Regulator of G-protein signaling 8

Overview
NameRegulator of G-protein signaling 8
Smed IDSMED30021851
Length (bp)1755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling 8 (SMED30021851) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling 8 (SMED30021851) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling 8 (SMED30021851) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling 8 (SMED30021851) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021851

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021851SMESG000016675.1 SmedASXL_007096SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30021851SMESG000016675.1 dd_Smed_v4_8877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021851SMESG000016675.1 dd_Smed_v4_8877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021851SMESG000016675.1 dd_Smed_v6_8877_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021851SMESG000016675.1 OX_Smed_1.0.04975ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Match: RGS20 (regulator of G protein signaling 20 [Source:HGNC Symbol;Acc:HGNC:14600])

HSP 1 Score: 191.045 bits (484), Expect = 3.339e-56
Identity = 87/130 (66.92%), Postives = 102/130 (78.46%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEPS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L
Sbjct:  105 TLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSL 234          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Match: RGS20 (regulator of G protein signaling 20 [Source:HGNC Symbol;Acc:HGNC:14600])

HSP 1 Score: 189.119 bits (479), Expect = 3.946e-55
Identity = 88/134 (65.67%), Postives = 103/134 (76.87%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSS 1533
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEPS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L   S
Sbjct:  137 TLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKS 270          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Match: RGS17 (regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088])

HSP 1 Score: 184.496 bits (467), Expect = 3.645e-54
Identity = 86/152 (56.58%), Postives = 117/152 (76.97%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            +K+E+I   E+    T +E   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N ++IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++P+ H +++AQLQI+TLM RDS+PRFLNS++YK F+    GSS+ S
Sbjct:   59 TKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES 210          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Match: RGS17 (regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088])

HSP 1 Score: 184.496 bits (467), Expect = 3.645e-54
Identity = 86/152 (56.58%), Postives = 117/152 (76.97%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            +K+E+I   E+    T +E   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N ++IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++P+ H +++AQLQI+TLM RDS+PRFLNS++YK F+    GSS+ S
Sbjct:   59 TKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES 210          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Match: RGS20 (regulator of G protein signaling 20 [Source:HGNC Symbol;Acc:HGNC:14600])

HSP 1 Score: 189.889 bits (481), Expect = 5.017e-54
Identity = 87/130 (66.92%), Postives = 102/130 (78.46%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEPS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L
Sbjct:  252 TLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSL 381          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 172.17 bits (435), Expect = 1.465e-50
Identity = 81/124 (65.32%), Postives = 98/124 (79.03%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            W  +F+ LM+  AG+K F EFLK EYS+ENI+F++A EEL+ E N E IEEKAR IYED+ISILSPKEVSLDSRVRE++N+ M  PS+ TFDEAQ QI+TLMQRDSYPRFL S +YK  +   G
Sbjct:   33 WSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFG 156          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 171.785 bits (434), Expect = 3.307e-50
Identity = 81/124 (65.32%), Postives = 98/124 (79.03%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            W  +F+ LM+  AG+K F EFLK EYS+ENI+F++A EEL+ E N E IEEKAR IYED+ISILSPKEVSLDSRVRE++N+ M  PS+ TFDEAQ QI+TLMQRDSYPRFL S +YK  +   G
Sbjct:   52 WSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFG 175          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 171.014 bits (432), Expect = 4.279e-50
Identity = 81/124 (65.32%), Postives = 98/124 (79.03%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            W  +F+ LM+  AG+K F EFLK EYS+ENI+F++A EEL+ E N E IEEKAR IYED+ISILSPKEVSLDSRVRE++N+ M  PS+ TFDEAQ QI+TLMQRDSYPRFL S +YK  +   G
Sbjct:   38 WSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFG 161          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 171.014 bits (432), Expect = 5.108e-50
Identity = 81/124 (65.32%), Postives = 98/124 (79.03%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            W  +F+ LM+  AG+K F EFLK EYS+ENI+F++A EEL+ E N E IEEKAR IYED+ISILSPKEVSLDSRVRE++N+ M  PS+ TFDEAQ QI+TLMQRDSYPRFL S +YK  +   G
Sbjct:   40 WSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFG 163          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Match: rgs-1 (Regulator of G-protein signaling rgs-1 [Source:UniProtKB/Swiss-Prot;Acc:P34295])

HSP 1 Score: 160.999 bits (406), Expect = 7.368e-46
Identity = 75/134 (55.97%), Postives = 100/134 (74.63%), Query Frame = 1
Query: 1123 EKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            E ++ +    W  +FD LM   +G+K F EFLK EYS+ENI+F++A EEL+ E N+E +EEKAR IYED+ISILSPKEVSLDS+VRE++N+ M  P+ +TF++AQ QI+ LM RDSYPRFL S  Y++ L   G
Sbjct:   28 EALSYEMVYSWQQSFDTLMSFKSGQKCFAEFLKSEYSDENILFWQACEELKREKNSEKMEEKARIIYEDFISILSPKEVSLDSKVREIVNTNMSRPTQNTFEDAQHQIYQLMARDSYPRFLTSIFYRETLASFG 161          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0340279)

HSP 1 Score: 187.578 bits (475), Expect = 6.774e-55
Identity = 87/133 (65.41%), Postives = 111/133 (83.46%), Query Frame = 1
Query: 1123 EKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            E+ TL+E + W  +FD LM+S+AGRKVF  FL+ E+SEENI+F+ A E+L+ E + EL+EEKAR IYEDYISILSP+EVSLDSRVRE++N  M+EP++HTFDEAQ+QI+TLM RDSYPRFLNS+ +K  L QL
Sbjct:  126 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKT-LAQL 257          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0301142)

HSP 1 Score: 187.578 bits (475), Expect = 7.393e-55
Identity = 87/133 (65.41%), Postives = 111/133 (83.46%), Query Frame = 1
Query: 1123 EKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            E+ TL+E + W  +FD LM+S+AGRKVF  FL+ E+SEENI+F+ A E+L+ E + EL+EEKAR IYEDYISILSP+EVSLDSRVRE++N  M+EP++HTFDEAQ+QI+TLM RDSYPRFLNS+ +K  L QL
Sbjct:  129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKT-LAQL 260          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084273)

HSP 1 Score: 85.8853 bits (211), Expect = 5.748e-17
Identity = 51/146 (34.93%), Postives = 80/146 (54.79%), Query Frame = 1
Query: 1090 PQSKLEAISSDEKITLDEA--QKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEE---LQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFL 1512
            P S + A  + E    D      W  +F+ ++Q +AG + F EFLK E+S ENI F+ A E    L++E +      +AR I+  +++  S   V++DS+ R L   ++ + +   F  AQ QIF+LM+ DSY RF+ S LYK  +
Sbjct:  801 PPSAITASVAAEGAAQDHGCPSSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRV---AQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCV 943          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0304669)

HSP 1 Score: 85.1149 bits (209), Expect = 5.847e-17
Identity = 46/120 (38.33%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEE---LQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYK 1503
            W  +F+ ++Q +AG + F EFLK E+S ENI F+ A E    L++E +      +AR I+  +++  S   V++DS+ R L   ++ + +   F  AQ QIF+LM+ DSY RF+ S LYK
Sbjct:   65 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRV---AQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYK 181          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084275)

HSP 1 Score: 85.5001 bits (210), Expect = 5.980e-17
Identity = 46/123 (37.40%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1153 WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEE---LQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFL 1512
            W  +F+ ++Q +AG + F EFLK E+S ENI F+ A E    L++E +      +AR I+  +++  S   V++DS+ R L   ++ + +   F  AQ QIF+LM+ DSY RF+ S LYK  +
Sbjct:  458 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRV---AQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCV 577          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Match: rgs19 (regulator of G protein signaling 19 [Source:ZFIN;Acc:ZDB-GENE-080723-72])

HSP 1 Score: 182.57 bits (462), Expect = 9.225e-54
Identity = 88/154 (57.14%), Postives = 116/154 (75.32%), Query Frame = 1
Query: 1093 QSKLEAISSD--EKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNS 1548
            ++KLE    +   K T++E ++W  +FD LM++  GR  F EFL+ EYSEEN++F+ A E+L+NE N   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN +M +P+ H F++AQLQI+TLM RDSYPRFLNS +Y+  +   GGS ++S S
Sbjct:   48 ETKLEPFPWETCPKPTMEEIKQWAQSFDKLMKNPGGRNKFREFLRTEYSEENMLFWLACEDLKNEINKSAIEEKARLIYEDYISILSPKEVSLDSRVREVINRRMQDPTPHIFEDAQLQIYTLMHRDSYPRFLNSSVYRSLVQ--GGSRSSSES 199          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 181.8 bits (460), Expect = 3.661e-53
Identity = 87/144 (60.42%), Postives = 108/144 (75.00%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSI 1557
            K T +E   W  +FD LM   +GR  F +FL+ E+SEEN++F+ A EE + E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLMQRDSYPRF+NS +YK+ L       T S +QS+
Sbjct:   82 KPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSPVYKNLLK------TVSETQSV 219          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 181.8 bits (460), Expect = 4.051e-53
Identity = 87/144 (60.42%), Postives = 108/144 (75.00%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSI 1557
            K T +E   W  +FD LM   +GR  F +FL+ E+SEEN++F+ A EE + E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLMQRDSYPRF+NS +YK+ L       T S +QS+
Sbjct:   86 KPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSPVYKNLLK------TVSETQSV 223          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Match: rgs17 (regulator of G protein signaling 17 [Source:ZFIN;Acc:ZDB-GENE-040718-229])

HSP 1 Score: 178.718 bits (452), Expect = 2.291e-52
Identity = 83/142 (58.45%), Postives = 113/142 (79.58%), Query Frame = 1
Query: 1096 SKLEAISSDEKI--TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLH 1515
            +K+++I + E++  TLDE   W  +F+++M+S  GR VF EFL+ EYSEEN++F+ A E+++ ETN  ++EEKAR IYEDY+SILSPKEVSLDSRVRE IN  + EPSS  ++EAQLQI+TLM RDS+PRFLNS +Y+D L+
Sbjct:   50 TKMDSIEATEELHPTLDEVIAWSRSFEMMMRSPEGRDVFREFLRSEYSEENLLFWIACEDMKKETNPSVVEEKARIIYEDYVSILSPKEVSLDSRVREGINQSLAEPSSTMYEEAQLQIYTLMHRDSFPRFLNSSVYRDLLN 191          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Match: rgs20 (regulator of G protein signaling 20 [Source:ZFIN;Acc:ZDB-GENE-040718-128])

HSP 1 Score: 181.415 bits (459), Expect = 4.253e-52
Identity = 87/144 (60.42%), Postives = 108/144 (75.00%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSI 1557
            K T +E   W  +FD LM   +GR  F +FL+ E+SEEN++F+ A EE + E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLMQRDSYPRF+NS +YK+ L       T S +QS+
Sbjct:  154 KPTAEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSPVYKNLLK------TVSETQSV 291          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Match: RGS17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:100488096])

HSP 1 Score: 183.341 bits (464), Expect = 8.647e-54
Identity = 86/152 (56.58%), Postives = 116/152 (76.32%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            +K+E I  +E+    T +E   W HNFD +M+S AGR +F EFL+ EYSEEN++F+ A E+L+NE N +++E+ AR IYEDYISILSPKEVSLDSRVRE+IN  +++P+ H +++AQLQI+TLM RDS+PRFLNS++YK  L    GS T S
Sbjct:   55 TKMENIQVEEECQTPTAEEILSWSHNFDKMMKSPAGRNLFREFLRTEYSEENLLFWLACEDLKNEQNKKIVEDTARNIYEDYISILSPKEVSLDSRVREVINRNLLDPTPHMYEDAQLQIYTLMHRDSFPRFLNSQVYKSLLESTEGSITES 206          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Match: RGS17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:100488096])

HSP 1 Score: 183.341 bits (464), Expect = 9.486e-54
Identity = 86/152 (56.58%), Postives = 116/152 (76.32%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            +K+E I  +E+    T +E   W HNFD +M+S AGR +F EFL+ EYSEEN++F+ A E+L+NE N +++E+ AR IYEDYISILSPKEVSLDSRVRE+IN  +++P+ H +++AQLQI+TLM RDS+PRFLNS++YK  L    GS T S
Sbjct:   59 TKMENIQVEEECQTPTAEEILSWSHNFDKMMKSPAGRNLFREFLRTEYSEENLLFWLACEDLKNEQNKKIVEDTARNIYEDYISILSPKEVSLDSRVREVINRNLLDPTPHMYEDAQLQIYTLMHRDSFPRFLNSQVYKSLLESTEGSITES 210          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 181.03 bits (458), Expect = 2.699e-52
Identity = 85/137 (62.04%), Postives = 104/137 (75.91%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            TL++   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E +  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EPS  TFD+AQLQI+TLM RDSYPRF+NS +YK+ L  L  S   S
Sbjct:  119 TLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQRTFDDAQLQIYTLMHRDSYPRFMNSAIYKNLLQTLSESPADS 255          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 180.644 bits (457), Expect = 3.566e-52
Identity = 85/137 (62.04%), Postives = 104/137 (75.91%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            TL++   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E +  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EPS  TFD+AQLQI+TLM RDSYPRF+NS +YK+ L  L  S   S
Sbjct:  120 TLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQRTFDDAQLQIYTLMHRDSYPRFMNSAIYKNLLQTLSESPADS 256          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-852864])

HSP 1 Score: 179.874 bits (455), Expect = 7.728e-52
Identity = 85/137 (62.04%), Postives = 104/137 (75.91%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            TL++   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E +  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EPS  TFD+AQLQI+TLM RDSYPRF+NS +YK+ L  L  S   S
Sbjct:  123 TLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQRTFDDAQLQIYTLMHRDSYPRFMNSAIYKNLLQTLSESPADS 259          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Match: Rgs20 (regulator of G-protein signaling 20 [Source:MGI Symbol;Acc:MGI:1929866])

HSP 1 Score: 186.422 bits (472), Expect = 1.098e-54
Identity = 86/131 (65.65%), Postives = 101/131 (77.10%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MV+PS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L 
Sbjct:  103 TLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLA 233          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Match: Rgs20 (regulator of G-protein signaling 20 [Source:MGI Symbol;Acc:MGI:1929866])

HSP 1 Score: 184.882 bits (468), Expect = 1.830e-54
Identity = 86/131 (65.65%), Postives = 101/131 (77.10%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MV+PS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L 
Sbjct:   72 TLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLA 202          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Match: Rgs20 (regulator of G-protein signaling 20 [Source:MGI Symbol;Acc:MGI:1929866])

HSP 1 Score: 186.422 bits (472), Expect = 4.612e-53
Identity = 88/150 (58.67%), Postives = 109/150 (72.67%), Query Frame = 1
Query: 1075 QISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            + S++ ++ + A       TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MV+PS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L 
Sbjct:  217 RASHEIRTDIPACEESPTPTLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLA 366          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 180.644 bits (457), Expect = 8.163e-53
Identity = 87/156 (55.77%), Postives = 118/156 (75.64%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQS 1554
            +K+E+I   E+    T DE   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N + +EEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++PS H +++AQLQI+TLM RDS+PRFLNS++YK F+     S+T+  S+S
Sbjct:   59 TKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVINRSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVE----STTSCTSES 210          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Match: Rgs17 (regulator of G-protein signaling 17 [Source:MGI Symbol;Acc:MGI:1927469])

HSP 1 Score: 180.644 bits (457), Expect = 8.163e-53
Identity = 87/156 (55.77%), Postives = 118/156 (75.64%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQS 1554
            +K+E+I   E+    T DE   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N + +EEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++PS H +++AQLQI+TLM RDS+PRFLNS++YK F+     S+T+  S+S
Sbjct:   59 TKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVINRSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVE----STTSCTSES 210          
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Match: sp|Q9PWA1|RGS20_CHICK (Regulator of G-protein signaling 20 OS=Gallus gallus OX=9031 GN=RGS20 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.578e-55
Identity = 88/134 (65.67%), Postives = 105/134 (78.36%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSS 1533
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E+N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EPS HTFD+AQLQI+TLM RDSYPRF+NS +YKD L  L   S
Sbjct:   82 TLEEVNAWAQSFDKLMLTPAGRNAFREFLRTEFSEENMLFWMACEELKQESNKSVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQHTFDDAQLQIYTLMHRDSYPRFMNSAIYKDLLRSLSEKS 215          
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Match: sp|Q9QZB1|RGS20_MOUSE (Regulator of G-protein signaling 20 OS=Mus musculus OX=10090 GN=Rgs20 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 7.678e-54
Identity = 86/131 (65.65%), Postives = 101/131 (77.10%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLG 1524
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MV+PS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L 
Sbjct:  103 TLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLA 233          
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Match: sp|Q9UGC6|RGS17_HUMAN (Regulator of G-protein signaling 17 OS=Homo sapiens OX=9606 GN=RGS17 PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 1.751e-53
Identity = 86/152 (56.58%), Postives = 117/152 (76.97%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            +K+E+I   E+    T +E   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N ++IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++P+ H +++AQLQI+TLM RDS+PRFLNS++YK F+    GSS+ S
Sbjct:   59 TKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES 210          
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Match: sp|O76081|RGS20_HUMAN (Regulator of G-protein signaling 20 OS=Homo sapiens OX=9606 GN=RGS20 PE=1 SV=4)

HSP 1 Score: 189.889 bits (481), Expect = 2.410e-53
Identity = 87/130 (66.92%), Postives = 102/130 (78.46%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            TL+E   W  +FD LM + AGR  F EFL+ E+SEEN++F+ A EEL+ E N  +IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEPS H FD+AQLQI+TLM RDSYPRF+NS +YKD L  L
Sbjct:  252 TLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSL 381          
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Match: sp|Q9PWA0|RGS17_CHICK (Regulator of G-protein signaling 17 OS=Gallus gallus OX=9031 GN=RGS17 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.830e-53
Identity = 85/150 (56.67%), Postives = 116/150 (77.33%), Query Frame = 1
Query: 1096 SKLEAISSDEKI---TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSST 1536
            +K+E+I   E+    T DE   W  NFD +M++ AGR +F EFL+ EYSEEN++F+ A E+L+ E N ++IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  +++PS H +++AQLQI+TLM RDS+PRFLNS++YK  +  + GS++
Sbjct:   59 TKMESIQVIEECQNPTADEILSWAQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSLVESITGSTS 208          
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Match: A0A5J4N805 (Regulator of G-protein signaling (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0010580 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 5.776e-62
Identity = 103/150 (68.67%), Postives = 124/150 (82.67%), Query Frame = 1
Query: 1069 RTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQ 1518
            R   SNDPQSK++ +S DEK+T +E + W  +FDLLMQ   GRKVF EFL+ EYSEENI+F+ A EEL+ ETN EL+EEKAR IYED+ISILSP+EVSLDSRVRE+IN+ M+EP+ HTFDEAQLQI+TLM RDSY RFLNS++YKD L Q
Sbjct:  399 RPSASNDPQSKMDELSVDEKLTYEEIKSWEDSFDLLMQCPGGRKVFREFLRSEYSEENILFWLACEELKQETNPELVEEKARMIYEDFISILSPREVSLDSRVREIINANMIEPTPHTFDEAQLQIYTLMHRDSYLRFLNSKMYKDLLQQ 548          
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Match: A0A4S2LA62 (RGS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008821 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 5.698e-60
Identity = 101/161 (62.73%), Postives = 128/161 (79.50%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQ 1518
            + ++   ++  R   S DPQS+L+  S +EK+  DE + W  +FDLLMQ  AGRKVF EFL+ EYSEENIMF+ A EEL+ E+N EL+EEKAR IYED+ISILSP+EVSLDSRVRE+IN+ M+EP+ HTFDEAQ+Q++TLM RDSY RFLNSR+YKD LH+
Sbjct:  479 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISILSPREVSLDSRVREIINANMIEPTPHTFDEAQMQVYTLMHRDSYLRFLNSRIYKDLLHR 639          
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Match: G7YDW3 (Regulator of G-protein signaling 20 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_105646 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.195e-59
Identity = 100/161 (62.11%), Postives = 128/161 (79.50%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQ 1518
            + ++   ++  R   S DPQS+L+  S +EK+  DE + W  +FDLLMQ  AGRKVF EFL+ EYSEENIMF+ A EEL+ E+N EL+EEKAR IYED+ISILSP+EVSLDSRVRE+IN+ M+EP+ HTFDEAQ+Q++TLM RDSY RFLNS++YKD LH+
Sbjct:  477 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISILSPREVSLDSRVREIINANMIEPTPHTFDEAQMQVYTLMHRDSYLRFLNSKIYKDLLHR 637          
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Match: A0A094ZRQ6 (Regulator of G-protein signaling 20 OS=Schistosoma haematobium OX=6185 GN=MS3_05149 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.477e-59
Identity = 100/162 (61.73%), Postives = 131/162 (80.86%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            + ++    E  R   SNDPQS ++   SDEK+TL+E +KW  +FD+LM+SS+G+K F EFL+ EYSEENIMF+ A E+++ E+N E++EEKAR IYED+ISILSP+EVSLDSRVRE+INS M+EP+ H FDEAQLQI+TLM RDSYPRFLNS+LYKD + ++
Sbjct:  690 MRVRANLGESKRPSASNDPQSTVDCQISDEKVTLEELEKWAESFDILMRSSSGQKTFREFLRSEYSEENIMFWLACEDIRKESNLEIVEEKARIIYEDFISILSPREVSLDSRVREIINSNMIEPTPHIFDEAQLQIYTLMHRDSYPRFLNSKLYKDMIEEM 851          
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Match: A0A1S8XAC3 (Regulator of G protein signaling domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_00447 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.675e-59
Identity = 100/161 (62.11%), Postives = 128/161 (79.50%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQ 1518
            + ++   ++  R   S DPQS+L+  S +EK+  DE + W  +FDLLMQ  AGRKVF EFL+ EYSEENIMF+ A EEL+ E+N EL+EEKAR IYED+ISILSP+EVSLDSRVRE+IN+ M+EP+ HTFDEAQ+Q++TLM RDSY RFLNS++YKD LH+
Sbjct:  461 MRVRASLQDSKRPSSSLDPQSRLDEQSMEEKLPYDEIKSWGESFDLLMQCPAGRKVFREFLRSEYSEENIMFWLACEELKQESNPELVEEKARMIYEDFISILSPREVSLDSRVREIINANMIEPTPHTFDEAQMQVYTLMHRDSYLRFLNSKIYKDLLHR 621          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Match: rgs19 (regulator of G protein signaling 19 [Source:ZFIN;Acc:ZDB-GENE-080723-72])

HSP 1 Score: 193.741 bits (491), Expect = 4.665e-58
Identity = 94/154 (61.04%), Postives = 121/154 (78.57%), Query Frame = 1
Query: 1093 QSKLEAISSDE--KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNS 1548
            ++KLE I + E  K TL+E ++W  +FD LM++ AGR VF EFL+ EYSEEN++F+ A E+L+ E N   I+EKAR IYEDYISILSPKEVSLDSRVRE+IN +M EP+ HTF++AQLQI+TLM RDSYPRFLNS +Y+  +H  GGS ++S S
Sbjct:   51 ETKLETIPNCEATKPTLEEMKQWAQSFDKLMKNPAGRNVFREFLRTEYSEENMLFWLACEDLKKEINKSAIDEKARMIYEDYISILSPKEVSLDSRVREVINKKMQEPTPHTFEDAQLQIYTLMHRDSYPRFLNSPIYRSLVH--GGSRSSSES 202          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Match: rgs20 (regulator of G protein signaling 20 [Source:NCBI gene;Acc:103034107])

HSP 1 Score: 183.726 bits (465), Expect = 1.204e-53
Identity = 85/137 (62.04%), Postives = 105/137 (76.64%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            T++E + W  +FD LM   +GR  F +FL+ E+SEEN++F+ A EE   ETN   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLMQRDSYPRF+NS +YK+ L  +   S  S
Sbjct:  112 TVEEVRAWGQSFDKLMHCPSGRSAFRQFLRTEFSEENMLFWLACEEFTKETNKSAIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSAVYKNLLKSVSEQSPES 248          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Match: rgs20 (regulator of G protein signaling 20 [Source:NCBI gene;Acc:103034107])

HSP 1 Score: 182.57 bits (462), Expect = 1.261e-52
Identity = 85/137 (62.04%), Postives = 105/137 (76.64%), Query Frame = 1
Query: 1132 TLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            T++E + W  +FD LM   +GR  F +FL+ E+SEEN++F+ A EE   ETN   IEEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLMQRDSYPRF+NS +YK+ L  +   S  S
Sbjct:  158 TVEEVRAWGQSFDKLMHCPSGRSAFRQFLRTEFSEENMLFWLACEEFTKETNKSAIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSAVYKNLLKSVSEQSPES 294          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Match: rgs17 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:103040587])

HSP 1 Score: 172.555 bits (436), Expect = 5.415e-50
Identity = 79/136 (58.09%), Postives = 108/136 (79.41%), Query Frame = 1
Query: 1111 ISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQ 1518
            ++ ++  TLDE   W  +F+++M+S+ GR++F EFL+ EYSEEN+MF+ A E+L+ ET+   IEEKAR IYEDY+SILSPKEVSLDSRVRE IN  + EPSS  +++AQLQI+TLM RDS+PRFLNS +Y++ L +
Sbjct:   66 VTEEQHPTLDEVVAWARSFEMMMRSTEGREIFKEFLQSEYSEENLMFWIACEDLKKETSPSTIEEKARIIYEDYVSILSPKEVSLDSRVREGINLSLAEPSSLMYEDAQLQIYTLMHRDSFPRFLNSSVYRELLER 201          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Match: ENSAMXT00000052296.1 (regulator of G-protein signaling 20-like [Source:NCBI gene;Acc:103022271])

HSP 1 Score: 169.474 bits (428), Expect = 1.286e-48
Identity = 82/153 (53.59%), Postives = 108/153 (70.59%), Query Frame = 1
Query: 1090 PQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNS 1548
            P S L+ I      TL+E + W   F+ L++S  GR  F +FLK E+SEEN++F+ A EEL+ ETN   +E+  + IYEDY+SILSP+EVSLDSRVRE+IN  M+EPSS TFD+AQ QI+TLMQRDSYPR++NS +Y D +  L    T + S
Sbjct:   80 PNSLLDMIRGP---TLEEVRLWGQTFEQLIKSPRGRASFRQFLKTEFSEENLLFWLACEELKKETNRTAVEQTVKQIYEDYVSILSPREVSLDSRVREVINKNMMEPSSQTFDDAQQQIYTLMQRDSYPRYINSSMYADLIKSLEEPPTPNES 229          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003940.1 (pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-1 gene:ENSPMAG00000003600.1 transcript:ENSPMAT00000003940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 4.611e-58
Identity = 91/139 (65.47%), Postives = 112/139 (80.58%), Query Frame = 1
Query: 1093 QSKLEAISSDE---KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLY 1500
            +SKLE+I S E   K++L+E   W H F+ LM S+AGR VF EFL+ E+SEEN++F+ A E+L+ E N  ++EEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEPS+HTFD+AQLQI+TLM RDSYPRFL S +Y
Sbjct:   64 ESKLESIQSPEESGKLSLEEVTSWSHCFERLMHSAAGRAVFREFLRTEFSEENLLFWLACEDLKKEENKNIVEEKARTIYEDYISILSPKEVSLDSRVREVINRNMVEPSAHTFDDAQLQIYTLMHRDSYPRFLGSSVY 202          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008468.1 (pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-1 gene:ENSPMAG00000007670.1 transcript:ENSPMAT00000008468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 4.397e-56
Identity = 87/142 (61.27%), Postives = 110/142 (77.46%), Query Frame = 1
Query: 1117 SDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            S  K +++E Q W  +FD L++S+ GR  F EFL+ E+SEEN++F+ A E+L+ E N   +EEKAR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+SHTFD+AQLQI+TLM RDSYPRFLNS++YK     L  SS+ S
Sbjct:   65 SSGKPSMEEVQVWGQSFDKLIRSTGGRNTFREFLRTEFSEENMLFWLACEDLKREANKRAVEEKARVIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMHRDSYPRFLNSQIYKSLQDSLAESSSES 206          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000303.1 (pep scaffold:Pmarinus_7.0:GL477001:8680:13381:-1 gene:ENSPMAG00000000271.1 transcript:ENSPMAT00000000303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 9.841e-56
Identity = 96/174 (55.17%), Postives = 125/174 (71.84%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSD-----EKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            L I+ + EE +  + S D  +KLE+I S      E I  +  + W  +FD LM+S+AGR+VF EFL+ E+SEEN++F+ + EEL +E++   IEE+AR IYEDYISILSPKEVSLDSRVRE+IN  M+EP+ H FD+AQLQI+TLM RDSYPRF+NS LYK  L+    SST  
Sbjct:   57 LAIRNREEEDVGRRTSRD--TKLESIPSPGERPHELIQKNNRRAWGRSFDRLMRSAAGRRVFREFLRSEFSEENLLFWLSCEELTHESDPAAIEERARNIYEDYISILSPKEVSLDSRVREVINRNMLEPTPHAFDDAQLQIYTLMHRDSYPRFINSVLYKSLLNSTRASSTAG 228          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010564.1 (pep scaffold:Pmarinus_7.0:GL481967:17435:18590:-1 gene:ENSPMAG00000009570.1 transcript:ENSPMAT00000010564.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 9.683e-42
Identity = 73/142 (51.41%), Postives = 93/142 (65.49%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQ 1551
            +   DE   W  +F+ L++S  GR  F  FL+ E+SE+N++F+ A EEL+  T+   + E+ R IYE+YISILSP+EVSLDSR RE IN  M EP   TFDEAQ QI+ LMQRDSYPRFL S  Y+  L      ST + SQ
Sbjct:    3 RAGADEVLAWGRSFERLVRSPTGRAHFRHFLRGEFSEDNLLFWLACEELRAGTDDTSLPERMRTIYEEYISILSPREVSLDSRAREAINEGMEEPGVGTFDEAQQQIYMLMQRDSYPRFLASEHYRSLLQGAPDKSTAAVSQ 144          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006812.1 (pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1 gene:ENSPMAG00000006145.1 transcript:ENSPMAT00000006812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 3.216e-31
Identity = 56/124 (45.16%), Postives = 78/124 (62.90%), Query Frame = 1
Query: 1138 DEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDF 1509
            DEA  W  + D L+    G   F  FL+ E+SEENI F+ A E+ +   +   +  KAR I+ +YI+I SP EV+LDS  REL  + + +P++  FD AQ +IF LM++DSYPRFL S+LY D 
Sbjct:   30 DEAHAWAESLDKLLVHKYGLAAFQAFLRTEFSEENINFWLACEDYKKTKSAAKLTSKARKIFSEYIAIQSPNEVNLDSCTRELTAANLAKPTADAFDVAQKRIFGLMEKDSYPRFLRSQLYLDL 153          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 123.635 bits (309), Expect = 4.913e-33
Identity = 57/129 (44.19%), Postives = 84/129 (65.12%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFL 1512
            K T+DE + W H+F  L+ S  G   F EFL+ +Y EEN+ F+ AVE+ +   + E   + AR IYEDY+S LSP E+SLD+++R  ++  M +P  +TFD AQ  I+TLM  D +PRF+ S+ YK+ +
Sbjct:   33 KPTIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVSTLSPTEISLDAKIRATVDKSMSDPDQNTFDPAQDHIYTLMYHDCFPRFIKSKHYKNLI 161          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 119.783 bits (299), Expect = 9.680e-32
Identity = 55/122 (45.08%), Postives = 85/122 (69.67%), Query Frame = 1
Query: 1138 DEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYK 1503
            +E  +W  +F+ L+ S  G +VFHEFLK EYSEEN++F+ AVE L+ ET    ++  A+ IY DY+S  SPKEVS+D + R++I+ ++ +P+  TF +AQ  ++ +M +D YPRFL+S  +K
Sbjct:   28 EEINEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNLAQTIYNDYVSTESPKEVSIDHKTRQVIDDEISQPTKETFSKAQQHVYYVMYQDCYPRFLSSSTFK 149          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 98.2117 bits (243), Expect = 2.787e-21
Identity = 47/121 (38.84%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1150 KWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFL 1512
            +W   FD LM   AG   F EFLK E+SEENI+F+ A EE ++ ++ + ++  A  I+E ++S  +   V++DS   ++    ++ P++H +   Q Q++TLM+ DSYPRFL S LY+  L
Sbjct:  653 RWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLSPNALMPVNIDSSAVKVAEEHLLNPTNHMYRVPQQQVYTLMKFDSYPRFLKSDLYRQCL 773          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 88.5817 bits (218), Expect = 5.996e-19
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 1
Query: 1144 AQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFL 1512
             ++W  +   L++   GRK F  FL+ E+S EN+ F+ A E L+  T  + + EKA+ IY +Y+S  S   +++D +  E +   + +P  + FD AQ  IF LM+ DSY RFL S LYK+ L
Sbjct:  270 VKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKA-TPIKQVPEKAQEIYTEYLSEHSTSPINVDCKTHEEVEMNLEKPGRYMFDAAQDHIFQLMKSDSYSRFLRSELYKELL 391          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Match: EDO44861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI9])

HSP 1 Score: 50.447 bits (119), Expect = 1.685e-6
Identity = 31/129 (24.03%), Postives = 66/129 (51.16%), Query Frame = 1
Query: 1144 AQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTEL-IEEKARAIYEDYI------SILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDF 1509
             ++W ++F  L+  S G  +F+++L+ E +   + F R  E  +    T   +   A+ +++ ++       +L  K+ +  +++   +N Q  +P+   FD A  ++ + M++  Y  F+NS LYKDF
Sbjct:   87 CERWANSFTDLLNDSDGSNLFYKYLRREGASILLDFSRECEAYRRMVPTSTQMRTTAKTLFQKFVYPRQFCELLGVKDTTR-TQIAHHVNDQPADPA--LFDGAYAEVVSYMKKCHYVGFVNSNLYKDF 212          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Match: ENSORLT00000022304.2 (regulator of G-protein signaling 20 [Source:NCBI gene;Acc:101161339])

HSP 1 Score: 185.652 bits (470), Expect = 9.657e-55
Identity = 88/139 (63.31%), Postives = 105/139 (75.54%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            K TL+E   W  +FD LM   AGR  F +FL+ E+SEEN++F+ A EE   ETN  +IEEKAR IYEDYISILSPKEVSLDSRVRE IN  MVEP+SHTF++AQLQI+TLMQRDSYPR+LNS  +K+ L+ L   S  S
Sbjct:   82 KPTLEEVHSWGQSFDKLMGCPAGRNCFRQFLRTEFSEENMLFWLACEEFSKETNKSMIEEKARVIYEDYISILSPKEVSLDSRVRETINRNMVEPTSHTFEDAQLQIYTLMQRDSYPRYLNSSAHKNLLNSLSEQSPES 220          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Match: ENSORLT00000035946.1 (regulator of G-protein signaling 20 [Source:NCBI gene;Acc:101161339])

HSP 1 Score: 185.652 bits (470), Expect = 9.657e-55
Identity = 88/139 (63.31%), Postives = 105/139 (75.54%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTS 1542
            K TL+E   W  +FD LM   AGR  F +FL+ E+SEEN++F+ A EE   ETN  +IEEKAR IYEDYISILSPKEVSLDSRVRE IN  MVEP+SHTF++AQLQI+TLMQRDSYPR+LNS  +K+ L+ L   S  S
Sbjct:   82 KPTLEEVHSWGQSFDKLMGCPAGRNCFRQFLRTEFSEENMLFWLACEEFSKETNKSMIEEKARVIYEDYISILSPKEVSLDSRVRETINRNMVEPTSHTFEDAQLQIYTLMQRDSYPRYLNSSAHKNLLNSLSEQSPES 220          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Match: rgs19 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:101158610])

HSP 1 Score: 184.111 bits (466), Expect = 7.065e-54
Identity = 92/159 (57.86%), Postives = 122/159 (76.73%), Query Frame = 1
Query: 1078 ISNDPQSKLEAISSDE--KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNS 1548
            IS D  +K+E I+ +   K +++E + W  +FD LM++ AGR VF EFL+ EYSEEN++F+ A E+L+ E N   IEEKA +IYEDYISILSPKEVSLD+RVRE+IN +M +P+ HTF++AQLQI+TLM RDSYPRFL+S +YK  +H  GGS T+S S
Sbjct:   91 ISQD--NKMEPINCEACTKPSVEEIRLWSQSFDKLMRNPAGRNVFREFLRTEYSEENMLFWLACEDLKQEANKSAIEEKACSIYEDYISILSPKEVSLDARVREVINRKMQDPTPHTFEDAQLQIYTLMHRDSYPRFLSSNIYKALIH--GGSRTSSES 245          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Match: rgs19 (regulator of G-protein signaling 17 [Source:NCBI gene;Acc:101158610])

HSP 1 Score: 183.726 bits (465), Expect = 7.804e-54
Identity = 92/159 (57.86%), Postives = 122/159 (76.73%), Query Frame = 1
Query: 1078 ISNDPQSKLEAISSDE--KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNS 1548
            IS D  +K+E I+ +   K +++E + W  +FD LM++ AGR VF EFL+ EYSEEN++F+ A E+L+ E N   IEEKA +IYEDYISILSPKEVSLD+RVRE+IN +M +P+ HTF++AQLQI+TLM RDSYPRFL+S +YK  +H  GGS T+S S
Sbjct:   77 ISQD--NKMEPINCEACTKPSVEEIRLWSQSFDKLMRNPAGRNVFREFLRTEYSEENMLFWLACEDLKQEANKSAIEEKACSIYEDYISILSPKEVSLDARVREVINRKMQDPTPHTFEDAQLQIYTLMHRDSYPRFLSSNIYKALIH--GGSRTSSES 231          
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Match: RGS20 (regulator of G-protein signaling 20 [Source:NCBI gene;Acc:101160855])

HSP 1 Score: 182.185 bits (461), Expect = 5.100e-53
Identity = 83/132 (62.88%), Postives = 106/132 (80.30%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQL 1521
            K TL++A  W  +F+ +M+S+AGR  F +FL+ E+SEEN+MF+ A EEL+ ETN  ++EEK R IYED+ISILSPKEVSLDSRVRE+IN  M+EP+S TFD+AQ QI+TLMQRDSYPRF+NS +Y D L  L
Sbjct:  115 KPTLEDANSWAVSFERVMKSAAGRSCFRQFLRTEFSEENMMFWLACEELKKETNKIVVEEKVRQIYEDFISILSPKEVSLDSRVREVINKNMLEPTSQTFDDAQQQIYTLMQRDSYPRFINSSMYTDLLKNL 246          
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Match: SMESG000016675.1 (SMESG000016675.1)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 436/437 (99.77%), Postives = 437/437 (100.00%), Query Frame = 1
Query:  253 MSTSHHQPIAFLWKTKEINNLKWAATRDIFLDIILISKLLRNKYVTKLSQHQEPKSHKTDKLSIRKKSMFGGXXXXXXXXXXXXXXXXXYRASRLAHYQDQMYEETANLGSIRPSRRSSNLSGFSINSQYGTPYLHPTQEQFHXXXXXXXXXXXXXXXXXADDAPSDLHCKITQTSKSSDSKNESKPNQTEKEIKSNVRSHSIGPTAGLNDRVVFMSLHNQTTLDTTELSTLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSIAE 1563
            MSTSHHQPIAFLWKTKEINNLKWAATRDIFLDIILISKLLRNKYVTKLSQHQEPKSHKTDKLSIRKKSMFGGVNSSNMVMSSSVKCMSNYRASRLAHYQDQMYEETANLGSIRPSRRSSNLSGFSINSQYGTPYLHPTQEQFHQLLTNNDDMNNNIQNLTADDAPSDLHCKITQTSKSSDSK+ESKPNQTEKEIKSNVRSHSIGPTAGLNDRVVFMSLHNQTTLDTTELSTLASRSNPISRNNPSSRACYFCWCCCCSCSCLNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSIAE
Sbjct:    1 MSTSHHQPIAFLWKTKEINNLKWAATRDIFLDIILISKLLRNKYVTKLSQHQEPKSHKTDKLSIRKKSMFGGVNSSNMVMSSSVKCMSNYRASRLAHYQDQMYEETANLGSIRPSRRSSNLSGFSINSQYGTPYLHPTQEQFHQLLTNNDDMNNNIQNLTADDAPSDLHCKITQTSKSSDSKDESKPNQTEKEIKSNVRSHSIGPTAGLNDRVVFMSLHNQTTLDTTELSTLASRSNPISRNNPSSRACYFCWCCCCSCSCLNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSIAE 437          
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Match: SMESG000073688.1 (SMESG000073688.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.376e-63
Identity = 102/152 (67.11%), Postives = 126/152 (82.89%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNS 1491
            LN+    E+  R QISND  S++EAI ++EK TLD  +KW  +F++L+Q SAG+K+F EFLKLEYSEENI+FY A E+L++ET  +++EEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEP++ TFDEAQLQI+TLM RDSYPRFLNS
Sbjct:  160 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISILSPKEVSLDSRVREIINDNMVEPTAFTFDEAQLQIYTLMHRDSYPRFLNS 311          
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Match: SMESG000073688.1 (SMESG000073688.1)

HSP 1 Score: 212.616 bits (540), Expect = 1.386e-63
Identity = 102/152 (67.11%), Postives = 126/152 (82.89%), Query Frame = 1
Query: 1036 LNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNS 1491
            LN+    E+  R QISND  S++EAI ++EK TLD  +KW  +F++L+Q SAG+K+F EFLKLEYSEENI+FY A E+L++ET  +++EEKAR IYEDYISILSPKEVSLDSRVRE+IN  MVEP++ TFDEAQLQI+TLM RDSYPRFLNS
Sbjct:  165 LNVHSSSEDSSRPQISNDLTSRIEAIINEEKTTLDFVKKWSESFEILIQCSAGQKIFREFLKLEYSEENILFYLACEDLKSETEPDIVEEKARFIYEDYISILSPKEVSLDSRVREIINDNMVEPTAFTFDEAQLQIYTLMHRDSYPRFLNS 316          
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.190e-25
Identity = 50/125 (40.00%), Postives = 83/125 (66.40%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLY 1500
            K ++++ +KW ++F+ L+    G  +FHEFL+ E+S+ENI F+ A EE +  T  + ++ +A  IY D++ + + +EV+LDS+ R+     +  P+ HTFD+AQ +I  LM++DSY RFL S LY
Sbjct:  291 KSSIEQIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGVQAAREVNLDSKTRQQTEIDIRNPNPHTFDQAQKRIQALMEKDSYQRFLRSELY 415          
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Match: SMESG000048981.1 (SMESG000048981.1)

HSP 1 Score: 107.457 bits (267), Expect = 2.985e-24
Identity = 50/136 (36.76%), Postives = 88/136 (64.71%), Query Frame = 1
Query: 1126 KITLDEAQKWCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIEEKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFTLMQRDSYPRFLNSRLYKDFLHQLGGSS 1533
            K+  ++ Q+W  +F+ L+    G  +FH++LK EYSEENI F+ A EE +  TN + +  +A+ I +D+++  +PKEV++DS+ R++    +  P+++ FD AQ +I +LM+ DSY RFL S +Y+  +  +  +S
Sbjct:  338 KLLNEQIQRWNESFEQLLNDKYGLALFHDYLKSEYSEENIEFWIACEEFKTITNPKKMASRAQKIIKDFVTTQAPKEVNIDSKTRQITLESIQHPNANMFDMAQKRIQSLMEIDSYQRFLRSEMYQALMQDIKKAS 473          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS203.339e-5666.92regulator of G protein signaling 20 [Source:HGNC S... [more]
RGS203.946e-5565.67regulator of G protein signaling 20 [Source:HGNC S... [more]
RGS173.645e-5456.58regulator of G protein signaling 17 [Source:HGNC S... [more]
RGS173.645e-5456.58regulator of G protein signaling 17 [Source:HGNC S... [more]
RGS205.017e-5466.92regulator of G protein signaling 20 [Source:HGNC S... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs-21.465e-5065.32Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-23.307e-5065.32Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-24.279e-5065.32Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-25.108e-5065.32Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-17.368e-4655.97Regulator of G-protein signaling rgs-1 [Source:Un... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhit6.774e-5565.41gene:FBgn0028743 transcript:FBtr0340279[more]
Dhit7.393e-5565.41gene:FBgn0028743 transcript:FBtr0301142[more]
loco5.748e-1734.93gene:FBgn0020278 transcript:FBtr0084273[more]
loco5.847e-1738.33gene:FBgn0020278 transcript:FBtr0304669[more]
loco5.980e-1737.40gene:FBgn0020278 transcript:FBtr0084275[more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs199.225e-5457.14regulator of G protein signaling 19 [Source:ZFIN;A... [more]
rgs203.661e-5360.42regulator of G protein signaling 20 [Source:ZFIN;A... [more]
rgs204.051e-5360.42regulator of G protein signaling 20 [Source:ZFIN;A... [more]
rgs172.291e-5258.45regulator of G protein signaling 17 [Source:ZFIN;A... [more]
rgs204.253e-5260.42regulator of G protein signaling 20 [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS178.647e-5456.58regulator of G-protein signaling 17 [Source:NCBI g... [more]
RGS179.486e-5456.58regulator of G-protein signaling 17 [Source:NCBI g... [more]
rnf19a2.699e-5262.04ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
rnf19a3.566e-5262.04ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
rnf19a7.728e-5262.04ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs201.098e-5465.65regulator of G-protein signaling 20 [Source:MGI Sy... [more]
Rgs201.830e-5465.65regulator of G-protein signaling 20 [Source:MGI Sy... [more]
Rgs204.612e-5358.67regulator of G-protein signaling 20 [Source:MGI Sy... [more]
Rgs178.163e-5355.77regulator of G-protein signaling 17 [Source:MGI Sy... [more]
Rgs178.163e-5355.77regulator of G-protein signaling 17 [Source:MGI Sy... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PWA1|RGS20_CHICK1.578e-5565.67Regulator of G-protein signaling 20 OS=Gallus gall... [more]
sp|Q9QZB1|RGS20_MOUSE7.678e-5465.65Regulator of G-protein signaling 20 OS=Mus musculu... [more]
sp|Q9UGC6|RGS17_HUMAN1.751e-5356.58Regulator of G-protein signaling 17 OS=Homo sapien... [more]
sp|O76081|RGS20_HUMAN2.410e-5366.92Regulator of G-protein signaling 20 OS=Homo sapien... [more]
sp|Q9PWA0|RGS17_CHICK2.830e-5356.67Regulator of G-protein signaling 17 OS=Gallus gall... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N8055.776e-6268.67Regulator of G-protein signaling (Fragment) OS=Par... [more]
A0A4S2LA625.698e-6062.73RGS domain-containing protein OS=Opisthorchis feli... [more]
G7YDW31.195e-5962.11Regulator of G-protein signaling 20 (Fragment) OS=... [more]
A0A094ZRQ61.477e-5961.73Regulator of G-protein signaling 20 OS=Schistosoma... [more]
A0A1S8XAC31.675e-5962.11Regulator of G protein signaling domain protein (F... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs194.665e-5861.04regulator of G protein signaling 19 [Source:ZFIN;A... [more]
rgs201.204e-5362.04regulator of G protein signaling 20 [Source:NCBI g... [more]
rgs201.261e-5262.04regulator of G protein signaling 20 [Source:NCBI g... [more]
rgs175.415e-5058.09regulator of G-protein signaling 17 [Source:NCBI g... [more]
ENSAMXT00000052296.11.286e-4853.59regulator of G-protein signaling 20-like [Source:N... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003940.14.611e-5865.47pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-... [more]
ENSPMAT00000008468.14.397e-5661.27pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-... [more]
ENSPMAT00000000303.19.841e-5655.17pep scaffold:Pmarinus_7.0:GL477001:8680:13381:-1 g... [more]
ENSPMAT00000010564.19.683e-4251.41pep scaffold:Pmarinus_7.0:GL481967:17435:18590:-1 ... [more]
ENSPMAT00000006812.13.216e-3145.16pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328044.913e-3344.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373709.680e-3245.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431262.787e-2138.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343515.996e-1938.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448611.685e-624.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022304.29.657e-5563.31regulator of G-protein signaling 20 [Source:NCBI g... [more]
ENSORLT00000035946.19.657e-5563.31regulator of G-protein signaling 20 [Source:NCBI g... [more]
rgs197.065e-5457.86regulator of G-protein signaling 17 [Source:NCBI g... [more]
rgs197.804e-5457.86regulator of G-protein signaling 17 [Source:NCBI g... [more]
RGS205.100e-5362.88regulator of G-protein signaling 20 [Source:NCBI g... [more]
back to top
BLAST of Regulator of G-protein signaling 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016675.10.000e+099.77SMESG000016675.1[more]
SMESG000073688.11.376e-6367.11SMESG000073688.1[more]
SMESG000073688.11.386e-6367.11SMESG000073688.1[more]
SMESG000011723.11.190e-2540.00SMESG000011723.1[more]
SMESG000048981.12.985e-2436.76SMESG000048981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021851 ID=SMED30021851|Name=Regulator of G-protein signaling 8|organism=Schmidtea mediterranea sexual|type=transcript|length=1755bp
GACAATGCTGGGTCTATGATAATAGTAATAATTATTAATAATAATCTACC
GAGAACTGCATTAGAATCTTGATTGTTCTTTCTCTATGATGATAAAATGA
TACTTTCTCGTTTTATTGCATCATAACCTTTTCATCGAGTATTCATTTAT
ATGGAATGTGGATTTTAAAACTCGTCAGAGATTCACTTAGATTTTGCAAC
AATTTGGATTCAAAGTCAGTATTTTATAGGAATTTTAAACAAAATCTATT
TGATGAGCACAAGCCATCATCAACCAATTGCCTTTCTTTGGAAAACGAAA
GAAATTAATAATTTGAAGTGGGCTGCAACTAGAGATATATTTCTAGACAT
AATTTTGATCTCGAAATTATTGCGCAACAAATACGTTACTAAACTTAGTC
AACATCAAGAACCGAAATCTCATAAAACTGACAAACTTTCCATTAGAAAG
AAGTCGATGTTTGGTGGCGTAAACAGCAGCAACATGGTAATGAGCAGCAG
TGTAAAATGTATGAGTAATTATCGCGCGTCACGACTAGCTCACTATCAAG
ATCAGATGTACGAGGAAACCGCCAACCTAGGCTCTATTCGTCCGAGTCGT
CGAAGTAGCAATCTCAGTGGTTTTAGTATAAACAGTCAATATGGAACTCC
ATATCTCCACCCGACGCAGGAACAATTTCATCAGTTGCTTACAAATAACG
ACGATATGAATAACAATATCCAAAATCTCACCGCAGACGATGCACCTTCA
GATCTCCATTGCAAAATTACCCAGACATCGAAATCTAGTGATTCAAAAAA
CGAATCTAAACCAAATCAAACAGAGAAGGAAATTAAGTCAAATGTAAGAT
CACACAGCATAGGCCCGACAGCAGGTCTCAATGACAGGGTCGTATTCATG
TCTCTCCACAATCAAACGACTTTAGATACCACAGAACTGTCAACATTGGC
ATCGAGATCTAATCCGATTTCCAGAAATAATCCCAGTTCCAGAGCTTGTT
ATTTTTGCTGGTGTTGTTGTTGTAGTTGCTCATGCTTAAATATTAAACCA
AAGTTTGAAGAACCTTTACGTACTCAAATTTCAAATGATCCTCAATCAAA
ACTTGAAGCGATTTCAAGCGACGAAAAAATTACTCTTGACGAAGCACAAA
AATGGTGTCATAATTTTGATCTTCTTATGCAAAGTTCAGCCGGTCGAAAA
GTATTTCATGAATTCTTGAAACTGGAATACAGTGAAGAAAATATAATGTT
TTATCGAGCTGTAGAAGAATTGCAAAATGAAACAAATACCGAACTTATTG
AAGAAAAGGCTCGAGCAATTTATGAAGATTACATATCTATTTTATCTCCC
AAAGAAGTCAGTCTTGACTCAAGAGTCAGGGAGCTCATAAATTCCCAGAT
GGTGGAGCCTTCATCTCACACCTTCGACGAAGCTCAGTTACAAATTTTCA
CTCTAATGCAGCGTGACTCTTACCCTAGGTTTCTCAATTCAAGGTTATAC
AAAGATTTTTTGCACCAACTTGGAGGAAGTTCAACAACTTCAAACAGTCA
AAGTATCGCTGAAAGTCGACCAAACAACAGCAGCTAACAAAATCGAAATT
GTTATTCTTTTTCAATGACAAAAACAAAAACACAAACTAACATCTTAGAA
ATCTCTTAAAATATTCTCTTGGTCGCACTTTTAATTTTAAAATATTGATT
ATAAATATCAATAATTGCAATATTTTTCACAGAAAAAAAAACATTCATAA
TGGAT
back to top

protein sequence of SMED30021851-orf-1

>SMED30021851-orf-1 ID=SMED30021851-orf-1|Name=SMED30021851-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=445bp
MSTSHHQPIAFLWKTKEINNLKWAATRDIFLDIILISKLLRNKYVTKLSQ
HQEPKSHKTDKLSIRKKSMFGGVNSSNMVMSSSVKCMSNYRASRLAHYQD
QMYEETANLGSIRPSRRSSNLSGFSINSQYGTPYLHPTQEQFHQLLTNND
DMNNNIQNLTADDAPSDLHCKITQTSKSSDSKNESKPNQTEKEIKSNVRS
HSIGPTAGLNDRVVFMSLHNQTTLDTTELSTLASRSNPISRNNPSSRACY
FCWCCCCSCSCLNIKPKFEEPLRTQISNDPQSKLEAISSDEKITLDEAQK
WCHNFDLLMQSSAGRKVFHEFLKLEYSEENIMFYRAVEELQNETNTELIE
EKARAIYEDYISILSPKEVSLDSRVRELINSQMVEPSSHTFDEAQLQIFT
LMQRDSYPRFLNSRLYKDFLHQLGGSSTTSNSQSIAESRPNNSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036305RGS_sf
IPR016137RGS
IPR024066RGS_subdom1/3
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0031410cytoplasmic vesicle
Vocabulary: biological process
TermDefinition
GO:0009968negative regulation of signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 142..162
NoneNo IPR availableGENE3DG3DSA:1.20.58.1850coord: 274..423
e-value: 1.1E-44
score: 153.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 174..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..198
NoneNo IPR availablePANTHERPTHR10845REGULATOR OF G PROTEIN SIGNALINGcoord: 233..423
NoneNo IPR availablePANTHERPTHR10845:SF175REGULATOR OF G-PROTEIN SIGNALING 20coord: 233..423
IPR016137RGS domainPRINTSPR01301RGSPROTEINcoord: 352..375
score: 39.22
coord: 323..341
score: 48.28
coord: 394..413
score: 62.5
coord: 301..322
score: 38.54
IPR016137RGS domainSMARTSM00315RGS_3coord: 304..420
e-value: 3.2E-40
score: 149.6
IPR016137RGS domainPFAMPF00615RGScoord: 305..419
e-value: 5.3E-30
score: 104.1
IPR016137RGS domainPROSITEPS50132RGScoord: 304..420
score: 38.382
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 292..422