALLKANEKEIEFEQHLTALAERESGHLAQLTAKTEKELRSSKEKAEMIEENLSEAKEKLEKFRQQMQWDQQTMEAFLEESAQKEEDTMAMVKNSQQNKQKVKSLTLAIEKKRVELNENRKAYEKELTETTSVQVALKTMRDTMQQVHLDNQQLIQKWENTVKQMKRQDAEMQQCALELAQANQEVREKNAAIADLNQLLQTLQNNNKETEKKMAVTNRQAAKLQQELREEENICVKLQEQLDNCKRELDNINSGVRVLAAHISKSKKELQEKKDKVHTAEAYNAALREKLAKV--SQLAEQDRVAELEQILREGEK-------AIKEV-DVQQRFFMGELYLQKEQLKVLKGKEKESMVLISGAKVNMNTLQSRLGKLKTEMEEKDKVLRNQESELLTLKIKLARLQGDIPVDEKEMLKAKLAELTKDLEEKKEMDRMMSKEVKEGEHQIRCFRKILEKSEAQRREMLEKAEELGILCDGNEKELKRVSLRKQNTILEQKMLQLEVNRKRELLHKKEDSVQSLEKRKLELQAAMKERDEEIKVFLNLIKKQLKNSEKEKHKLNIELNEKLMKIDQIKLRFEMLALSIGAPEGEAERVQAHCITKAALEKEELKQQKSSLDAEVEKMELETKALENTVKVFNHFNSHLRKSLLKVDESSPEYQEKLQLEEQLKATQKTIRFKKQQIQELQRDLEDMDCSLKRLLQDKQVEKAKIDHKQSIITKLKKEMASMQEKIERATKECSKLTKKIRSHKKTKAETFE--EKDIRLVELKEVNK-KVNRMLNEAMEDQSDLRGVLEKHFQKAGRLLPPPPS 873          
BLAST of coiled-coil domain-containing protein 39 vs. Planmine SMEST
Match: SMESG000072034.1 (SMESG000072034.1)

HSP 1 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 483/484 (99.79%), Postives = 483/484 (99.79%), Query Frame = 2
Query: 1508 MQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILXXXXXXXXXXXXXXXXXXRAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPSTASIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQSSRAAAGINVVQMGFGATPSQRAAMPLTPPIRST 2959
            MQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILEQLVQKEKEKQKQMEKIERAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTP TASIKSSNTGSARSSISGSQSALTASGSARSSTASSVAASISTRQSSRAAAGINVVQMGFGATPSQRAAMPLTPPIRST
Sbjct:    1 MQGDHSNEEKEALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILEQLVQKEKEKQKQMEKIERAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLRCIQNHYPDIVANTKQYLEMGNLLTWTPPTASIKSSNTGSARSSISGSQSALTASGSARSSTASSVAASISTRQSSRAAAGINVVQMGFGATPSQRAAMPLTPPIRST 484          
BLAST of coiled-coil domain-containing protein 39 vs. Planmine SMEST
Match: SMESG000072035.1 (SMESG000072035.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 327/327 (100.00%), Postives = 327/327 (100.00%), Query Frame = 2
Query:   89 MSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRT 1069
            MSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTLNNKNELDKLNEKLNSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRT
Sbjct:    1 MSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTLNNKNELDKLNEKLNSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRT 327          
BLAST of coiled-coil domain-containing protein 39 vs. Planmine SMEST
Match: SMESG000048137.1 (SMESG000048137.1)

HSP 1 Score: 304.294 bits (778), Expect = 7.223e-88
Identity = 234/773 (30.27%), Postives = 421/773 (54.46%), Query Frame = 2
Query:   98 ESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTXXXXXXXXXXXXXXXSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREIGRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALEAWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLEREVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHLSNKL----ALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLRMEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQXXXXXXXXXXXXXXAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQALKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSLLKQQEILYNQDFSIQQLERRINRMQGDHSNEEKE-ALEEKINQLTKELEATVKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQQELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQAIKERFAEIRIHKDMLQSQTRSAEEEKNKI---SSDLKSRISKIDKLEKRFEILTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRALENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKRKQLEQLEDDYQVLKETLE 2392
            E ++++ IL  LGWD  +++P+ANE NK+L +LI   +K  + NK+E+  L EKL  ++ H KNCR E  +   + NA     ++E+H+TK+SERE+GR+KQ+      ++ E+ + KN++EN+ + K+  +EE++ +M+WDQQ LE +L E   + D    + +Y RQD ++   +N ++  L     + R  L+  V+ETK  QVEL+KT E++R  H+ R+ ++  W+ TI Q+ +RD +I  +SN L    A LR    + E  ++ +   + ++   N  I+K +   +++   LR    ++  +      ELE L+ T +RTA D E AR AI  +K +K     +      K   L+ +   ++SD    ++   +A+  L+E+E   ++  + L   R+ Q+K A +L   +  +RN  A        +RN+ +   + +  L+K  E++Y  D +IQ L+ RI+ ++GD+++ E E  L+ +I  L +EL++  +V   L+  + R  ++ R  + ++EK+        EK+    +  + ++ +L+K +  +E  +V  N+   ++++L+        +V  L  ++  L   I ER  EI   K++L+ + R  E +   I   SS++K R+++      ++E++    +     E        I+AA  KE LQ+ GDELD+KIRK EKEIRALENT++L+N+CN+++R   +K T +S E   K   +  L+  M   + KR Q+  +  + + + ETL+
Sbjct:    2 EFEIVNDILIELGWDKGISIPVANETNKELCYLIRDTKKDVILNKHEILSLQEKLTVIAEHKKNCRLERSNCESIVNALNHDIETENHLTKISERELGRIKQDIDNHQKQLVEIAKRKNIYENSNYAKSMLLEEIKEKMQWDQQDLEKYLAECNNQEDLEDYLSQYTRQDNSRSAVLNHQIMELIDVQTKARKNLDEAVIETKILQVELDKTAEQYRNEHQARKEVIKMWQTTIEQMSKRDHDILRVSNDLNEHKAFLR----QTELEVQEKKALFHDIGTDNTNIEKLVSRADKETAMLREVLSEIMKESDKIRRELEFLQSTIERTARDTEVARSAIRHMKDQKEFFLTKIKNLTTKTDGLQNKFNLLLSDSYDYQKAYQIAESSLKEEELYILQLNEELNRLRERQYKLALDLAAQQTVKRNKEADGTTYRANLRNLISRKGKCESDLMKLDELIYKTDLTIQNLQHRISTIEGDNTSSELENELKARIVLLQEELDSINRVSKQLSEMINRFVNEARIHRMNIEKLGGLKKVEIEKINAEQITIDNAKIQLKKVKTSREDTLVYRNMENFQLRKLKALCDMNFNKVTDLAIQKESLNAIINERRVEINFFKEILKKEIRKLENDFANIQKESSEVKHRLNRTI---IKYEVI----SKTSNFENNDGVVATIEAAVRKEELQKYGDELDLKIRKCEKEIRALENTVVLLNTCNESFRYLYTKATSSSTELIVKEQADNDLKAEMKMFSLKRYQMRLVLKEIEKVNETLD 763          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC390.000e+040.89coiled-coil domain containing 39 [Source:HGNC Symb... [more]
CCDC391.668e-16338.59coiled-coil domain containing 39 [Source:HGNC Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG173871.444e-3522.95gene:FBgn0037276 transcript:FBtr0078880[more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC390.000e+045.49coiled-coil domain containing 39 [Source:HGNC Symb... [more]
CCDC390.000e+045.52coiled-coil domain containing 39 [Source:HGNC Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc390.000e+043.51coiled-coil domain containing 39 [Source:NCBI gene... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc390.000e+042.52coiled-coil domain containing 39 [Source:MGI Symbo... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0V9R4|CCD39_XENTR0.000e+043.51Coiled-coil domain-containing protein 39 OS=Xenopu... [more]
sp|P0CK98|CCD39_DANRE0.000e+043.01Coiled-coil domain-containing protein 39 OS=Danio ... [more]
sp|Q9UFE4|CCD39_HUMAN0.000e+040.89Coiled-coil domain-containing protein 39 OS=Homo s... [more]
sp|Q9D5Y1|CCD39_MOUSE0.000e+042.52Coiled-coil domain-containing protein 39 OS=Mus mu... [more]
sp|E2R1I5|CCD39_CANLF0.000e+040.32Coiled-coil domain-containing protein 39 OS=Canis ... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|181876040.000e+047.39tr|A0A1I8GAL7|A0A1I8GAL7_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183136790.000e+047.18tr|A0A267EZT9|A0A267EZT9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182547020.000e+047.18tr|A0A267E7S6|A0A267E7S6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|239212880.000e+050.46tr|K1QZ54|K1QZ54_CRAGI Coiled-coil domain-containi... [more]
gnl|BL_ORD_ID|235067800.000e+048.91tr|A0A210Q7E9|A0A210Q7E9_MIZYE Coiled-coil domain-... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000019717.20.000e+039.18coiled-coil domain containing 39 [Source:NCBI gene... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO348701.360e-1129.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000011041.29.095e-9530.73coiled-coil domain-containing protein 39 [Source:N... [more]
back to top
BLAST of coiled-coil domain-containing protein 39 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000072034.10.000e+099.79SMESG000072034.1[more]
SMESG000072035.10.000e+0100.00SMESG000072035.1[more]
SMESG000048137.17.223e-8830.27SMESG000048137.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021868 ID=SMED30021868|Name=coiled-coil domain-containing protein 39|organism=Schmidtea mediterranea sexual|type=transcript|length=3222bp
TATTTAACTTTTTTCTTTGAATTTGATATTTGTTTTAACTGTTCTATTCG
ATGGCAACTGTAGAAAACTAATTTCAAATTTATTGAAAATGTCTGGTGAG
TCTGATGTTATTAGTTCTATATTAACCGGATTGGGGTGGGATGACAGTTT
GGCCGTTCCAATTGCAAATGAGGAAAATAAGAAATTGTTACATTTAATAG
ATTTGAAACAGAAACAAACATTGAATAACAAGAATGAGCTTGATAAGTTG
AACGAAAAGCTGAATTCAATGTCGAATCATTTAAAAAACTGCAGACAAGA
ATTACAGCACTCGTTGCAGTTGCGAAACGCGAAGATCGAACAAAACAAAT
CTGAAGATCACATGACCAAAGTTAGTGAGAGAGAAATCGGTCGTTTAAAG
CAGGAAAATAAACGATTCGACAGTAAAATGAAAGAGCTTCATCAAACCAA
AAATGTGTTTGAGAACAATTTGTTCAAAAAAACAACGGAAATGGAAGAGC
TGAGGAATCAAATGAAATGGGATCAGCAAGCCCTTGAAGCATGGCTCGAG
GAAAGTGAGAGAAAGGGCGATGACATTATGTCGATGCAGAAATACGCTAG
ACAAGATGAGGCAAAGATCAAGGAAATGAATCTCGAGATGGAGCGTCTGA
CCAGCGCCATCAACGAGAAGAGATCAAAACTGGAGAGAGAAGTCGTGGAA
ACGAAAACAGCTCAAGTGGAATTAGAGAAAACGAATGAGGAATTCCGAAC
TGCCCACGAAGAGCGTGAAACTCTCCTTATCCAATGGGAGGCGACGATTG
GCCAATTGAAACGACGAGATGAGGAAATCGATCATTTGTCTAATAAATTG
GCGCTTTTGCGGCTGGAAGCAGGAAAGCTCGAGGAGGCGATGAAGGCGAG
AAATGAATTTTACGAGAATCTCGTCAATACCAACAAGGAAATTGACAAGA
ACATCGATTTGGTAGAAAGACAAGCTGGTAAGTTGCGAATGGAACAGAGA
GATGTGGAAACCCAGCGGTTCAATTTCCATAGCGAGCTCGAGGCATTGAA
GCGCACCTGTGATCGAACAGCGTCGGATTTGGAGCAGGCCAGAGTTGCCA
TCTCACAGCTGAAAAAAGAGAAGCTTGAGAAGGAAGATCGCAAATTAGAA
GCTGTTCAGAAGCATGCCGACCTTGAGGAGCGCTTAAAACGAGTCGTCAG
CGACAAGCTAACTGCTGAACAGCGAGCGAATCTAGCAGATCAAATGCTTG
AGGAACAAGAGCGGAACCATGTGAAGTTTGAACAGGCATTGAAACACACT
CGAGATCTGCAGTTTAAGACAGCCCAAGAGCTCCACGATGCTGAAGTAAA
CCAGAGGAATATTACCGCTAGTATTCAAGGCAATTCTACCGCCATCAGGA
ACATGAATACGAGTATTCACAGGCTCGATCATTCCCTCCTCAAGCAGCAG
GAGATCCTTTACAACCAAGATTTCTCAATTCAGCAGCTGGAAAGGCGTAT
CAACCGGATGCAAGGAGACCATTCTAATGAGGAGAAGGAAGCGCTGGAAG
AGAAAATCAACCAATTGACAAAAGAATTGGAAGCCACAGTGAAGGTGGTA
GCGACACTGACCACGCAATTGAAGCGAGTCCAGGATGACATACGCCGGTG
CAAATATGACATGGAGAAGATTACCCACGAGAATACAAATATAACCGAGA
AATTGGAGGAAGTCAATTTGCAGAATGAAACTAGTCAGCAGGAGCTGAGA
AAGAGCCGTGCTGATAAGGAGAAATTGATGGTCGAGGACAACATAATGAA
ATTGGAGGTGAAAAGATTGCGGGATCGATTGTACAGCAAGGCAGAGCAAG
TTCTCTCTTTAGACAAACGCCGACTCCAATTGGAGCAAGCAATCAAGGAG
AGGTTTGCAGAAATCAGGATCCACAAGGATATGCTACAATCACAAACTCG
CTCAGCTGAAGAGGAAAAGAATAAGATTAGCAGTGACTTGAAATCTAGAA
TTTCTAAAATAGATAAATTGGAAAAGAGATTTGAAATATTGACTGTGTCT
ATGGCTCCACCAGAAGGAGAGGAAGAGCAATCACAAGCATATTATGTTAT
CAAGGCTGCCCAAGATAAGGAGGCATTGCAGCGGCAAGGAGATGAACTGG
ATGTGAAAATTAGGAAAGCCGAAAAAGAAATTAGAGCCCTTGAGAATACA
TTAATGCTGATGAACAGTTGCAATCAGAATTACAGGCAGAGCATGTCCAA
GGTTACCGACACGAGTGCTGAGCAGAGCACAAAAAATGATTTGAATGTCC
AATTGAGGACTGTGATGGACAAATGCAATTTTAAAAGGAAGCAACTAGAA
CAATTAGAAGATGACTATCAGGTGCTGAAGGAAACATTGGAAAATTTAAA
CAAGGATGAAGTTCTTTACGGGGATCAGGTGAATGGAATACTTGAGCAAT
TGGTACAGAAAGAAAAAGAGAAGCAGAAGCAGATGGAGAAAATTGAGAGA
GCAGAGAATATGATAATCAGATTGCGAAATGAAATATTGGAATCCTCGAA
AGCTGAAGAATTCCAGTTGGTGGAGGACGATATAAAGGCCAGAGACAAAA
AGGAGTTCAACAGAATCGCTGTTAATGAGCTTCTGCGCTGCATTCAGAAT
CATTATCCAGATATCGTGGCCAACACCAAGCAATACCTGGAAATGGGCAA
CTTGTTGACGTGGACACCATCAACAGCTTCCATCAAATCTTCAAATACCG
GGTCGGCGCGTTCATCGATCAGTGGCAGTCAATCAGCCCTCACTGCATCG
GGATCAGCGAGGTCGAGTACTGCATCGAGCGTGGCGGCCTCCATCTCAAC
CAGGCAATCATCGAGAGCGGCGGCTGGAATCAATGTTGTCCAAATGGGAT
TCGGAGCTACCCCCTCACAGAGAGCAGCAATGCCGCTGACACCACCAATA
AGAAGCACTGTTAAATCTCCCGCCGGTTCTGTCGGTTCCTCATCGACTGT
CAGTAGGAACAGTAAAGGTAGCACCGGGACTGGTAGGAGCCGGGGCAGCC
GTATTGGATAACAATTATAATTGATTTGTCATCAACTATGATGCTGACAA
CGATTTTCCTGTTTTCAATAAATTATTGTCTTATGGTTAGTTACCGATGA
TCCGGCACTAAGAACAAGTCTTACAGACAATGTGTACAGATCCTAATGAT
TTATTCTTATGGTATTAGGGAG
back to top

protein sequence of SMED30021868-orf-1

>SMED30021868-orf-1 ID=SMED30021868-orf-1|Name=SMED30021868-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=991bp
MSGESDVISSILTGLGWDDSLAVPIANEENKKLLHLIDLKQKQTLNNKNE
LDKLNEKLNSMSNHLKNCRQELQHSLQLRNAKIEQNKSEDHMTKVSEREI
GRLKQENKRFDSKMKELHQTKNVFENNLFKKTTEMEELRNQMKWDQQALE
AWLEESERKGDDIMSMQKYARQDEAKIKEMNLEMERLTSAINEKRSKLER
EVVETKTAQVELEKTNEEFRTAHEERETLLIQWEATIGQLKRRDEEIDHL
SNKLALLRLEAGKLEEAMKARNEFYENLVNTNKEIDKNIDLVERQAGKLR
MEQRDVETQRFNFHSELEALKRTCDRTASDLEQARVAISQLKKEKLEKED
RKLEAVQKHADLEERLKRVVSDKLTAEQRANLADQMLEEQERNHVKFEQA
LKHTRDLQFKTAQELHDAEVNQRNITASIQGNSTAIRNMNTSIHRLDHSL
LKQQEILYNQDFSIQQLERRINRMQGDHSNEEKEALEEKINQLTKELEAT
VKVVATLTTQLKRVQDDIRRCKYDMEKITHENTNITEKLEEVNLQNETSQ
QELRKSRADKEKLMVEDNIMKLEVKRLRDRLYSKAEQVLSLDKRRLQLEQ
AIKERFAEIRIHKDMLQSQTRSAEEEKNKISSDLKSRISKIDKLEKRFEI
LTVSMAPPEGEEEQSQAYYVIKAAQDKEALQRQGDELDVKIRKAEKEIRA
LENTLMLMNSCNQNYRQSMSKVTDTSAEQSTKNDLNVQLRTVMDKCNFKR
KQLEQLEDDYQVLKETLENLNKDEVLYGDQVNGILEQLVQKEKEKQKQME
KIERAENMIIRLRNEILESSKAEEFQLVEDDIKARDKKEFNRIAVNELLR
CIQNHYPDIVANTKQYLEMGNLLTWTPSTASIKSSNTGSARSSISGSQSA
LTASGSARSSTASSVAASISTRQSSRAAAGINVVQMGFGATPSQRAAMPL
TPPIRSTVKSPAGSVGSSSTVSRNSKGSTGTGRSRGSRIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033290CCDC39
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0036159inner dynein arm assembly
Vocabulary: cellular component
TermDefinition
GO:0005930axoneme
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 266..300
NoneNo IPR availableCOILSCoilCoilcoord: 204..238
NoneNo IPR availableCOILSCoilCoilcoord: 52..93
NoneNo IPR availableCOILSCoilCoilcoord: 308..349
NoneNo IPR availableCOILSCoilCoilcoord: 3..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 471..517
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 484..517
IPR033290Coiled-coil domain-containing protein 39PANTHERPTHR18962COILED-COIL DOMAIN-CONTAINING PROTEIN 39coord: 1..451