Transcription initiation factor TFIID subunit 4

Overview
NameTranscription initiation factor TFIID subunit 4
Smed IDSMED30021853
Length (bp)1791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 4 (SMED30021853) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 4 (SMED30021853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 4 (SMED30021853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 4 (SMED30021853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021853

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021853h1SMcG0004296 SmedASXL_012691SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021853h1SMcG0004296 SmedASXL_012691SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Human
Match: TAF4B (TATA-box binding protein associated factor 4b [Source:HGNC Symbol;Acc:HGNC:11538])

HSP 1 Score: 81.6481 bits (200), Expect = 1.770e-15
Identity = 47/142 (33.10%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S+A +     LLE+    A HR   +K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    ++  AN+TAL AIG ++K
Sbjct:  660 LQKRILDIGKKHDITELN--SDAVNLISQATQERLRGLLEKLTAIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDANLTALAAIGPRKK 799          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Human
Match: TAF4B (TATA-box binding protein associated factor 4b [Source:HGNC Symbol;Acc:HGNC:11538])

HSP 1 Score: 81.6481 bits (200), Expect = 1.855e-15
Identity = 47/142 (33.10%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S+A +     LLE+    A HR   +K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    ++  AN+TAL AIG ++K
Sbjct:  665 LQKRILDIGKKHDITELN--SDAVNLISQATQERLRGLLEKLTAIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDANLTALAAIGPRKK 804          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Human
Match: TAF4 (TATA-box binding protein associated factor 4 [Source:HGNC Symbol;Acc:HGNC:11537])

HSP 1 Score: 81.2629 bits (199), Expect = 3.061e-15
Identity = 47/152 (30.92%), Postives = 89/152 (58.55%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
             + +I EI K    T ++   + ++YVS A +     L+E+ +  A  +   +KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ ++   P S
Sbjct:  878 LQRRILEIGKKHGITELH--PDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGS 1027          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Human
Match: TAF4 (TATA-box binding protein associated factor 4 [Source:HGNC Symbol;Acc:HGNC:11537])

HSP 1 Score: 78.9518 bits (193), Expect = 7.206e-15
Identity = 47/149 (31.54%), Postives = 88/149 (59.06%), Query Frame = 3
Query: 1035 KINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
            +I EI K    T ++   + ++YVS A +     L+E+ +  A  +   +KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ ++   P S
Sbjct:  253 RILEIGKKHGITELH--PDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGS 399          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Celegans
Match: taf-4 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:O61707])

HSP 1 Score: 52.373 bits (124), Expect = 7.691e-7
Identity = 38/139 (27.34%), Postives = 71/139 (51.08%), Query Frame = 3
Query:  993 SLPTNIINHHNYRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSR 1409
            SL ++I+      N+I + + S    + ++ +EAL  +S+A+E+    L+   A  A HR E  +    Y  IDDV+ Q++FL++L+  +  L + + K  L + +K+++          KET+ K +E  +   E  R
Sbjct:  323 SLKSSILKPDEVLNRITKRMMS----SCSVEEEALVAISDAVESHLRELITLMAGVAEHRVESLRIPENYVAIDDVKRQLRFLEDLDRQEEELRESREKESLIRMSKNKNSG--------KETIEKAKEMQRQDAEAKR 449          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Match: Taf4 (gene:FBgn0010280 transcript:FBtr0333290)

HSP 1 Score: 84.7297 bits (208), Expect = 1.115e-16
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  766 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 899          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Match: Taf4 (gene:FBgn0010280 transcript:FBtr0075451)

HSP 1 Score: 84.3445 bits (207), Expect = 1.214e-16
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  655 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 788          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Match: Taf4 (gene:FBgn0010280 transcript:FBtr0075450)

HSP 1 Score: 84.3445 bits (207), Expect = 1.214e-16
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  655 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 788          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Match: Taf4 (gene:FBgn0010280 transcript:FBtr0114589)

HSP 1 Score: 84.7297 bits (208), Expect = 1.247e-16
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  892 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 1025          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Match: Taf4 (gene:FBgn0010280 transcript:FBtr0301911)

HSP 1 Score: 84.3445 bits (207), Expect = 1.251e-16
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  725 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 858          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Match: si:dkey-219c3.2 (si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-238])

HSP 1 Score: 91.6633 bits (226), Expect = 8.702e-19
Identity = 43/124 (34.68%), Postives = 79/124 (63.71%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            +S E +  +S A ++   ++LE+ +  A HR +  KD+ +Y++  DVR+Q+KF ++LE  ++  +DD+ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  783 VSMETVTLISHATQSRLRSMLEKVSAVAQHRADSCKDEDLYEQTSDVRTQLKFFEQLEKIEKQRKDDEERELLMKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 906          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Match: taf4a (TAF4A RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-131127-579])

HSP 1 Score: 88.5817 bits (218), Expect = 7.751e-18
Identity = 48/150 (32.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query: 1059 ESGTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKIIESEDPNSIPIGLKT 1499
            E G    ++D   E +N VS A +     LLE+ ++ A  +   +K+D  Y++++DVR+Q+KF ++L+  ++  ++++ +  L K AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG ++K      P+S  +G+ T
Sbjct:  620 EIGQRFGVTDLGPEVVNIVSHATQQRLQNLLEKVSLIAQQKNMTYKEDSRYEQVEDVRAQLKFFEQLDQLEKQKKEEQEREILMKAAKSRSRQEDPEQLRLKQKAKEMQQQELAQIRQRDANLTALAAIGPRKK----RKPDSPSLGIDT 765          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Match: taf4b (TAF4B RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-070424-105])

HSP 1 Score: 61.2326 bits (147), Expect = 2.678e-9
Identity = 41/132 (31.06%), Postives = 79/132 (59.85%), Query Frame = 3
Query: 1065 GTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            G ++ +++   + L  +S A +     LLE+    A HRQ  ++DD  Y + +D RSQ+KFL++LE  ++   +++ +  L + A+SRS  ++ EQ ++K+  ++MQ+ +    E+  AN+ AL A+G ++K
Sbjct:  647 GGSLGVTEVCPDVLELISLATQERLRDLLEKITAVAQHRQISYRDDWRYTQTNDTRSQLKFLEQLERLEKQKREEEERETLLRIARSRSNSEDPEQQRLKQRAKEMQQLELAQMEHRDANLAALAALGPRKK 778          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Match: taf4b (TAF4B RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-070424-105])

HSP 1 Score: 60.4622 bits (145), Expect = 3.985e-9
Identity = 41/132 (31.06%), Postives = 79/132 (59.85%), Query Frame = 3
Query: 1065 GTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            G ++ +++   + L  +S A +     LLE+    A HRQ  ++DD  Y + +D RSQ+KFL++LE  ++   +++ +  L + A+SRS  ++ EQ ++K+  ++MQ+ +    E+  AN+ AL A+G ++K
Sbjct:  385 GGSLGVTEVCPDVLELISLATQERLRDLLEKITAVAQHRQISYRDDWRYTQTNDTRSQLKFLEQLERLEKQKREEEERETLLRIARSRSNSEDPEQQRLKQRAKEMQQLELAQMEHRDANLAALAALGPRKK 516          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Match: taf4b (TAF4B RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-070424-105])

HSP 1 Score: 60.077 bits (144), Expect = 4.950e-9
Identity = 41/132 (31.06%), Postives = 79/132 (59.85%), Query Frame = 3
Query: 1065 GTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            G ++ +++   + L  +S A +     LLE+    A HRQ  ++DD  Y + +D RSQ+KFL++LE  ++   +++ +  L + A+SRS  ++ EQ ++K+  ++MQ+ +    E+  AN+ AL A+G ++K
Sbjct:  472 GGSLGVTEVCPDVLELISLATQERLRDLLEKITAVAQHRQISYRDDWRYTQTNDTRSQLKFLEQLERLEKQKREEEERETLLRIARSRSNSEDPEQQRLKQRAKEMQQLELAQMEHRDANLAALAALGPRKK 603          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Xenopus
Match: TAF4B (TATA-box binding protein associated factor 4b [Source:NCBI gene;Acc:100487219])

HSP 1 Score: 85.1149 bits (209), Expect = 1.532e-16
Identity = 42/124 (33.87%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            ++ + +N VS A +     L+E+  + A HR   +K    Y K  DVR+Q+KFL++LE  ++   +++ +  L + AKSRS  ++ EQL++K+  +++Q+ +    +Y  AN+TAL AIG ++K
Sbjct:  705 LNSDVMNLVSHATQERLRGLIEKLTLAAQHRSTNYKQSDRYLKYSDVRAQLKFLEQLEHLEKQRRNEEEREMLLRAAKSRSNREDPEQLRLKQKAKELQQMELEQIQYREANLTALAAIGPRKK 828          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Xenopus
Match: cetn4 (centrin 4 [Source:Xenbase;Acc:XB-GENE-920656])

HSP 1 Score: 82.8037 bits (203), Expect = 7.719e-16
Identity = 49/149 (32.89%), Postives = 88/149 (59.06%), Query Frame = 3
Query: 1035 KINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
            +I EI K    T I+   + ++YVS A +     ++E+ +  A  +    KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ +ES  P S
Sbjct:  844 RILEIGKKHGITEIH--QDVVSYVSHATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVESPGPGS 990          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Xenopus
Match: cetn4 (centrin 4 [Source:Xenbase;Acc:XB-GENE-920656])

HSP 1 Score: 82.8037 bits (203), Expect = 8.953e-16
Identity = 49/149 (32.89%), Postives = 88/149 (59.06%), Query Frame = 3
Query: 1035 KINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
            +I EI K    T I+   + ++YVS A +     ++E+ +  A  +    KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ +ES  P S
Sbjct:  829 RILEIGKKHGITEIH--QDVVSYVSHATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVESPGPGS 975          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Xenopus
Match: cetn4 (centrin 4 [Source:Xenbase;Acc:XB-GENE-920656])

HSP 1 Score: 79.7221 bits (195), Expect = 7.868e-15
Identity = 45/139 (32.37%), Postives = 83/139 (59.71%), Query Frame = 3
Query: 1035 KINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            +I EI K    T I+   + ++YVS A +     ++E+ +  A  +    KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  829 RILEIGKKHGITEIH--QDVVSYVSHATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 965          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Mouse
Match: Taf4b (TATA-box binding protein associated factor 4b [Source:MGI Symbol;Acc:MGI:2152345])

HSP 1 Score: 83.5741 bits (205), Expect = 3.193e-16
Identity = 48/142 (33.80%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S A +     LLE+    A HR  ++K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    +Y  AN+TAL AIG ++K
Sbjct:  649 LQKRILDIGKKHDITELN--SDAVNLISHATQERLRGLLEKLTTIAQHRMTIYKGSENYILSTDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDANLTALAAIGPRKK 788          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Mouse
Match: Taf4b (TATA-box binding protein associated factor 4b [Source:MGI Symbol;Acc:MGI:2152345])

HSP 1 Score: 83.5741 bits (205), Expect = 3.347e-16
Identity = 48/142 (33.80%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S A +     LLE+    A HR  ++K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    +Y  AN+TAL AIG ++K
Sbjct:  654 LQKRILDIGKKHDITELN--SDAVNLISHATQERLRGLLEKLTTIAQHRMTIYKGSENYILSTDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDANLTALAAIGPRKK 793          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Mouse
Match: Taf4 (TATA-box binding protein associated factor 4 [Source:MGI Symbol;Acc:MGI:2152346])

HSP 1 Score: 82.0333 bits (201), Expect = 1.137e-15
Identity = 47/152 (30.92%), Postives = 89/152 (58.55%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
             + +I EI K    T ++   + ++YVS A +     L+E+ +  A  +   +KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ ++   P S
Sbjct:  835 LQRRILEIGKKHGITELH--PDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCTGPGS 984          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Mouse
Match: Taf4 (TATA-box binding protein associated factor 4 [Source:MGI Symbol;Acc:MGI:2152346])

HSP 1 Score: 81.6481 bits (200), Expect = 1.255e-15
Identity = 47/152 (30.92%), Postives = 89/152 (58.55%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
             + +I EI K    T ++   + ++YVS A +     L+E+ +  A  +   +KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ ++   P S
Sbjct:  823 LQRRILEIGKKHGITELH--PDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCTGPGS 972          
BLAST of Transcription initiation factor TFIID subunit 4 vs. UniProt/SwissProt
Match: sp|P47825|TAF4_DROME (Transcription initiation factor TFIID subunit 4 OS=Drosophila melanogaster OX=7227 GN=Taf4 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.254e-15
Identity = 48/135 (35.56%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            I SE+G      D A+  +S A +     ++E+ AV A HR ++ K DP Y+   DVR Q+KFL+EL+  ++   ++  +  L + AKSRS++++ EQ K+K   ++MQ  +        AN+TAL+AIG ++K+
Sbjct:  725 ITSEAGLDEPSQDVAV-LISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKL 858          
BLAST of Transcription initiation factor TFIID subunit 4 vs. UniProt/SwissProt
Match: sp|G5E8Z2|TAF4B_MOUSE (Transcription initiation factor TFIID subunit 4B OS=Mus musculus OX=10090 GN=Taf4b PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 2.253e-15
Identity = 48/142 (33.80%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S A +     LLE+    A HR  ++K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    +Y  AN+TAL AIG ++K
Sbjct:  649 LQKRILDIGKKHDITELN--SDAVNLISHATQERLRGLLEKLTTIAQHRMTIYKGSENYILSTDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDANLTALAAIGPRKK 788          
BLAST of Transcription initiation factor TFIID subunit 4 vs. UniProt/SwissProt
Match: sp|Q92750|TAF4B_HUMAN (Transcription initiation factor TFIID subunit 4B OS=Homo sapiens OX=9606 GN=TAF4B PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 8.499e-15
Identity = 47/142 (33.10%), Postives = 82/142 (57.75%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
             + +I +I K    T +N   +A+N +S+A +     LLE+    A HR   +K    Y    D RSQ+KFL++L+  ++  +D + +  L K AKSRS  ++ EQL++K+  +++Q+ +    ++  AN+TAL AIG ++K
Sbjct:  660 LQKRILDIGKKHDITELN--SDAVNLISQATQERLRGLLEKLTAIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDANLTALAAIGPRKK 799          
BLAST of Transcription initiation factor TFIID subunit 4 vs. UniProt/SwissProt
Match: sp|O00268|TAF4_HUMAN (Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 1.470e-14
Identity = 47/152 (30.92%), Postives = 89/152 (58.55%), Query Frame = 3
Query: 1026 YRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG-NKRKIIESEDPNS 1478
             + +I EI K    T ++   + ++YVS A +     L+E+ +  A  +   +KDD  Y++  DVR+Q+KF ++L+  ++  +D++ +  L + AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG  K++ ++   P S
Sbjct:  878 LQRRILEIGKKHGITELH--PDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGS 1027          
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Match: A0A1S4MYX8 (Transcription initiation factor TFIID subunit,putative OS=Pediculus humanus subsp. corporis OX=121224 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.422e-20
Identity = 125/481 (25.99%), Postives = 213/481 (44.28%), Query Frame = 3
Query:  165 QNSITNKLC-KFFKNLLELEEKQGRYNES--VAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPEHVLDLNHQTTXXXXXXXXXXXXXXXXXXXXXXXGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANP-----NPQPVFS----SSQSVLSIPNANLRSIAPSSPIRQPYIQNTISTNQIRAV----AVSTSALANNTKSAPVI--------------------NSDELK-----------IETVTSMVEHSSPQKHQ----SHEPMSTNSVSLPTNIINHH-NYRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            Q   T + C KF  NLLEL  ++ +  E     +IQ+ I+ ++  ++   +L+   + +  P  L+  L  ++  LR+ +F   + I+GI PPP+ V+        +            +          T+ +  P N+      +T P++  +  R V   + QI  Q  I A  +R   P      P P+      SSQ+  S P   +  I P++P R    +N  +   ++ V     V T + ANN++S  VI                      +ELK           I  V +M   +  ++ Q    S + + T   S+   I  H    +NKI +I+ +        S E  + VS A +    TL+E+ A  A HR ++ K D  Y+ + DV+ Q+KFL+EL+  +R   +++ +  L + AKSRSK ++ EQ+K+K   ++MQ  +        AN+TAL+AIG ++K
Sbjct:  399 QMDTTKEKCRKFLANLLELSSREPKAVERNVRTLIQELIDAKVEPEDFCDRLEKLLNASPQP-CLIGFLKKSLPLLRQSLFSREMTIEGIRPPPQQVVSTTASVAQVPQMQAQLRPQMVTQ---------TVRVVAPLNAAGQNISVTTPRMGTLQNRFVTPIRGQIPAQGKIIATSIRGQTPLATSTQPPPLHHTTPISSQTPSSPP---VHQIRPTTPARAAAPKNQTTKTPVKQVITKTTVQTKSNANNSRSINVIAKPSTPSVTNKSISKVISKGGYEELKFGATSFSGDDDINDVAAMGGVNLAEESQRILGSTQFVGTQIRSVKDEIFLHSIPLQNKIRQIVSNHG--LDEPSSEVASLVSHACQERLKTLIEKLACIAEHRIDVIKLDSRYEVVQDVKGQLKFLEELDRVERKRHEEQERELLLRAAKSRSKSEDPEQVKLKAKAKEMQRAEMEELRQREANLTALQAIGPRKK 864          
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Match: E0VZS5 (Transcription initiation factor TFIID subunit, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=Phum_PHUM537630 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.081e-19
Identity = 124/481 (25.78%), Postives = 211/481 (43.87%), Query Frame = 3
Query:  165 QNSITNKLC-KFFKNLLELEEKQGRYNES--VAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPEHVLDLNHQTTXXXXXXXXXXXXXXXXXXXXXXXGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANP-----NPQPVFS----SSQSVLSIPNANLRSIAPSSPIRQPYIQNTISTNQIRAV----AVSTSALANNTKSAPVI--------------------NSDELK-----------IETVTSMVEHSSPQKHQ----SHEPMSTNSVSLPTNIINHH-NYRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            Q   T + C KF  NLLEL  ++ +  E     +IQ+ I+ ++  ++   +L+   + +  P  L+  L  ++  LR+ +F   + I+GI PPP+ V+        +            +          T+ +  P N+      +T P++  +  R       QI  Q  I A  +R   P      P P+      SSQ+  S P   +  I P++P R    +N  +   ++ V     V T + ANN++S  VI                      +ELK           I  V +M   +  ++ Q    S + + T   S+   I  H    +NKI +I+ +        S E  + VS A +    TL+E+ A  A HR ++ K D  Y+ + DV+ Q+KFL+EL+  +R   +++ +  L + AKSRSK ++ EQ+K+K   ++MQ  +        AN+TAL+AIG ++K
Sbjct:  399 QMDTTKEKCRKFLANLLELSSREPKAVERNVRTLIQELIDAKVEPEDFCDRLEKLLNASPQP-CLIGFLKKSLPLLRQSLFSREMTIEGIRPPPQQVVSTTASVAQVPQMQAQLRPQMVTQ---------TVRVVAPLNAAGQNISVTTPRMGTLQNR------GQIPAQGKIIATSIRGQTPLATSTQPPPLHHTTPISSQTPSSPP---VHQIRPTTPARAAAPKNQTTKTPVKQVITKTTVQTKSNANNSRSINVIAKPSTPSVTNKSISKVISKGGYEELKFGATSFSGDDDINDVAAMGGVNLAEESQRILGSTQFVGTQIRSVKDEIFLHSIPLQNKIRQIVSNHG--LDEPSSEVASLVSHACQERLKTLIEKLACIAEHRIDVIKLDSRYEVVQDVKGQLKFLEELDRVERKRHEEQERELLLRAAKSRSKSEDPEQVKLKAKAKEMQRAEMEELRQREANLTALQAIGPRKK 858          
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Match: A0A2G8K239 (Putative transcription initiation factor TFIID subunit 4-like isoform X2 OS=Stichopus japonicus OX=307972 GN=BSL78_21067 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.544e-18
Identity = 48/123 (39.02%), Postives = 81/123 (65.85%), Query Frame = 3
Query: 1083 SDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            S EA++ +S A+E    T++E+ +V A HR E++++DP Y+ + DVRSQ+KF ++L+  +R   D++ +  L + AKSRSK ++ EQL++K   ++MQ  +        AN+TAL AIG ++K
Sbjct:  667 SREAVDLISSAVEERLKTMVEKLSVIAQHRLEIYREDPKYEPVTDVRSQLKFFEQLDAMERKRRDEQEREMLLRAAKSRSKQEDPEQLRLKRKAKEMQLMEAEQIRQQEANLTALAAIGPRKK 789          
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Match: W5M1Q0 (Si:dkey-219c3.2 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.792e-18
Identity = 47/124 (37.90%), Postives = 80/124 (64.52%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            +  EA+N++S A +    T+LE+  + A HR E +KDD  Y++  DVRSQ+KF ++LE  ++  +D++ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  912 VPAEAVNFISHATQERLRTVLEKVTIIAQHRMETYKDDEWYEQATDVRSQLKFFEQLERIEKQRKDEEEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 1035          
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Match: W5M1R8 (Si:dkey-219c3.2 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 4.602e-18
Identity = 47/124 (37.90%), Postives = 80/124 (64.52%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            +  EA+N++S A +    T+LE+  + A HR E +KDD  Y++  DVRSQ+KF ++LE  ++  +D++ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  847 VPAEAVNFISHATQERLRTVLEKVTIIAQHRMETYKDDEWYEQATDVRSQLKFFEQLERIEKQRKDEEEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 970          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Match: ENSAMXT00000031575.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:35619383:35725638:-1 gene:ENSAMXG00000029195.1 transcript:ENSAMXT00000031575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.248e-18
Identity = 54/155 (34.84%), Postives = 92/155 (59.35%), Query Frame = 3
Query:  996 LPTNIINHHNYRNKINEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG--NKRKI 1454
            LPT +++      +I E  K    T + +  EA+N++S A ++   T+LE+    A HR +  KD+  Y++  DVRSQ+KF ++LE  ++  +D++ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG   KRK+
Sbjct:   55 LPTGLLHR-----RILETAKKYGVTEVPL--EAVNFISHATQSRLRTVLEKVTSIAQHRMDSNKDEEWYEQSSDVRSQLKFFEQLERLEKQRKDEQEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV 202          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Match: si:dkey-219c3.2 (si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-238])

HSP 1 Score: 86.2705 bits (212), Expect = 4.614e-17
Identity = 43/124 (34.68%), Postives = 74/124 (59.68%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            I  + ++ VS A E    ++LE     A HR +  KD+   ++  DVR+Q+KF ++LE  ++  +DD+ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  851 IGGDVVSLVSHAAEVRLRSMLENVTALAQHRADSCKDEETLEQTSDVRTQLKFFEQLERLEKQRKDDEEREILLKVAKSRSRQEDPEQARLKQKAKEMQQQELAEMRQRDANLTALAAIGPRKK 974          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Match: si:dkey-219c3.2 (si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-238])

HSP 1 Score: 85.5001 bits (210), Expect = 5.955e-17
Identity = 43/124 (34.68%), Postives = 74/124 (59.68%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            I  + ++ VS A E    ++LE     A HR +  KD+   ++  DVR+Q+KF ++LE  ++  +DD+ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  757 IGGDVVSLVSHAAEVRLRSMLENVTALAQHRADSCKDEETLEQTSDVRTQLKFFEQLERLEKQRKDDEEREILLKVAKSRSRQEDPEQARLKQKAKEMQQQELAEMRQRDANLTALAAIGPRKK 880          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Match: TAF4 (TATA-box binding protein associated factor 4 [Source:HGNC Symbol;Acc:HGNC:11537])

HSP 1 Score: 78.1814 bits (191), Expect = 1.160e-14
Identity = 39/124 (31.45%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            +  + ++ VS A +     LLE+    A  R   +K+D  ++++ DVR+Q+KF ++L+  ++  ++++ +  L K AKSRS+ ++ EQL++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:  644 LGSDVVSIVSHAAQQRLQNLLEKVTQVAQQRNVPYKEDERHEQVSDVRAQLKFFEQLDQMEKQRKEEQEREILMKAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 767          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Match: taf4a (TAF4A RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-131127-579])

HSP 1 Score: 69.3218 bits (168), Expect = 7.560e-12
Identity = 38/126 (30.16%), Postives = 73/126 (57.94%), Query Frame = 3
Query: 1077 NISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKI 1454
            +++ E +N VS A +     LLE+ +V A  +   +K+D  Y+++ DVR+Q+KF ++L+  ++  ++++ +  L K AKSRS+ ++ EQL++K+  ++           S AN TA  + G  R+ 
Sbjct:  652 DLAPEVVNLVSHAAQQRLQNLLEKVSVIAQQKNMTYKEDGRYEQVTDVRAQLKFFEQLDQMEKQKKEEQEREILMKAAKSRSRQEDPEQLRLKQKAKE--------GSGSSANATAGLSGGVSRQF 769          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Nematostella
Match: EDO36684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT6])

HSP 1 Score: 71.2478 bits (173), Expect = 7.492e-13
Identity = 40/144 (27.78%), Postives = 81/144 (56.25%), Query Frame = 3
Query: 1038 INEIIKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG--NKRKIIES 1463
            + E+ K   G   NI  +    +S A +     +LE+ +  + +R E ++DDP Y+   + ++Q++  +++++ +R   + + +  L + AKSRS+ ++ EQ ++KE  +++Q+ ++       AN TAL AIG   KRK+ E+
Sbjct:  651 VGEVKKQGLG---NIHQDVCGLISHACQERLRNILEKLSTISLNRPESYRDDPRYEGGLETKAQLRVFEQIDEVERKKRELREREVLMRAAKSRSRQEDPEQARLKEKAKQLQQEEEEIIRKREANNTALAAIGPRKKRKLDEA 791          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Match: si:ch211-79l17.1 (KIAA0355 ortholog [Source:NCBI gene;Acc:100170629])

HSP 1 Score: 91.6633 bits (226), Expect = 8.560e-19
Identity = 50/149 (33.56%), Postives = 90/149 (60.40%), Query Frame = 3
Query: 1059 ESGTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG--NKRKIIESEDPNSIPIG 1490
            E+     ++D   EA+ ++S A ++   T++E+ ++ A HR +  KDD  Y++  DVRSQ++F ++LE  ++  +D++ +  L K AKSRS+ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG   KRK+   + P + P G
Sbjct:  816 ETAKKFGVTDVPVEAVTFISHATQSRLRTMVEKISIIAQHRLDSCKDDEYYEQSTDVRSQLRFFEQLERIEKQRKDEQEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV---DSPRAQPSG 961          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Match: ENSORLT00000041494.1 (transcription initiation factor TFIID subunit 4 [Source:NCBI gene;Acc:101167450])

HSP 1 Score: 89.3521 bits (220), Expect = 3.567e-18
Identity = 60/215 (27.91%), Postives = 104/215 (48.37%), Query Frame = 3
Query: 1080 ISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIG--NKRKIIESEDPNSIPIGLKTARXXXXXXXXXXXXXXXXXSQIYINPNFVAGKSQRPSTVARFRNKRIILKDFQLVLDQDVKLKR-FKTYKKIF 1715
            +  + +N VS A +    +LLE+ +V A HR +  KD+ +Y++  DVR+Q++F ++LE  ++  +D++ +  L K AKSR++ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG   KRK+      N                           +   ++    +  S  P    R R  R+ L+DF L L+QD    R    YK + 
Sbjct:  717 VPADVVNVVSHATQFRLRSLLEKVSVVAQHRADAVKDEDLYEQTSDVRAQLRFFEQLERIEKQRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDSVGGAN---------------------------TGSEVSSGLGSLGSPSPRQQLRQRITRVNLRDFILCLEQDRSTARSMALYKALL 904          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Match: ENSORLT00000000324.2 (transcription initiation factor TFIID subunit 4 [Source:NCBI gene;Acc:101167450])

HSP 1 Score: 80.8777 bits (198), Expect = 1.581e-16
Identity = 42/121 (34.71%), Postives = 78/121 (64.46%), Query Frame = 3
Query: 1089 EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            + +N VS A +    +LLE+ +V A HR +  KD+ +Y++  DVR+Q++F ++LE  ++  +D++ +  L K AKSR++ ++ EQ ++K+  ++MQ+ +        AN+TAL AIG ++K
Sbjct:   84 DVVNVVSHATQFRLRSLLEKVSVVAQHRADAVKDEDLYEQTSDVRAQLRFFEQLERIEKQRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 204          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Match: TAF4 (TATA-box binding protein associated factor 4 [Source:NCBI gene;Acc:101174832])

HSP 1 Score: 80.1073 bits (196), Expect = 3.492e-15
Identity = 42/137 (30.66%), Postives = 80/137 (58.39%), Query Frame = 3
Query: 1050 IKSESGTTINISD---EALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRK 1451
            I  E G    +S+   + ++Y+S A +     LLE+ +  A H+    K+D   +++ DVR Q+KF ++L+  ++  ++++ +  L K AKSRS+ ++ EQL++K+  ++MQ+ +        AN+ AL AIG ++K
Sbjct:  752 IALEIGKKFGVSELGTDVISYISHATQQRLQNLLEKVSQVAHHKNVTLKEDERCEQVSDVRGQLKFFEQLDQLEKQRKEEQEREILLKAAKSRSRQEDPEQLRLKQKAKEMQQLELAQIRQREANLAALAAIGPRKK 888          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Match: taf4a (transcription initiation factor TFIID subunit 4 [Source:NCBI gene;Acc:101155764])

HSP 1 Score: 75.485 bits (184), Expect = 8.718e-14
Identity = 41/143 (28.67%), Postives = 82/143 (57.34%), Query Frame = 3
Query: 1050 IKSESGTTINISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRSQMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQEHDKNWDEYSRANMTALKAIGNKRKIIESEDPNS 1478
            I    G T ++  + + ++S A +     LLE+ +  A  +    K+   Y++  DVR+Q+KF ++L+  ++  ++++ +  L K AKSR++ ++ EQL++K+  ++MQ+ +        AN+TAL AIG ++K    + P+S
Sbjct:  617 ISKRHGVT-DLGTDVVTFISHATQQRLQNLLEKVSFVAQQKNINLKESENYEQSSDVRAQLKFFEQLDQLEKQRKEEQEREILLKAAKSRARQEDPEQLRLKQKAKEMQQQELAQMRQREANLTALAAIGPRKKRKNLDSPSS 758          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Planmine SMEST
Match: SMESG000031801.1 (SMESG000031801.1)

HSP 1 Score: 414.461 bits (1064), Expect = 4.746e-143
Identity = 231/232 (99.57%), Postives = 232/232 (100.00%), Query Frame = 3
Query:   27 MNSINRPDLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPEHVLDLNHQTTXXXXXXXXXXXXXXXXXXXXXXXGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF 722
            MNSINRPDLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPE+VLDLNHQTTIISSSNNMNININNSSNNIINSNGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF
Sbjct:    1 MNSINRPDLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPENVLDLNHQTTIISSSNNMNININNSSNNIINSNGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF 232          
BLAST of Transcription initiation factor TFIID subunit 4 vs. Planmine SMEST
Match: SMESG000031801.1 (SMESG000031801.1)

HSP 1 Score: 400.979 bits (1029), Expect = 1.446e-137
Identity = 230/248 (92.74%), Postives = 231/248 (93.15%), Query Frame = 3
Query:   27 MNSINR----------------PDLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPEHVLDLNHQTTXXXXXXXXXXXXXXXXXXXXXXXGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF 722
            MNSINR                 DLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPE+VLDLNHQTTIISSSNNMNININNSSNNIINSNGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF
Sbjct:    1 MNSINRRKYCIFDDLFCIYIFSADLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSITNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNASKATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPENVLDLNHQTTIISSSNNMNININNSSNNIINSNGGTINLRLPTNSLIPQRPITYPQVNNIITRPVVTQQSQILRQANIQARQLRPANPNPQPVF 248          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TAF4B1.770e-1533.10TATA-box binding protein associated factor 4b [Sou... [more]
TAF4B1.855e-1533.10TATA-box binding protein associated factor 4b [Sou... [more]
TAF43.061e-1530.92TATA-box binding protein associated factor 4 [Sour... [more]
TAF47.206e-1531.54TATA-box binding protein associated factor 4 [Sour... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf-47.691e-727.34TAF (TBP-associated transcription factor) family ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf41.115e-1635.56gene:FBgn0010280 transcript:FBtr0333290[more]
Taf41.214e-1635.56gene:FBgn0010280 transcript:FBtr0075451[more]
Taf41.214e-1635.56gene:FBgn0010280 transcript:FBtr0075450[more]
Taf41.247e-1635.56gene:FBgn0010280 transcript:FBtr0114589[more]
Taf41.251e-1635.56gene:FBgn0010280 transcript:FBtr0301911[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-219c3.28.702e-1934.68si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
taf4a7.751e-1832.00TAF4A RNA polymerase II, TATA box binding protein ... [more]
taf4b2.678e-931.06TAF4B RNA polymerase II, TATA box binding protein ... [more]
taf4b3.985e-931.06TAF4B RNA polymerase II, TATA box binding protein ... [more]
taf4b4.950e-931.06TAF4B RNA polymerase II, TATA box binding protein ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TAF4B1.532e-1633.87TATA-box binding protein associated factor 4b [Sou... [more]
cetn47.719e-1632.89centrin 4 [Source:Xenbase;Acc:XB-GENE-920656][more]
cetn48.953e-1632.89centrin 4 [Source:Xenbase;Acc:XB-GENE-920656][more]
cetn47.868e-1532.37centrin 4 [Source:Xenbase;Acc:XB-GENE-920656][more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taf4b3.193e-1633.80TATA-box binding protein associated factor 4b [Sou... [more]
Taf4b3.347e-1633.80TATA-box binding protein associated factor 4b [Sou... [more]
Taf41.137e-1530.92TATA-box binding protein associated factor 4 [Sour... [more]
Taf41.255e-1530.92TATA-box binding protein associated factor 4 [Sour... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P47825|TAF4_DROME1.254e-1535.56Transcription initiation factor TFIID subunit 4 OS... [more]
sp|G5E8Z2|TAF4B_MOUSE2.253e-1533.80Transcription initiation factor TFIID subunit 4B O... [more]
sp|Q92750|TAF4B_HUMAN8.499e-1533.10Transcription initiation factor TFIID subunit 4B O... [more]
sp|O00268|TAF4_HUMAN1.470e-1430.92Transcription initiation factor TFIID subunit 4 OS... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S4MYX81.422e-2025.99Transcription initiation factor TFIID subunit,puta... [more]
E0VZS53.081e-1925.78Transcription initiation factor TFIID subunit, put... [more]
A0A2G8K2392.544e-1839.02Putative transcription initiation factor TFIID sub... [more]
W5M1Q03.792e-1837.90Si:dkey-219c3.2 OS=Lepisosteus oculatus OX=7918 PE... [more]
W5M1R84.602e-1837.90Si:dkey-219c3.2 OS=Lepisosteus oculatus OX=7918 PE... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031575.13.248e-1834.84pep primary_assembly:Astyanax_mexicanus-2.0:18:356... [more]
si:dkey-219c3.24.614e-1734.68si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
si:dkey-219c3.25.955e-1734.68si:dkey-219c3.2 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
TAF41.160e-1431.45TATA-box binding protein associated factor 4 [Sour... [more]
taf4a7.560e-1230.16TAF4A RNA polymerase II, TATA box binding protein ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366847.492e-1327.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-79l17.18.560e-1933.56KIAA0355 ortholog [Source:NCBI gene;Acc:100170629][more]
ENSORLT00000041494.13.567e-1827.91transcription initiation factor TFIID subunit 4 [S... [more]
ENSORLT00000000324.21.581e-1634.71transcription initiation factor TFIID subunit 4 [S... [more]
TAF43.492e-1530.66TATA-box binding protein associated factor 4 [Sour... [more]
taf4a8.718e-1428.67transcription initiation factor TFIID subunit 4 [S... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000031801.14.746e-14399.57SMESG000031801.1[more]
SMESG000031801.11.446e-13792.74SMESG000031801.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021853 ID=SMED30021853|Name=Transcription initiation factor TFIID subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1791bp
CTCTTCCGATCTTATAATTTAAATTAATGAATTCTATTAATAGACCTGAT
CTAAACGCCAGAATAATTAATACAACTGGAGCTCGCCCTAGACCTCAGAA
TGCTAGACTTGTTTGTATTCCAAGTAATAGTACTCAAGTTATGCAAACAC
CGCAGGCATCTAACCAAAATTCCATAACGAATAAATTGTGCAAATTTTTC
AAGAATCTTTTAGAGTTAGAAGAAAAGCAAGGTCGATATAACGAGAGTGT
TGCAGTGATACAAAAATATATTAATAAAGAGATAAATATTGACGAATTGG
GAGTTCAACTCAAAGGAAATGCGTCTAAAGCTACACTTCCAGATTCCTTA
ATGTCTTCACTTAACTCTAATATAGATGATTTGCGCCGGGAAATGTTTTA
TGGTCGTGTTAGGATCGATGGAATTAATCCGCCACCGGAACACGTTTTAG
ATCTTAATCACCAAACGACGATAATTAGCAGTAGCAATAATATGAATATC
AATATTAATAACAGTTCTAATAACATAATAAATTCAAACGGAGGAACAAT
TAACCTACGTCTGCCCACCAATTCATTAATACCTCAACGACCAATAACAT
ACCCACAAGTAAATAATATCATTACTCGCCCTGTTGTTACCCAGCAATCA
CAAATATTACGCCAAGCTAACATACAAGCTAGACAGTTACGACCCGCTAA
TCCCAATCCCCAGCCGGTTTTCTCTTCTTCACAATCCGTTTTAAGTATCC
CAAATGCTAACCTACGTTCAATTGCACCGAGTTCCCCGATTCGTCAACCT
TACATTCAAAACACAATATCAACCAATCAAATTCGCGCGGTTGCCGTGTC
CACTAGTGCCCTCGCCAATAACACGAAATCTGCACCGGTTATTAATAGCG
ATGAGTTGAAAATTGAAACCGTTACGTCGATGGTTGAACATTCATCTCCA
CAAAAACATCAGTCTCACGAACCAATGTCAACAAATAGCGTCAGCCTACC
GACAAATATCATCAACCACCACAATTATCGGAATAAAATCAATGAAATCA
TAAAATCTGAAAGTGGAACAACCATAAATATATCCGATGAAGCTCTTAAT
TACGTGTCGGAAGCTATGGAGAATTTCTCGATAACGCTCCTGGAACAGGC
TGCTGTTTTTGCTTGTCATCGTCAAGAGTTATTCAAAGATGATCCAATCT
ATAAGAAAATCGATGATGTAAGGTCACAAATGAAATTTCTCCAGGAACTC
GAAGACTACCAGCGGAATTTGGAAGATGATAAAATAAAAGCCGAATTGTT
TAAGCAGGCGAAATCTCGATCGAAAATGGACAATCAAGAGCAATTGAAAA
TCAAAGAAACAGTCAGGAAAATGCAGGAACACGACAAAAACTGGGACGAG
TATTCCCGAGCAAACATGACTGCATTGAAAGCCATTGGAAATAAAAGAAA
AATTATCGAATCTGAAGATCCGAATAGCATTCCAATCGGCCTAAAAACGG
CCAGATTGGTTAATCCTAATAATCTCAATTCAAATTTCCAGAATCAGGTT
CCTAATTCTCAGATATATATCAATCCGAATTTTGTTGCCGGGAAATCTCA
AAGACCCTCTACAGTTGCACGTTTTCGCAACAAACGAATCATTCTCAAAG
ATTTTCAATTGGTTTTAGATCAAGACGTCAAATTGAAGAGATTTAAAACT
TATAAAAAGATTTTCACTTATGGCCGTTATTGATTTCATATTTTTTGTAA
ATTTGTTTACGTAAATAAATTCTATTTGCTTTAAAAAAAAA
back to top

protein sequence of SMED30021853-orf-1

>SMED30021853-orf-1 ID=SMED30021853-orf-1|Name=SMED30021853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=569bp
MNSINRPDLNARIINTTGARPRPQNARLVCIPSNSTQVMQTPQASNQNSI
TNKLCKFFKNLLELEEKQGRYNESVAVIQKYINKEINIDELGVQLKGNAS
KATLPDSLMSSLNSNIDDLRREMFYGRVRIDGINPPPEHVLDLNHQTTII
SSSNNMNININNSSNNIINSNGGTINLRLPTNSLIPQRPITYPQVNNIIT
RPVVTQQSQILRQANIQARQLRPANPNPQPVFSSSQSVLSIPNANLRSIA
PSSPIRQPYIQNTISTNQIRAVAVSTSALANNTKSAPVINSDELKIETVT
SMVEHSSPQKHQSHEPMSTNSVSLPTNIINHHNYRNKINEIIKSESGTTI
NISDEALNYVSEAMENFSITLLEQAAVFACHRQELFKDDPIYKKIDDVRS
QMKFLQELEDYQRNLEDDKIKAELFKQAKSRSKMDNQEQLKIKETVRKMQ
EHDKNWDEYSRANMTALKAIGNKRKIIESEDPNSIPIGLKTARLVNPNNL
NSNFQNQVPNSQIYINPNFVAGKSQRPSTVARFRNKRIILKDFQLVLDQD
VKLKRFKTYKKIFTYGRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007900TAF4
Vocabulary: biological process
TermDefinition
GO:0006352DNA-templated transcription, initiation
GO:0006355regulation of transcription, DNA-templated
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0005669transcription factor TFIID complex
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003743translation initiation factor activity
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availablePANTHERPTHR15138FAMILY NOT NAMEDcoord: 29..257
IPR007900Transcription initiation factor TFIID component TAF4PFAMPF05236TAF4coord: 26..259
e-value: 5.5E-21
score: 75.5