Phosphorylase kinase gamma subunit

Overview
NamePhosphorylase kinase gamma subunit
Smed IDSMED30021860
Length (bp)603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphorylase kinase gamma subunit (SMED30021860) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphorylase kinase gamma subunit (SMED30021860) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphorylase kinase gamma subunit (SMED30021860) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphorylase kinase gamma subunit (SMED30021860) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021860

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021860SMESG000023567.1 SMESG000038340.1 dd_Smed_v4_1020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Match: PHKG1 (phosphorylase kinase catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:8930])

HSP 1 Score: 70.4774 bits (171), Expect = 8.057e-14
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +     +F   L + +     +PR KFK  VIA  +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  276 PQNRYTAEEALAHPFFQQYLVEEVRH--FSPRGKFK--VIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 379          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Match: PHKG1 (phosphorylase kinase catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:8930])

HSP 1 Score: 70.4774 bits (171), Expect = 8.224e-14
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +     +F   L + +     +PR KFK  VIA  +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  273 PQNRYTAEEALAHPFFQQYLVEEVRH--FSPRGKFK--VIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Match: PHKG1 (phosphorylase kinase catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:8930])

HSP 1 Score: 70.0922 bits (170), Expect = 1.105e-13
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +     +F   L + +     +PR KFK  VIA  +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  305 PQNRYTAEEALAHPFFQQYLVEEVRH--FSPRGKFK--VIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 408          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Match: PHKG2 (phosphorylase kinase catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:8931])

HSP 1 Score: 61.6178 bits (148), Expect = 8.508e-11
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  215 INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTP 448
            + PR++F+  V  + +++  R      R+  +T   +  +PY  R++R LID  AF +Y HWVKKGE+QNRAA+FQ  P
Sbjct:  306 LTPRQRFR--VAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGHWVKKGEQQNRAALFQHRP 382          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Match: PHKG2 (phosphorylase kinase catalytic subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:8931])

HSP 1 Score: 61.6178 bits (148), Expect = 8.791e-11
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  215 INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTP 448
            + PR++F+  V  + +++  R      R+  +T   +  +PY  R++R LID  AF +Y HWVKKGE+QNRAA+FQ  P
Sbjct:  302 LTPRQRFR--VAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGHWVKKGEQQNRAALFQHRP 378          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 60.4622 bits (145), Expect = 1.095e-10
Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 2
Query:  317 EMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD 457
            E   +PY  + LRK+ID  AF +Y HWVKKGE QNRAA+F+ TP+ +
Sbjct:  362 EAIRDPYRVKVLRKVIDGCAFRVYGHWVKKGEGQNRAALFENTPRTE 408          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 60.4622 bits (145), Expect = 1.095e-10
Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 2
Query:  317 EMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD 457
            E   +PY  + LRK+ID  AF +Y HWVKKGE QNRAA+F+ TP+ +
Sbjct:  362 EAIRDPYRVKVLRKVIDGCAFRVYGHWVKKGEGQNRAALFENTPRTE 408          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301501)

HSP 1 Score: 60.4622 bits (145), Expect = 1.137e-10
Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 2
Query:  317 EMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD 457
            E   +PY  + LRK+ID  AF +Y HWVKKGE QNRAA+F+ TP+ +
Sbjct:  503 EAIRDPYRVKVLRKVIDGCAFRVYGHWVKKGEGQNRAALFENTPRTE 549          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301500)

HSP 1 Score: 60.4622 bits (145), Expect = 1.137e-10
Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 2
Query:  317 EMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD 457
            E   +PY  + LRK+ID  AF +Y HWVKKGE QNRAA+F+ TP+ +
Sbjct:  503 EAIRDPYRVKVLRKVIDGCAFRVYGHWVKKGEGQNRAALFENTPRTE 549          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 60.4622 bits (145), Expect = 1.183e-10
Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 2
Query:  317 EMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD 457
            E   +PY  + LRK+ID  AF +Y HWVKKGE QNRAA+F+ TP+ +
Sbjct:  334 EAIRDPYRVKVLRKVIDGCAFRVYGHWVKKGEGQNRAALFENTPRTE 380          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Match: phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:ZFIN;Acc:ZDB-GENE-040426-825])

HSP 1 Score: 78.1814 bits (191), Expect = 1.066e-16
Identity = 43/118 (36.44%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQN 484
            P L +T  +     +F    +Q     + +PR+ FK++++      R++  +   R  +T   +  +PY  R +RKLID  AF IY HWVKKGE+QNRAA+FQ T K   +G ++L+N
Sbjct:  276 PTLRLTAEQALAHPFFCQ--YQKEDVRLFSPRKTFKALILTVLACIRMQCRYYRAR-PLTKELLSRDPYSIRGVRKLIDGCAFRIYGHWVKKGEQQNRAALFQNTAKIILLGLEDLEN 390          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 68.5514 bits (166), Expect = 2.236e-13
Identity = 41/113 (36.28%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +  N  +F     Q +V+ V   +P RKFK    +V+ A ++    R+        +T   ++++PY  ++LRK+ID  AF IY HWVKKG+ QNRAA+F+ +PK
Sbjct:  273 PESRYTATEALNHPFFQ----QYVVAEVRHFSPYRKFKVICRTVLAAMRIYCNYRRAK-----PVTKEVIQSDPYAIKHLRKMIDACAFKIYGHWVKKGQTQNRAALFENSPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 68.5514 bits (166), Expect = 2.236e-13
Identity = 41/113 (36.28%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +  N  +F     Q +V+ V   +P RKFK    +V+ A ++    R+        +T   ++++PY  ++LRK+ID  AF IY HWVKKG+ QNRAA+F+ +PK
Sbjct:  273 PESRYTATEALNHPFFQ----QYVVAEVRHFSPYRKFKVICRTVLAAMRIYCNYRRAK-----PVTKEVIQSDPYAIKHLRKMIDACAFKIYGHWVKKGQTQNRAALFENSPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Match: phkg1a (phosphorylase kinase, gamma 1a (muscle) [Source:ZFIN;Acc:ZDB-GENE-061103-385])

HSP 1 Score: 68.1662 bits (165), Expect = 2.763e-13
Identity = 43/110 (39.09%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T     N  +F     Q +V+ V   +P RKFK  VI   +++ +R      R   +T   +K++PY  + +RKLID  AF IY HWVKKG+ QNRAA+F+ +PK
Sbjct:  273 PEKRFTATDALNHPFFQ----QYVVAEVRHFSPYRKFK--VICMTVLATMRIYCNYRRAKPVTKEVIKSDPYAVKPIRKLIDACAFKIYGHWVKKGQTQNRAALFENSPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Match: phkg1a (phosphorylase kinase, gamma 1a (muscle) [Source:ZFIN;Acc:ZDB-GENE-061103-385])

HSP 1 Score: 68.1662 bits (165), Expect = 2.763e-13
Identity = 43/110 (39.09%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T     N  +F     Q +V+ V   +P RKFK  VI   +++ +R      R   +T   +K++PY  + +RKLID  AF IY HWVKKG+ QNRAA+F+ +PK
Sbjct:  273 PEKRFTATDALNHPFFQ----QYVVAEVRHFSPYRKFK--VICMTVLATMRIYCNYRRAKPVTKEVIKSDPYAVKPIRKLIDACAFKIYGHWVKKGQTQNRAALFENSPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 67.781 bits (164), Expect = 6.354e-13
Identity = 38/92 (41.30%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  218 NPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQ 490
            +P RKFK  V+   +++ +R  H   ++  +T   +  +PY  + +RKLID  AF IY HWVKKGE+QNRAA+F+ T     + HD L  D 
Sbjct:  299 SPFRKFK--VVCLTVLASVRIYHYYRKVKPVTKEIIVRDPYAIKPIRKLIDGCAFRIYGHWVKKGEQQNRAALFENT---QHVAHDPLVGDH 385          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 65.4698 bits (158), Expect = 3.409e-12
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  218 NPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            +P RKFK  V+   +++ +R  H   ++  +T   +  +PY  + +RKLID  AF IY HWVKKGE+QNRAA+F+ T K
Sbjct:  297 SPFRKFK--VVCLTVLASVRIYHYYRKVKPVTKEIIVRDPYAIKPIRKLIDGCAFRIYGHWVKKGEQQNRAALFENTAK 373          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 65.4698 bits (158), Expect = 3.525e-12
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  218 NPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            +P RKFK  V+   +++ +R  H   ++  +T   +  +PY  + +RKLID  AF IY HWVKKGE+QNRAA+F+ T K
Sbjct:  309 SPFRKFK--VVCLTVLASVRIYHYYRKVKPVTKEIIVRDPYAIKPIRKLIDGCAFRIYGHWVKKGEQQNRAALFENTAK 385          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Match: phkg1 (phosphorylase kinase, gamma 1 (muscle) [Source:NCBI gene;Acc:448255])

HSP 1 Score: 65.0846 bits (157), Expect = 4.972e-12
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  218 NPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            +P RKFK  V+   +++ +R  H   ++  +T   +  +PY  + +RKLID  AF IY HWVKKGE+QNRAA+F+ T K
Sbjct:  299 SPFRKFK--VVCLTVLASVRIYHYYRKVKPVTKEIIVRDPYAIKPIRKLIDGCAFRIYGHWVKKGEQQNRAALFENTAK 375          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Match: xpo5 (exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328])

HSP 1 Score: 63.5438 bits (153), Expect = 1.757e-11
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P   +T  +     +F     Q    T + P  +F+    + +   +++ R R+     R + T   M++ PY  + +R+LID  AF IY HWVKKGE QNRAA+FQ  PK
Sbjct:  276 PEKRLTAEQALQHPFFQS--HQRDQDTPVKPSYRFRIAAWAALACVRILVRWRR----ARPVTTQLLMRD-PYGIKGVRRLIDACAFRIYGHWVKKGERQNRAALFQNQPK 379          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Mouse
Match: Phkg1 (phosphorylase kinase gamma 1 [Source:MGI Symbol;Acc:MGI:97579])

HSP 1 Score: 67.3958 bits (163), Expect = 5.541e-13
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  152 NKCFNDLYFNDILFQSIVSTVI---NPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            ++C  +       FQ  V   +   +PR KFK    +V+ + ++  + R++    R ++       +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  275 DRCSAEEALAHPFFQEYVVEEVRHFSPRGKFKVICLTVLASVKIYYQYRRVKPVTREIVI-----RDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Mouse
Match: Phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:MGI Symbol;Acc:MGI:1916211])

HSP 1 Score: 65.855 bits (159), Expect = 2.216e-12
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 2
Query:  215 INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD-KIGHDNLQNDQEYLREIKVS 517
            + PR++F+  V  + +++  R      RL  +T   +  +PY  R +R+LID  AF +Y HWVKKGE+QNRAA+FQ  P R   I    L+ D   + E + +
Sbjct:  302 LTPRQRFR--VAVWTILAAGRVALSSHRLRPLTKNALLRDPYALRPVRRLIDNCAFRLYGHWVKKGEQQNRAALFQHQPPRLFPIAATELEGDSGAITEDEAT 402          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Mouse
Match: Phkg2 (phosphorylase kinase, gamma 2 (testis) [Source:MGI Symbol;Acc:MGI:1916211])

HSP 1 Score: 65.855 bits (159), Expect = 2.216e-12
Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = 2
Query:  215 INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD-KIGHDNLQNDQEYLREIKVS 517
            + PR++F+  V  + +++  R      RL  +T   +  +PY  R +R+LID  AF +Y HWVKKGE+QNRAA+FQ  P R   I    L+ D   + E + +
Sbjct:  302 LTPRQRFR--VAVWTILAAGRVALSSHRLRPLTKNALLRDPYALRPVRRLIDNCAFRLYGHWVKKGEQQNRAALFQHQPPRLFPIAATELEGDSGAITEDEAT 402          
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Match: sp|Q16816|PHKG1_HUMAN (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens OX=9606 GN=PHKG1 PE=2 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 3.949e-13
Identity = 42/108 (38.89%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +     +F   L + +     +PR KFK  VIA  +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  273 PQNRYTAEEALAHPFFQQYLVEEVRH--FSPRGKFK--VIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Match: sp|P13286|PHKG1_RAT (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus OX=10116 GN=Phkg1 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 1.729e-12
Identity = 41/104 (39.42%), Postives = 60/104 (57.69%), Query Frame = 2
Query:  152 NKCFNDLYFNDILFQSIVSTVI---NPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            ++C  +       FQ  V   +   +PR KFK  VI   +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  275 DRCSAEEALAHPFFQEYVVEEVRHFSPRGKFK--VICLTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Match: sp|P31325|PHKG2_RAT (Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus OX=10116 GN=Phkg2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.181e-12
Identity = 39/103 (37.86%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  215 INPRRKFKSVVIAYQLISRLRKMHLCGRL-MITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRD-KIGHDNLQNDQEYLREIKVS 517
            + PR++F+  V  + +++  R      RL  +T   +  +PY  R +R+LID  AF +Y HWVKKGE+QNRAA+FQ  P R   I   +L+ D   + E +V+
Sbjct:  302 LTPRQRFR--VAVWTILAAGRVALSSHRLRPLTKNALLRDPYALRPVRRLIDNCAFRLYGHWVKKGEQQNRAALFQHQPPRPFPIIATDLEGDSSAITEDEVT 402          
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Match: sp|P00518|PHKG1_RABIT (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKG1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 2.983e-12
Identity = 40/89 (44.94%), Postives = 56/89 (62.92%), Query Frame = 2
Query:  194 QSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            Q +V  V   +PR KFK  VI   +++ +R  +   R+  +T   +  +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  290 QYVVEEVRHFSPRGKFK--VICLTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Match: sp|P07934|PHKG1_MOUSE (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus OX=10090 GN=Phkg1 PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 3.876e-12
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  152 NKCFNDLYFNDILFQSIVSTVI---NPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            ++C  +       FQ  V   +   +PR KFK    +V+ + ++  + R++    R ++       +PY  R LR+LID  AF IY HWVKKG++QNRAA+F+ TPK
Sbjct:  275 DRCSAEEALAHPFFQEYVVEEVRHFSPRGKFKVICLTVLASVKIYYQYRRVKPVTREIVI-----RDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Match: A0A0X3PEF4 (Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Schistocephalus solidus OX=70667 GN=PHKG1 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.536e-19
Identity = 39/87 (44.83%), Postives = 64/87 (73.56%), Query Frame = 2
Query:  203 VSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKI 463
             ST+ N +R+F++  +A + I  LR++  CG  +  Y ++ ++PY N+ LRKLIDT+A+D+YSHW+K+G+EQNRAA+F+  P R+ +
Sbjct:  296 ASTLFNAKRRFRAAYVAVRFIHLLRELKACGTSLSIY-KLTSDPYANKRLRKLIDTLAYDVYSHWIKRGDEQNRAALFENQPHRELV 381          
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Match: A0A5K3ETJ9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.220e-17
Identity = 37/80 (46.25%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  224 RRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKI 463
            RRKF++   A Q I  LR++  CG   ++  ++  +PY N+ LRKLID++AFD+YSHW+K+G+EQNRAA+++  P+ D++
Sbjct:  303 RRKFRAAYSALQFIRMLRELKACG-TTLSLHKLTTDPYSNKRLRKLIDSLAFDVYSHWIKRGDEQNRAALYENKPRFDQV 381          
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Match: A0A183KYY3 (Protein kinase domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS20280 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.120e-17
Identity = 46/108 (42.59%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  143 ITGNKCFNDLYFNDILFQSIVS-TVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKI 463
            +T     N  +F   L Q IV  T  N R+KFK+ ++A   I  LR++ +     +   ++  +PY N+ LRK+IDT+A+D+YS WVKKGEEQNRA +F+  P+RD I
Sbjct:   81 LTALDSLNHAFF---LQQPIVGKTAFNARQKFKTGMLAVSFIFYLRRLKV-DAAYLNINQLSMDPYSNKKLRKIIDTLAYDVYSQWVKKGEEQNRAELFENVPRRDMI 184          
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Match: G4V683 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_098840 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.627e-16
Identity = 44/93 (47.31%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  188 LFQSIVS-TVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKI 463
            L Q IV  TV N R+KFK+ ++A   I  LR++ +    +    ++  +PY N+ LRK+IDT+A+D+YS WVKKGEEQNRA +F+  P+RD I
Sbjct:  290 LQQPIVGKTVFNARQKFKTGMLAVSFIFYLRRLKMNAAYL-NINQLSMDPYSNKKLRKIIDTLAYDVYSQWVKKGEEQNRAELFENIPRRDMI 381          
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Match: A0A183PCN8 (Protein kinase domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12124 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.995e-16
Identity = 46/108 (42.59%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  143 ITGNKCFNDLYFNDILFQSIVS-TVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKI 463
            +T     N  +F   L Q IV  T  N R+KFK+ ++A   I  LR++ +     +   ++  +PY N+ LRK+IDT+A+D+YS WVKKGEEQNRA +F+  P+RD I
Sbjct:  240 LTALDSLNHAFF---LQQPIVGKTAFNARQKFKTGMLAVSFIFYLRRLKV-DAAYLNINQLSMDPYSNKKLRKIIDTLAYDVYSQWVKKGEEQNRAELFENVPRRDMI 343          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Cavefish
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:103041098])

HSP 1 Score: 72.4034 bits (176), Expect = 9.231e-15
Identity = 42/118 (35.59%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQN 484
            P L +T  +     +F    +Q     + +PR+ F+ +++      R+   +   R  +T   +  +PY  R +RKLID  AF IY HWVKKGE+QNRAA+FQ T K   +G ++L+N
Sbjct:  275 PPLRLTAEQALAHPFFRQ--YQKEEVRLFSPRKTFRVLILTVLGCIRMYCRYNRAR-PLTRELLARDPYSLRAVRKLIDGCAFRIYGHWVKKGEQQNRAALFQNTTKILLVGLEDLEN 389          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Cavefish
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:103041098])

HSP 1 Score: 72.4034 bits (176), Expect = 9.231e-15
Identity = 42/118 (35.59%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQN 484
            P L +T  +     +F    +Q     + +PR+ F+ +++      R+   +   R  +T   +  +PY  R +RKLID  AF IY HWVKKGE+QNRAA+FQ T K   +G ++L+N
Sbjct:  275 PPLRLTAEQALAHPFFRQ--YQKEEVRLFSPRKTFRVLILTVLGCIRMYCRYNRAR-PLTRELLARDPYSLRAVRKLIDGCAFRIYGHWVKKGEQQNRAALFQNTTKILLVGLEDLEN 389          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Cavefish
Match: phkg1a (phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform [Source:NCBI gene;Acc:103046290])

HSP 1 Score: 68.1662 bits (165), Expect = 2.553e-13
Identity = 42/105 (40.00%), Postives = 61/105 (58.10%), Query Frame = 2
Query:  146 TGNKCFNDLYFNDILFQSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            T     N  +F     Q +V+ V   +P +KFK  VI+  +++ +R      R   +T   +K++PY  + +RKLID  AF IY HWVKKG+ QNRAA+F+ TPK
Sbjct:  278 TATDALNHPFFQ----QYVVAEVRHFSPYKKFK--VISLTVLASMRIYCNYRRAKPVTKEVIKSDPYAVKPIRKLIDACAFKIYGHWVKKGQTQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Cavefish
Match: phkg1b (phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform [Source:NCBI gene;Acc:103023937])

HSP 1 Score: 67.0106 bits (162), Expect = 7.192e-13
Identity = 43/110 (39.09%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLM-ITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T  +  N  +F     Q  V+ V   +P RKFK  VI   +++ +R      R   +T   ++++PY  + LRK+ID  AF IY HWVKKG+ QNRAA+F+ TPK
Sbjct:  273 PQSRYTATEALNHPFFQ----QYEVTEVRHFSPYRKFK--VICLTVLASMRIYCNYRRAKPVTKEVIRSDPYAIKPLRKMIDACAFKIYGHWVKKGQTQNRAALFENTPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 70.0922 bits (170), Expect = 1.145e-14
Identity = 36/79 (45.57%), Postives = 53/79 (67.09%), Query Frame = 2
Query:  218 NPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMK-NEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            +P RKFK++++   +++ +R  +   R+    TE+   +PY  R +R+LID  AF IY HWVKKGE QNRAA+F+ TPK
Sbjct:  304 SPYRKFKTIMLT--VLASVRMYYHYRRVRPVTTEIVLRDPYALRAVRRLIDGAAFRIYGHWVKKGERQNRAALFENTPK 380          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Nematostella
Match: EDO44594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV77])

HSP 1 Score: 63.5438 bits (153), Expect = 3.196e-12
Identity = 35/85 (41.18%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  191 FQSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVK--KGEEQNRAAVFQ 439
            FQS  +     R KFK  V+A   +   R+  +   L +++  +   PY N+ +RKLID  AF IY HWVK  K E QNRAA+F+
Sbjct:  301 FQSQKNDRFCARWKFKGAVLAVIAVQEFRRFIISKILPVSFDIVTEHPYGNKPIRKLIDGCAFRIYGHWVKRNKDENQNRAALFE 385          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Medaka
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:101165598])

HSP 1 Score: 70.8626 bits (172), Expect = 3.214e-14
Identity = 38/95 (40.00%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  212 VINPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQN 484
            + +PR+ F+    SV+   ++ SR R++       +T   +  +PY  R +RKLID  AF IY HWVKKGE+QNRAA+FQ T K   +G ++ + 
Sbjct:  284 LFSPRKTFRVLIVSVLACIRMYSRYRRVR-----PLTREVLARDPYSIRGVRKLIDGCAFRIYGHWVKKGEQQNRAALFQNTAKIMLLGLEDFET 373          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Medaka
Match: phkg2 (phosphorylase kinase catalytic subunit gamma 2 [Source:NCBI gene;Acc:101165598])

HSP 1 Score: 70.4774 bits (171), Expect = 4.574e-14
Identity = 38/95 (40.00%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  212 VINPRRKFK----SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQN 484
            + +PR+ F+    SV+   ++ SR R++       +T   +  +PY  R +RKLID  AF IY HWVKKGE+QNRAA+FQ T K   +G ++ + 
Sbjct:  301 LFSPRKTFRVLIVSVLACIRMYSRYRRVR-----PLTREVLARDPYSIRGVRKLIDGCAFRIYGHWVKKGEQQNRAALFQNTAKIMLLGLEDFET 390          
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Medaka
Match: phkg1a (phosphorylase kinase catalytic subunit gamma 1 [Source:NCBI gene;Acc:101167060])

HSP 1 Score: 65.855 bits (159), Expect = 1.523e-12
Identity = 39/109 (35.78%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  131 PMLNITGNKCFNDLYFNDILFQSIVSTV--INPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPK 451
            P    T     N  +F+    Q +V+ V   +P R+FK + I      R+   +   +  +T   ++++PY  + +RKLID  AF IY HWVKKG+ QNRAA+F+  PK
Sbjct:  273 PSRRFTAADALNHPFFS----QYVVNEVRQFSPYRRFKVICITVLATMRIYCNYRRAK-PVTKEVIQSDPYAVKPIRKLIDACAFKIYGHWVKKGQTQNRAALFENAPK 376          
BLAST of Phosphorylase kinase gamma subunit vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 227.254 bits (578), Expect = 2.184e-73
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 2
Query:  194 QSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 520
            QSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC
Sbjct:  288 QSIVSTVINPRRKFKSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 396          
BLAST of Phosphorylase kinase gamma subunit vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 197.978 bits (502), Expect = 1.468e-62
Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 2
Query:  239 SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 520
            SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC
Sbjct:  262 SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 355          
BLAST of Phosphorylase kinase gamma subunit vs. Planmine SMEST
Match: SMESG000038340.1 (SMESG000038340.1)

HSP 1 Score: 198.749 bits (504), Expect = 1.595e-62
Identity = 94/95 (98.95%), Postives = 95/95 (100.00%), Query Frame = 2
Query:  236 KSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 520
            +SVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC
Sbjct:  288 QSVVIAYQLISRLRKMHLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAVFQTTPKRDKIGHDNLQNDQEYLREIKVSC 382          
The following BLAST results are available for this feature:
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHKG18.057e-1438.89phosphorylase kinase catalytic subunit gamma 1 [So... [more]
PHKG18.224e-1438.89phosphorylase kinase catalytic subunit gamma 1 [So... [more]
PHKG11.105e-1338.89phosphorylase kinase catalytic subunit gamma 1 [So... [more]
PHKG28.508e-1140.51phosphorylase kinase catalytic subunit gamma 2 [So... [more]
PHKG28.791e-1140.51phosphorylase kinase catalytic subunit gamma 2 [So... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma1.095e-1055.32gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma1.095e-1055.32gene:FBgn0011754 transcript:FBtr0343648[more]
PhKgamma1.137e-1055.32gene:FBgn0011754 transcript:FBtr0301501[more]
PhKgamma1.137e-1055.32gene:FBgn0011754 transcript:FBtr0301500[more]
PhKgamma1.183e-1055.32gene:FBgn0011754 transcript:FBtr0343587[more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phkg21.066e-1636.44phosphorylase kinase, gamma 2 (testis) [Source:ZFI... [more]
phkg1b2.236e-1336.28phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
phkg1b2.236e-1336.28phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
phkg1a2.763e-1339.09phosphorylase kinase, gamma 1a (muscle) [Source:ZF... [more]
phkg1a2.763e-1339.09phosphorylase kinase, gamma 1a (muscle) [Source:ZF... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phkg16.354e-1341.30phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg13.409e-1244.30phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg13.525e-1244.30phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
phkg14.972e-1244.30phosphorylase kinase, gamma 1 (muscle) [Source:NCB... [more]
xpo51.757e-1134.23exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328][more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Phkg15.541e-1336.45phosphorylase kinase gamma 1 [Source:MGI Symbol;Ac... [more]
Phkg22.216e-1236.89phosphorylase kinase, gamma 2 (testis) [Source:MGI... [more]
Phkg22.216e-1236.89phosphorylase kinase, gamma 2 (testis) [Source:MGI... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16816|PHKG1_HUMAN3.949e-1338.89Phosphorylase b kinase gamma catalytic chain, skel... [more]
sp|P13286|PHKG1_RAT1.729e-1239.42Phosphorylase b kinase gamma catalytic chain, skel... [more]
sp|P31325|PHKG2_RAT2.181e-1237.86Phosphorylase b kinase gamma catalytic chain, live... [more]
sp|P00518|PHKG1_RABIT2.983e-1244.94Phosphorylase b kinase gamma catalytic chain, skel... [more]
sp|P07934|PHKG1_MOUSE3.876e-1236.45Phosphorylase b kinase gamma catalytic chain, skel... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PEF42.536e-1944.83Phosphorylase b kinase gamma catalytic chain, skel... [more]
A0A5K3ETJ93.220e-1746.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183KYY35.120e-1742.59Protein kinase domain-containing protein OS=Schist... [more]
G4V6831.627e-1647.31Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
A0A183PCN82.995e-1642.59Protein kinase domain-containing protein OS=Schist... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
phkg29.231e-1535.59phosphorylase kinase catalytic subunit gamma 2 [So... [more]
phkg29.231e-1535.59phosphorylase kinase catalytic subunit gamma 2 [So... [more]
phkg1a2.553e-1340.00phosphorylase b kinase gamma catalytic chain, skel... [more]
phkg1b7.192e-1339.09phosphorylase b kinase gamma catalytic chain, skel... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phkg1b1.145e-1445.57phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445943.196e-1241.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phkg23.214e-1440.00phosphorylase kinase catalytic subunit gamma 2 [So... [more]
phkg24.574e-1440.00phosphorylase kinase catalytic subunit gamma 2 [So... [more]
phkg1a1.523e-1235.78phosphorylase kinase catalytic subunit gamma 1 [So... [more]
back to top
BLAST of Phosphorylase kinase gamma subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000038340.12.184e-73100.00SMESG000038340.1[more]
SMESG000038340.11.468e-62100.00SMESG000038340.1[more]
SMESG000038340.11.595e-6298.95SMESG000038340.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021860 ID=SMED30021860|Name=Phosphorylase kinase gamma subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=603bp
GTATGTGTATTAATTGCTAATGATTTGATTTTCAATAAGTGAAGATTTAA
AGCTTTAATTGGTGTTTGTAGTTTTGATTATTTTGCACTGGATTTTTCTA
TCGCAAATTTATATAAAAAGATTACACTTTCCAATGCTTAACATAACCGG
CAATAAATGCTTTAATGATTTGTATTTTAATGATATTCTATTTCAGAGCA
TCGTTTCTACTGTTATTAATCCAAGAAGAAAATTCAAATCCGTGGTTATT
GCATATCAATTGATAAGCCGATTGAGAAAAATGCATTTATGTGGCAGATT
AATGATAACGTATACTGAAATGAAAAATGAACCATATCTGAATAGAAATT
TAAGAAAATTAATTGATACAATCGCTTTCGATATTTATTCACATTGGGTG
AAAAAGGGAGAAGAACAAAACAGAGCAGCAGTCTTTCAAACCACTCCTAA
ACGAGACAAAATAGGACATGACAACCTTCAAAATGATCAAGAATATTTGA
GGGAAATCAAAGTTTCATGTTGATTATTTTAAATTGACCACAAAATTATT
AGATACATAAATTTGAATGTAATTTTAAATAAATTGGTTCTTATATTGAA
ATA
back to top

protein sequence of SMED30021860-orf-1

>SMED30021860-orf-1 ID=SMED30021860-orf-1|Name=SMED30021860-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MLNITGNKCFNDLYFNDILFQSIVSTVINPRRKFKSVVIAYQLISRLRKM
HLCGRLMITYTEMKNEPYLNRNLRKLIDTIAFDIYSHWVKKGEEQNRAAV
FQTTPKRDKIGHDNLQNDQEYLREIKVSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR002291Phosph_kin_gamma
Vocabulary: biological process
TermDefinition
GO:0005978glycogen biosynthetic process
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005964phosphorylase kinase complex
Vocabulary: molecular function
TermDefinition
GO:0005516calmodulin binding
GO:0005524ATP binding
GO:0004689phosphorylase kinase activity
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002291Phosphorylase kinase, gamma catalytic subunitPRINTSPR01049PHOSPHBKNASEcoord: 93..106
score: 63.27
coord: 62..76
score: 37.14
coord: 26..41
score: 28.57
coord: 77..92
score: 71.43
NoneNo IPR availablePANTHERPTHR44167:SF7PHOSPHORYLASE KINASE CATALYTIC SUBUNIT GAMMA 1coord: 7..108
NoneNo IPR availablePANTHERPTHR44167FAMILY NOT NAMEDcoord: 7..108