GCR126

Overview
NameGCR126
Smed IDSMED30021866
Length (bp)1328
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR126 (SMED30021866) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR126 (SMED30021866) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021866

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30021866h1SMcG0008278 GCR126smed_ncbi_20240424PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR126 vs. TrEMBL
Match: A0A193KUM0 (GCR126 OS=Schmidtea mediterranea OX=79327 GN=gcr126 PE=2 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 433/433 (100.00%), Postives = 433/433 (100.00%), Query Frame = 1
Query:    1 KILIHEIENKYHNKNVYYFYRIDFLYIMYYLTPVDDSMEKIEDKFSPFYNIDXXXXXXXXXXXXXXTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK 1299
            KILIHEIENKYHNKNVYYFYRIDFLYIMYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNSSCISTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK
Sbjct:    2 KILIHEIENKYHNKNVYYFYRIDFLYIMYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNSSCISTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK 434          
BLAST of GCR126 vs. TrEMBL
Match: A0A193KUE1 (GCR135 OS=Schmidtea mediterranea OX=79327 GN=gcr135 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.493e-46
Identity = 120/414 (28.99%), Postives = 223/414 (53.86%), Query Frame = 1
Query:   82 MYYLTPVDDSMEKIEDKFS-PFYNIDXXXXXXXXXXXXXXTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCS-NGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKG-HSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRII-----LPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQND-ADFLLAIQETT 1296
            MY L P +++M  I DK+   F    ++  L   + +C + W +  C+  +   E+ +  CPF  +++   C+ +G+W+  +   ++ C   EF YR+ IE+ F  ++ P  ++IY + ++ IS Y E++KDF WR ++W L+++++   I   +  +NS+      C+  T +P+ +DLF  +  +ALF ++Y +++  + Q+R IKS+L     + P+L   VCL+LD+     ++YF+CQ     SRV   +V + +   +I   L++ I+ K K +  E      YRMEYDI G RKE+SKRE++R    +K  L LS++  ++Y   V++ ++      P +  + I  I+    N A+ + +  +IWFNK  + +  A   W   ++ + ++N  +  +FL    E +
Sbjct:    1 MYSLRPKNNTMASINDKYRYIFSKFIEECKLNNISYTCPNVWWYNSCIRMTNSDENIDAPCPFIKSFVALKCNPDGKWNATEIGFFQLCNGAEFLYRIQIEKYFGFILYPIQIIIYLSSIFKISLYDEMLKDFCWRMIIWSLRAKTLKHGIGWLLVLMNSNSFVSAACIPITVIPIFMDLFGQSCHMALFFYLYIMLYRFDVQIRTIKSALFRITIMTPILAITVCLVLDMNKDDYYNYFECQTDIFGSRVVLAFVTSFVAMTIINIYLWIAILKKCKEMNKE-AFFGIYRMEYDIAGTRKEISKREIIRTTYVLKWLLGLSVFETIVYFCSVLHIVLDGYLERPVKFNFFITAIVTFLINNAEMVTMIAIIWFNKHFQTKQNALKQWYIEIDDDKRSNNEELENFLFQDAEES 413          
BLAST of GCR126 vs. TrEMBL
Match: A0A193KUM8 (GCR136 OS=Schmidtea mediterranea OX=79327 GN=gcr136 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.627e-43
Identity = 118/411 (28.71%), Postives = 212/411 (51.58%), Query Frame = 1
Query:   82 MYYLTPVDDSMEKIEDKFSPFYNIDXXXXXXXXXXXX-XXTWVFQVCLTDSMR-SEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIG-TKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQND---ADFLLAIQETT 1296
            MY L P  DS E I  KFS F+  +K  CL  ++S      W +  C+T +   +  +++ CPF+      +C NG W+   ++++ +C    F +R TI       + P +LLI+ T  + + EY EI ++F W+ ++W+   +S+     I +  +NSS   Y  CML     +  + F   SM     ++YAI+    TQLR+IKS+L H  FI P+++ ++ LI D+  TKG + FQC+  P+ S + ++YV   +  I+    + ++I   L  + +  N    YR+EYDI+G RKE+S R++ R    +K+ + ++  N ++    +  +    +   YK  VI+YS +++   ++   ++W N  L+    A + W    ++++K   +D    +F  A++  T
Sbjct:    1 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITTASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQ--DIDLKKTLDDYGNDEFFAALKVAT 408          
BLAST of GCR126 vs. Planmine SMEST
Match: SMESG000076933.1 (SMESG000076933.1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 406/406 (100.00%), Postives = 406/406 (100.00%), Query Frame = 1
Query:   82 MYYLTPVDDSMEKIEDKFSPFYNIDXXXXXXXXXXXXXXTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK 1299
            MYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNSSCISTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK
Sbjct:    1 MYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNSSCISTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK 406          
BLAST of GCR126 vs. Planmine SMEST
Match: SMESG000076929.1 (SMESG000076929.1)

HSP 1 Score: 171.785 bits (434), Expect = 1.135e-48
Identity = 109/373 (29.22%), Postives = 203/373 (54.42%), Query Frame = 1
Query:  202 WVFQVCLTDSMRSEDNEILCPFFTTYIQPVCS-NGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGTKG-HSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRII-----LPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQND-ADFLLAIQETT 1296
            W +  C+  +   E+ +  CPF  +++   C+ +G+W+  +   ++ C   EF YR+ IE+ F  ++ P  ++IY + ++ IS Y E++KDF WR ++W L+++++   I   +  +NS+      C+  T +P+ +DLF  +  +ALF ++Y +++  + Q+R IKS+L     + P+L   VCL+LD+     ++YF+CQ     SRV   +V + +   +I   L++ I+ K K +  E      YRMEYDI G RKE+SKRE++R    +K  L LS++  ++Y   V++ ++      P +  + I  I+    N A+ + +  +IWFNK  + +  A   W   ++ + ++N  +  +FL    E +
Sbjct:   32 WWYNSCIRMTNSDENIDAPCPFIKSFVALKCNPDGKWNATEIGFFQLCNGAEFLYRIQIEKYFGFILYPIQIIIYLSSIFKISLYDEMLKDFCWRMIIWSLRAKTLKHGIGWLLVLMNSNSFVSAACIPITVIPIFMDLFGQSCHMALFFYLYIMLYRFDVQIRTIKSALFRITIMTPILAITVCLVLDMNKDDYYNYFECQTDIFGSRVVLAFVTSFVAMTIINIYLWIAILKKCKEMNKE-AFFGIYRMEYDIAGTRKEISKREIIRTTYVLKWLLGLSVFETIVYFCSVLHIVLDGYLERPVKFNFFITAIVTFLINNAEMVTMIAIIWFNKHFQTKQNALKQWYIEIDDDKRSNNEELENFLFQDAEES 403          
BLAST of GCR126 vs. Planmine SMEST
Match: SMESG000076928.1 (SMESG000076928.1)

HSP 1 Score: 160.229 bits (404), Expect = 4.531e-45
Identity = 101/324 (31.17%), Postives = 173/324 (53.40%), Query Frame = 1
Query:  331 YEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIGT-KGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRII-LPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQNDADFLLAIQETT 1296
            ++ C  K+F YR  IE+ F  ++ P  +++  T ++ IS + E+VKDF+WR ++W L++++I   I   M  +NS+      C+  + +P+  D F     +ALF +VY I+F  + Q+R IKS+L     + P L  IVCL+LD+ T   ++YF+CQ     SR+ + Y+       +I F L++ I  K+  +  +  L   YRMEYDI+G RKE+S+RE+ R +  +   L  ++++ ++    +   I   P    + IM +        + + +  ++W N+  R R  A  LW   +N E    Q + DF  A++ETT
Sbjct:    3 FDLCNGKQFLYRTQIEKYFGFVLYPMQMILLLTSIFKISIFDEMVKDFSWRMIIWSLRAKTIKYTIGWMMVLMNSNYVVSTTCIALSLIPVLADFFSLACQMALFFYVYIILFRFDVQIRTIKSALFRVTVMTPFLAIIVCLVLDLNTDDNYNYFECQTDIFGSRILHAYLTIYFAVTVILFYLWIAISRKINEMR-KQVLIGTYRMEYDIVGARKEISRREIFRVRYILNWLLAHNVFDSIVLSSTIYQTISETPRTYYFLIMALTLFILIFGEAVTVLAIVWMNRHFRDRHNALRLWYVEINEEKNLGQEEEDFKSALKETT 325          
BLAST of GCR126 vs. Planmine SMEST
Match: SMESG000018582.1 (SMESG000018582.1)

HSP 1 Score: 154.451 bits (389), Expect = 8.004e-43
Identity = 100/310 (32.26%), Postives = 166/310 (53.55%), Query Frame = 1
Query:   82 MYYLTPVDDSMEKIEDKFSPFYNIDXXXXXXXXXXXX-XXTWVFQVCLTDSMR-SEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMXXXXXXXXXXXXYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIG-TKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVR 1002
            MY L P  DS E I  KFS F+  +K  CL  ++S      W +  C+T +   +  +++ CPF+      +C NG W+   ++++ +C    F +R TI       + P +LLI+ T  + + EY EI ++F W+ ++W+   +S+     I +  +NSS   Y  CML     +  + F   SM     ++YAI+    TQLR+IKS+L H  FI P+++ ++ LI D+  TKG + FQC+  P+ S + ++YV   +  I+    + ++I   L  + +  N    YR+EYDI+G RKE+S R++ R
Sbjct:    1 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQR 309          
The following BLAST results are available for this feature:
BLAST of GCR126 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A193KUM00.000e+0100.00GCR126 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A193KUE11.493e-4628.99GCR135 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUM84.627e-4328.71GCR136 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
back to top
BLAST of GCR126 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR126 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000076933.10.000e+0100.00SMESG000076933.1[more]
SMESG000076929.11.135e-4829.22SMESG000076929.1[more]
SMESG000076928.14.531e-4531.17SMESG000076928.1[more]
SMESG000018582.18.004e-4332.26SMESG000018582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021866 ID=SMED30021866|Name=GCR126|organism=Schmidtea mediterranea sexual|type=transcript|length=1328bp
AAAATTTTGATTCATGAAATAGAAAATAAATATCATAATAAAAATGTTTA
TTATTTTTATAGGATTGATTTCCTTTACATAATGTATTACTTGACTCCAG
TTGATGATTCAATGGAAAAAATAGAAGACAAATTTTCTCCTTTTTATAAC
ATCGATAAGAAAAAGTGTTTGAAACTTTCAAATTCTTCTTGCATAAGCAC
TTGGGTCTTTCAGGTATGCCTAACAGATTCAATGAGAAGTGAAGACAATG
AAATATTATGTCCATTTTTTACCACTTACATTCAACCAGTCTGTTCAAAT
GGTCGTTGGGATTATGACGATAGAAGGGTTTACGAGGATTGCTATACCAA
AGAATTTTATTATCGTTTAACAATTGAAAGGACATTTATGCTGTTGATTA
ACCCATTTATCTTATTAATTTATCAAACTGGAGTTTATTATATATCAGAA
TATCCGGAAATAGTAAAGGACTTTAACTGGAGATTTGTCGTTTGGCTCTT
AAAATCAAGATCAATTCACTTATTTATTCTCATTTCAATGTGCTTCATTA
ATTCTAGCAGGGCTACTTATGAATGGTGTATGTTATTTACATTTTTACCT
TTGACCCTCGACCTTTTTTACCACACATCTATGTTAGCACTGTTCATCCA
TGTCTACGCAATCATTTTTAACCAAGAAACTCAACTAAGAGTTATCAAGT
CATCACTGAAACATTTCTGCTTTATAATGCCGTTATTAATCGCAATAGTT
TGTTTAATTCTTGATATAGGAACAAAAGGCCATAGCTATTTTCAATGTCA
ATGTGGTCCAATTCTCTCCAGGGTCTATTACGTTTATGTCGCAACCACAC
TGGTGCAAATACTCATTGCCTTTCCATTGTATTTGAGAATAATGTCGAAA
TTAAAAACAATTGAATTAGAAAACAATTTAAGGAATCATTATAGAATGGA
ATACGACATCCTGGGGGAAAGAAAAGAAGTTTCAAAAAGAGAATTAGTGA
GATGTAAGCTGTCGATGAAAGTCTTTCTTCTGTTAAGTATTTGGAATTTC
GTTATGTATTGTGTAATGGTGATAAACCGCATAATATTACCTAATAGATT
AGTTTATAAGATAATGGTAATAATTTATTCTTCAAGAAATATTGCTGATT
GTATAATGCTCACAATATTAATATGGTTCAATAAAGGTCTCAGGCAGAGG
ATGGCTGCTTGGGATTTGTGGAATAACGTATTAAATGTGGAAGTTAAAAC
AAACCAAAACGATGCCGATTTTCTATTAGCGATTCAGGAAACTACAAAAT
AAAGATATTAATTAAAAAAAAACAGTTA
back to top

protein sequence of SMED30021866-orf-1

>SMED30021866-orf-1 ID=SMED30021866-orf-1|Name=SMED30021866-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=434bp
KILIHEIENKYHNKNVYYFYRIDFLYIMYYLTPVDDSMEKIEDKFSPFYN
IDKKKCLKLSNSSCISTWVFQVCLTDSMRSEDNEILCPFFTTYIQPVCSN
GRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISE
YPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLP
LTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIV
CLILDIGTKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSK
LKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNF
VMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQR
MAAWDLWNNVLNVEVKTNQNDADFLLAIQETTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 373..393
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 171..190
NoneNo IPR availableTMHMMTMhelixcoord: 128..150
NoneNo IPR availableTMHMMTMhelixcoord: 205..223
NoneNo IPR availableTMHMMTMhelixcoord: 273..295