SMED30021849

Overview
NameSMED30021849
Smed IDSMED30021849
Length (bp)1661
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30021849 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008402:24617..26778 +8145
Homology
BLAST of SMED30021849 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 56.6102 bits (135), Expect = 1.010e-7
Identity = 78/336 (23.21%), Postives = 127/336 (37.80%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN------FPNSEAIQSL-PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQ 1202
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +      L       F      F  + ++ +   Q   Y +  + T P F   + WC K +   R      + +L + P         +   + ++ P  R         + +   +E  +S +R +   +R+  + E L     R         P+ E  ++L P  T  LT+ +L         R LL      +    + +  V + LF+D L++TK  +K    K KV R  + L  L C      NSF L     FQ
Sbjct:  166 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEE-TRASGQPLDPIGL----QSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQM----LCDLLIKPHQRITKYPLLLHAVLKRSPEAR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVAS--EHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKAD--KAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQ 481          
BLAST of SMED30021849 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 56.6102 bits (135), Expect = 1.010e-7
Identity = 78/336 (23.21%), Postives = 127/336 (37.80%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN------FPNSEAIQSL-PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQ 1202
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +      L       F      F  + ++ +   Q   Y +  + T P F   + WC K +   R      + +L + P         +   + ++ P  R         + +   +E  +S +R +   +R+  + E L     R         P+ E  ++L P  T  LT+ +L         R LL      +    + +  V + LF+D L++TK  +K    K KV R  + L  L C      NSF L     FQ
Sbjct:  166 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEE-TRASGQPLDPIGL----QSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQM----LCDLLIKPHQRITKYPLLLHAVLKRSPEAR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVAS--EHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKAD--KAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQ 481          
BLAST of SMED30021849 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 56.6102 bits (135), Expect = 1.103e-7
Identity = 78/336 (23.21%), Postives = 127/336 (37.80%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN------FPNSEAIQSL-PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQ 1202
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +      L       F      F  + ++ +   Q   Y +  + T P F   + WC K +   R      + +L + P         +   + ++ P  R         + +   +E  +S +R +   +R+  + E L     R         P+ E  ++L P  T  LT+ +L         R LL      +    + +  V + LF+D L++TK  +K    K KV R  + L  L C      NSF L     FQ
Sbjct:  134 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEE-TRASGQPLDPIGL----QSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQM----LCDLLIKPHQRITKYPLLLHAVLKRSPEAR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVAS--EHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKAD--KAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQ 449          
BLAST of SMED30021849 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 54.299 bits (129), Expect = 4.486e-7
Identity = 78/340 (22.94%), Postives = 128/340 (37.65%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN------FPNSEAIQSL-PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFS-NDKENSF--NLFDDKSFQN 1205
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +      L       F      F  + ++ +   Q   Y +  + T P F   + WC K +   R      + +L + P         +   + ++ P  R         + +   +E  +S +R +   +R+  + E L     R         P+ E  ++L P  T  LT+ +L         R LL      +    + +  V + LF+D L++TK  +K    K KV R  + L  L C    D   SF   +F   S Q 
Sbjct:  166 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEE-TRASGQPLDPIGL----QSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQM----LCDLLIKPHQRITKYPLLLHAVLKRSPEAR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVAS--EHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKAD--KAKVIRPPLMLEKLVCQPLRDPSTSFLQGVFSSPSSQR 485          
BLAST of SMED30021849 vs. Ensembl Zebrafish
Match: plekhg5b (pleckstrin homology domain containing, family G (with RhoGef domain) member 5b [Source:ZFIN;Acc:ZDB-GENE-090908-6])

HSP 1 Score: 57.3806 bits (137), Expect = 4.326e-8
Identity = 76/352 (21.59%), Postives = 139/352 (39.49%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKIHM-TVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEET--LKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWC--NKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-----VEDMLRKLRKIEILMIGCDRSNFPNSEAIQSLPIET---------FQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFRSISLHTLCCFSNDKENSFNLFDDKSFQNYRESFT 1223
            I+EL+ TE   I + + +  + +  +L+L       E +   LF N  D+ R     W++ +FP  E       K + + +LIE T   + F+     FQ + ++ +       Y +++      FK  I W   NKQ        ++ + ++ + P            Q   K+P+  KT+  +      +D L    + +      V+  +R+ ++ + L     R    + EA++    E            LT  ++     P E R L       +      R      LFTD L+ITK VK++  +K+ V + + LH + C       SF L     F++   ++T
Sbjct:  424 IWELIQTEATYIKKLRVITDLFLCGLLNLQDNSLLGEVEPTRLFSNIQDIVRLHCTLWVQVMFPALE-------KARGSRSLIEPTDLQEGFSTFASRFQPYIRYCMEEESCMEYMRSLLRDNELFKIYITWAETNKQ------CNRLKLADMLVKP-----------HQRLTKYPLLLKTILKKTEDQASRDALNNMVACVEGFINGVDSQMRQRQEQQKLAATSAR--VESYEAVEGASEEVEKALKEFSRIDLTAPMIGT--SPEETRQLHLEGALRMKEGKDSRMDAYCFLFTDLLLITKPVKRLEKVKV-VRQPLLLHNVVCRELKDPGSFVLIYLNEFKSAVAAYT 746          
BLAST of SMED30021849 vs. Ensembl Mouse
Match: Plekhg6 (pleckstrin homology domain containing, family G (with RhoGef domain) member 6 [Source:MGI Symbol;Acc:MGI:2682298])

HSP 1 Score: 74.7146 bits (182), Expect = 1.358e-13
Identity = 84/345 (24.35%), Postives = 141/345 (40.87%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLA-KPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTI 1226
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN  +L R   +FW E L PI E  T  S +     +L       F      FQ + ++ +   Q   Y +  + T P F   + WC K +   R     T+ +L + P         + + ++++ P PR         + +   +E  +S +R +   +R+  + E LM    R        P+SE ++    P  T  L   +L   PE+    R LL      +    + +  V + LF+D L++TK  +K    + KV R  + L  L C      NSF L     FQ    + T+
Sbjct:  166 LWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHRRFWEEVLQPILED-TRTSGQPLDPVSL----QNGFLTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQ----TLGDLLIKPHQRITKYPLLLQAVRKRSPEPR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLMTPVLGVAPEY---TRQLLLEGPVRVKEGREGKMDVYLFLFSDVLLVTKPQRKAD--RAKVIRPPLMLEKLVCRPLRDPNSFLLIHLTEFQCVSSALTV 489          
BLAST of SMED30021849 vs. UniProt/SwissProt
Match: sp|Q8R0J1|PKHG6_MOUSE (Pleckstrin homology domain-containing family G member 6 OS=Mus musculus OX=10090 GN=Plekhg6 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 9.499e-13
Identity = 84/345 (24.35%), Postives = 141/345 (40.87%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLA-KPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTI 1226
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN  +L R   +FW E L PI E  T  S +     +L       F      FQ + ++ +   Q   Y +  + T P F   + WC K +   R     T+ +L + P         + + ++++ P PR         + +   +E  +S +R +   +R+  + E LM    R        P+SE ++    P  T  L   +L   PE+    R LL      +    + +  V + LF+D L++TK  +K    + KV R  + L  L C      NSF L     FQ    + T+
Sbjct:  166 LWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHRRFWEEVLQPILED-TRTSGQPLDPVSL----QNGFLTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQ----TLGDLLIKPHQRITKYPLLLQAVRKRSPEPR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLMTPVLGVAPEY---TRQLLLEGPVRVKEGREGKMDVYLFLFSDVLLVTKPQRKAD--RAKVIRPPLMLEKLVCRPLRDPNSFLLIHLTEFQCVSSALTV 489          
BLAST of SMED30021849 vs. UniProt/SwissProt
Match: sp|Q3KR16|PKHG6_HUMAN (Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 4.853e-7
Identity = 78/336 (23.21%), Postives = 127/336 (37.80%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN------FPNSEAIQSL-PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQ 1202
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +      L       F      F  + ++ +   Q   Y +  + T P F   + WC K +   R      + +L + P         +   + ++ P  R         + +   +E  +S +R +   +R+  + E L     R         P+ E  ++L P  T  LT+ +L         R LL      +    + +  V + LF+D L++TK  +K    K KV R  + L  L C      NSF L     FQ
Sbjct:  166 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEE-TRASGQPLDPIGL----QSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQM----LCDLLIKPHQRITKYPLLLHAVLKRSPEAR-------AQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVAS--EHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKAD--KAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQ 481          
BLAST of SMED30021849 vs. TrEMBL
Match: A0A3L7HAW2 (PLEKHG6 OS=Cricetulus griseus OX=10029 GN=CgPICR_018439 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.609e-9
Identity = 98/434 (22.58%), Postives = 168/434 (38.71%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-----HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTIVFSKKFNHFELFLKNVEIAKRNALKLLQTNVMRNESKLKRTDSICTVYKYHSTSSN-----PRLSLDSWLDDCVDASPYLNDLIFD 1469
            ++EL++TEL     Y   +KI        +L+L       E     LFGN   L R    FW E L P+ E  T  S +     +L       F K    FQ + ++ +   Q   Y +  + T P F   + WC K +   R     T+ +L + P         + + + ++ P PR         + +   +   +S +R +   +R+  + E L+    R        P++E ++    P  T  LT  +L     P   R LL      +    + +  V + LF+D L+ITK  ++    + KV R  + L  L C      NSF L     FQ    + T+      +      K V+     A   LQ   ++ E  +++   + T+Y+     ++     PRL +    +D  + +P + D   D
Sbjct:  166 LWELLSTELI----YSRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPSLIRAHRSFWEEVLQPVLEE-TRASGQPMDPVSL----QNGFLKFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQ----TLGDLLIKPHQRITKYPLLLQAVLKRSPEPR-------AQEALNAMIAAVESFLRHINGQVRQGEEQESLVAAAQRIGPYEVLEPSNEEVEKNLRPFSTLDLTTPILGV--APEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLITKPQRRAD--RAKVIRPPLMLEKLVCQPLRDSNSFLLIHLTEFQCVSSALTVHCPSSADRARWLEKTVQ-----AQATLQK--LKAEEYVQQKRELLTLYRNQGRETSEYSVIPRLVV---TEDTDEDAPSMPDDTSD 565          
BLAST of SMED30021849 vs. TrEMBL
Match: D4ABR1 (Pleckstrin homology and RhoGEF domain-containing G6 OS=Rattus norvegicus OX=10116 GN=Plekhg6 PE=4 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 2.908e-8
Identity = 88/378 (23.28%), Postives = 148/378 (39.15%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIRVEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS-----------LPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTIVFSKKFNHFELFLKNVEIAKRNALKL 1304
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R   +FW E L PI E  T  S +     +L       F      FQ + ++ +   Q   Y +  + T P F+  + WC K +   R     T+ +L + P         + + + ++ P PR     +L  D+M   +E    +  +  ++R+  + E LM    R        P+SE ++             PIE              P   R LL      +    + +  V + LF+D L++TK  +K+   K KV R  + L  L C      +SF L     FQ    + T+  S      + +L+  + A+    KL
Sbjct:  163 LWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPKLIRTHRRFWEEVLQPILED-TRTSGQPLDPVSL----QNGFLTFGQRFQPYIQYCLRVKQTMAYAREQQDTNPLFRTFVQWCEKHKRSGRQ----TLGDLLIKPHQRITKYPLLLQAVLKRSPEPR----AQLALDNMIVAVE--SFLQHINGLVRRGEEQESLMAVAQRIGPYEVLEPSSEEVEKHLRQFSTLDLMTPIEGV-----------APENTRQLLLEGPVRMKEGREGKMDVYLFLFSDVLLVTKPQRKVD--KAKVIRPPLMLEKLVCRPLRDPHSFLLIHLTEFQCVSSALTVHCSSSTERTQ-WLQKTQQAQATLQKL 511          
BLAST of SMED30021849 vs. TrEMBL
Match: G3GUL5 (Pleckstrin-likey domain-containing family G member 6 OS=Cricetulus griseus OX=10029 GN=I79_001378 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.654e-8
Identity = 73/308 (23.70%), Postives = 119/308 (38.64%), Query Frame = 3
Query:  330 EFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTI 1226
            E     LFGN   L R    FW E L P+ E  T  S +     +L       F K    FQ + ++ +   Q   Y +  + T P F   + WC K +   R     T+ +L + P         + + + ++ P PR         + +   +   +S +R +   +R+  + E L+    R        P++E ++    P  T  LT  +L     P   R LL      +    + +  V + LF+D L+ITK  ++    + KV R  + L  L C      NSF L     FQ    + T+
Sbjct:  207 EVSAETLFGNVPSLIRAHRSFWEEVLQPVLEE-TRASGQPMDPVSL----QNGFLKFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQ----TLGDLLIKPHQRITKYPLLLQAVLKRSPEPR-------AQEALNAMIAAVESFLRHINGQVRQGEEQESLVAAAQRIGPYEVLEPSNEEVEKNLRPFSTLDLTTPILGV--APEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLITKPQRRAD--RAKVIRPPLMLEKLVCQPLRDSNSFLLIHLTEFQCVSSALTV 494          
BLAST of SMED30021849 vs. TrEMBL
Match: A0A2U4AKS6 (pleckstrin homology domain-containing family G member 6 isoform X2 OS=Tursiops truncatus OX=9739 GN=LOC101318244 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.053e-8
Identity = 78/344 (22.67%), Postives = 133/344 (38.66%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKI-HMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTI 1226
            ++EL+TTEL  + + + +  +    +L+L       E     LFGN   L R    FW E L P  E  T  S +     +L       F      FQ +  + +   Q   Y    +   P F+  + WC K     +   + T+ +L + P         + + + ++ P  R         + +   +   +S +R +   +R+  + E L     R        P+SE ++    P  T  LT  +L  P  P   R LL      +    + +  V + LF+D L++TK +++    K KV R  + L  L C S    +SF L      Q    + T+
Sbjct:   12 LWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPSLIRTHQSFWEEVLGPTLEE-TRASGQPLDPVSL----QNGFLSFSQRFQPYVLYCLRVKQTMAYAWKQQDNNPLFRTFLQWCEKH----KRSGRQTLGDLLIKPHQRITKYPLLLQAVLKRSPEAR-------AREALTAMIAAVESFLRHINKQVRQREEQESLAAAAQRIGPYEVLEPSSEEVEKNLRPFSTLDLTAPMLGVP--PEHTRQLLLEGPVRMKEGREGKLDVYLFLFSDVLLVTKPLRRTD--KAKVIRPPLMLEKLVCRSLRDPSSFLLIHLTELQCVSSALTV 335          
BLAST of SMED30021849 vs. TrEMBL
Match: A0A5N4C6R5 (Pleckstrin homology domain-containing family G member 6 OS=Camelus dromedarius OX=9838 GN=Cadr_000029382 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.646e-7
Identity = 83/371 (22.37%), Postives = 144/371 (38.81%), Query Frame = 3
Query:  225 IFELVTTELNNIIRYQAVIKIHMT-VLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLK-AFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIR-VEDMLRKLRKIEILMIGCDRSN-----FPNSEAIQS--LPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVFR-SISLHTLCCFSNDKENSFNLFDDKSFQNYRESFTIVFSKKFNHFELFLKNVEIAKRNALKL 1304
            ++EL+TTEL  + + + +  +  + +L+L       E     LFGN   L R    FW E L P  E + +      S   L   +L+  F      FQ +  + +   Q   Y +  +   P F   + WC K +   R      + +L + P         + + + ++ P  R         + +   +   +S +R +   +R+  + E L+   +R        P+SE ++   LP  T  LT+ +L     P   R LL      +    + +  V + LF+D L++TK  ++    K KV R  + L  L C      +SF L     FQ    + T+      +      K  +  KR  L L
Sbjct:  114 LWELLTTELIYVRKLKIMTDLLASGLLNLQRVGLLTEVSAETLFGNVPSLIRAHRSFWEEVLGPSLEEMRA------SGQPLDPVSLQNGFLMFSQRFQPYVLYCLRVKQTMAYAREQQDNNPLFHTFVQWCEKHKRSGRQM----LGDLLIKPHQRITKYPLLLQAVLKRSPEAR-------AQEALNAMIAAVESFLRHINKQVRQGEEQESLVAAAERIGPYEVLEPSSEEVEKNLLPFSTLDLTSPVLGV--APEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKRQRRAD--KAKVIRPPLMLEKLVCQPLRDPSSFLLIHLTEFQCVSSALTVHCPSPADRARWLEKTQQAQKRELLAL 463          
BLAST of SMED30021849 vs. Planmine SMEST
Match: SMESG000049531.1 (SMESG000049531.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.934e-17
Identity = 90/403 (22.33%), Postives = 173/403 (42.93%), Query Frame = 3
Query:  222 LIFELVTTELNNIIRYQAVIKIHMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDTLERAKSIIRVEDMLRKLRKIEILMIGCDRSNFPN-SEAIQSL----PIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKKMTPIKLKVF-RSISLHTLCCFSN----DKENSFNLFDDKSFQNYRESFTIVFSKKF---NHFELFLKNVEIAKRN----ALKLLQTNVMRN-----ESKLKRTDSICT 1364
            +I+EL+T+E+  + +   ++K  + +L    + +FP+ D+  +FGN ++++R++  FW E +  +F+ L     K+      I   +  F      F  +  + ++   Y  Y    E+    F+  + WC   +   RL     ++     P           +++ ++     +         ++   +      I+V++M  KLR  + ++ G     FP   E I+++    P   F +T  +  K E+ NE+R L+   T  L    +K   VK+LLFTD L+  K +KK    +L++    I+L  L  + +    + + S  L +   FQ +   + +   K     N  + FLK +  AK +     L+  QTNV  N      + L + +  CT
Sbjct:  140 VIWELITSEIVYLKQIHFIVKTPLPILIDIKQTFFPKLDVFSIFGNILEVFRSNVIFWTEYMEDVFQIL-----KNCDNVPDIRHMISGFNNFSKQFVPYKSYCMNISAYCEYITKFELESDCFRLFLEWCRNSDSSNRL----GLDTFITMPFQRLTRYSLFLDRIMKECSDDDEIYELSQAISEVDKFVNNINKSIKVKEMTSKLRYFQSILCG-----FPTIEEYIKAIFPIPPYPVFNMTCPMQVKSEYENEVRCLIHQDTLRLKQIHRKTISVKVLLFTDLLIFAKPIKKNQQCRLQLLDHPIALDQLVIYDSHAMIENDQSIFLAEINQFQCFSTIYKLSNDKSSSFKNPVKYFLKKLSFAKMHYETIMLQTNQTNVHINVVNSDRNSLNKEEENCT 528          
BLAST of SMED30021849 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.673e-6
Identity = 68/323 (21.05%), Postives = 130/323 (40.25%), Query Frame = 3
Query:  165 PCNNISKYFNYELKKPTYPLIFELVTTELNNIIRYQAVIKIHMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWC------NKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDT-LERAKSIIRVEDMLRKLRKIEILMIGCDRSNFPNSEAIQSLPIETFQLTNH-----LLAKPEFPNE--IRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKK 1091
            P NN+ + +  +        I+EL+ TE N + +   +++I++   ++   +YFP+     +F N  D+   S +FW  C+ P+ E     +++      L+++    F KI    + +  +     +  +   ++E +   F E I W       N++ +   L K          P L       + + +Q+   I  K     +   D  DT + +    I   ++++KL+ +   +   D         I+ L  +   + N      L A  ++  E  IR +L   +  L     K   VK+ L TD L+ITK  KK
Sbjct:   85 PENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIE--NYETTRQMFKPRLLKD---GFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAK----------PFLRLTKYKILLQAIQKYSGIDEKKEIQEMI--DAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYD--------VIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKK 382          
BLAST of SMED30021849 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.799e-6
Identity = 68/323 (21.05%), Postives = 130/323 (40.25%), Query Frame = 3
Query:  165 PCNNISKYFNYELKKPTYPLIFELVTTELNNIIRYQAVIKIHMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWC------NKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDT-LERAKSIIRVEDMLRKLRKIEILMIGCDRSNFPNSEAIQSLPIETFQLTNH-----LLAKPEFPNE--IRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKK 1091
            P NN+ + +  +        I+EL+ TE N + +   +++I++   ++   +YFP+     +F N  D+   S +FW  C+ P+ E     +++      L+++    F KI    + +  +     +  +   ++E +   F E I W       N++ +   L K          P L       + + +Q+   I  K     +   D  DT + +    I   ++++KL+ +   +   D         I+ L  +   + N      L A  ++  E  IR +L   +  L     K   VK+ L TD L+ITK  KK
Sbjct:   66 PENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIE--NYETTRQMFKPRLLKD---GFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAK----------PFLRLTKYKILLQAIQKYSGIDEKKEIQEMI--DAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYD--------VIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKK 363          
BLAST of SMED30021849 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 50.8322 bits (120), Expect = 2.038e-6
Identity = 68/323 (21.05%), Postives = 130/323 (40.25%), Query Frame = 3
Query:  165 PCNNISKYFNYELKKPTYPLIFELVTTELNNIIRYQAVIKIHMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWC------NKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDT-LERAKSIIRVEDMLRKLRKIEILMIGCDRSNFPNSEAIQSLPIETFQLTNH-----LLAKPEFPNE--IRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKK 1091
            P NN+ + +  +        I+EL+ TE N + +   +++I++   ++   +YFP+     +F N  D+   S +FW  C+ P+ E     +++      L+++    F KI    + +  +     +  +   ++E +   F E I W       N++ +   L K          P L       + + +Q+   I  K     +   D  DT + +    I   ++++KL+ +   +   D         I+ L  +   + N      L A  ++  E  IR +L   +  L     K   VK+ L TD L+ITK  KK
Sbjct:  100 PENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIE--NYETTRQMFKPRLLKD---GFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAK----------PFLRLTKYKILLQAIQKYSGIDEKKEIQEMI--DAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYD--------VIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKK 397          
BLAST of SMED30021849 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 50.8322 bits (120), Expect = 2.114e-6
Identity = 68/323 (21.05%), Postives = 130/323 (40.25%), Query Frame = 3
Query:  165 PCNNISKYFNYELKKPTYPLIFELVTTELNNIIRYQAVIKIHMTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNSSKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPAFKEVILWC------NKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPIPRKTLTYRLCYDDMKDT-LERAKSIIRVEDMLRKLRKIEILMIGCDRSNFPNSEAIQSLPIETFQLTNH-----LLAKPEFPNE--IRALLCHATAHLFTPDKKRFLVKILLFTDFLMITKIVKK 1091
            P NN+ + +  +        I+EL+ TE N + +   +++I++   ++   +YFP+     +F N  D+   S +FW  C+ P+ E     +++      L+++    F KI    + +  +     +  +   ++E +   F E I W       N++ +   L K          P L       + + +Q+   I  K     +   D  DT + +    I   ++++KL+ +   +   D         I+ L  +   + N      L A  ++  E  IR +L   +  L     K   VK+ L TD L+ITK  KK
Sbjct:  114 PENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIE--NYETTRQMFKPRLLKD---GFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAK----------PFLRLTKYKILLQAIQKYSGIDEKKEIQEMI--DAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYD--------VIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKK 411          
The following BLAST results are available for this feature:
BLAST of SMED30021849 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PLEKHG61.010e-723.21pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG61.010e-723.21pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG61.103e-723.21pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG64.486e-722.94pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of SMED30021849 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
plekhg5b4.326e-821.59pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of SMED30021849 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Plekhg61.358e-1324.35pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of SMED30021849 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8R0J1|PKHG6_MOUSE9.499e-1324.35Pleckstrin homology domain-containing family G mem... [more]
sp|Q3KR16|PKHG6_HUMAN4.853e-723.21Pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of SMED30021849 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L7HAW21.609e-922.58PLEKHG6 OS=Cricetulus griseus OX=10029 GN=CgPICR_0... [more]
D4ABR12.908e-823.28Pleckstrin homology and RhoGEF domain-containing G... [more]
G3GUL53.654e-823.70Pleckstrin-likey domain-containing family G member... [more]
A0A2U4AKS69.053e-822.67pleckstrin homology domain-containing family G mem... [more]
A0A5N4C6R52.646e-722.37Pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of SMED30021849 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021849 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049531.12.934e-1722.33SMESG000049531.1[more]
SMESG000023540.11.673e-621.05SMESG000023540.1[more]
SMESG000023540.11.799e-621.05SMESG000023540.1[more]
SMESG000023540.12.038e-621.05SMESG000023540.1[more]
SMESG000023540.12.114e-621.05SMESG000023540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021849 ID=SMED30021849|Name=SMED30021849|organism=Schmidtea mediterranea sexual|type=transcript|length=1661bp
CTAGAAAACAAATTAAAGAATTAAAGCTAAGCTCAAAAGTAAATAAATTA
ATAATTTTATTTTAATTATGGTATCATTAGGATGATAAAGATTTAAAAAT
TCTAGAAGATTTAAACAATTTAGATTTGGAAAGTCTTCCGTGCCGCTTTA
TCGGAACCGAAGATCCGTGCAATAACATCTCCAAATATTTTAACTATGAG
CTCAAAAAGCCTACATATCCGCTGATCTTTGAGTTGGTCACGACGGAATT
GAATAACATCATACGATACCAAGCGGTCATTAAAATTCACATGACCGTTT
TAGATTTATTCTCAAAAGAATACTTCCCAGAATTTGACATGAGGTGCTTG
TTTGGGAATTGGGTGGATTTGTACCGAAACTCTTCTCAATTCTGGCTTGA
ATGCCTGTTTCCGATCTTTGAGTATTTGACATCGAATTCCTCGAAAGACA
AATCAACGGCAACGCTTATAGAGGAAACCTTGAAAGCATTTACGAAGATC
GACGGATATTTCCAATCTCATTTTAAATTCCACATTCACAGTCCTCAGTA
TTTCAATTACTATAAAGCAATGGAGGTGACATATCCGGCATTTAAAGAGG
TGATTTTGTGGTGCAATAAACAAGAGATATTCATAAGACTATTCAAAAAG
ATTACTATAGAAAACCTGTTTATGTTTCCTAGGTTGAATTTCGGAACGGT
GGGAACGATTTTCGAACAACTGCAAAGAAAGTTTCCGATTCCAAGAAAAA
CGTTGACCTATAGACTTTGTTACGATGATATGAAAGACACGCTTGAACGG
GCAAAGTCAATTATAAGAGTTGAAGATATGTTAAGAAAGCTGAGGAAAAT
TGAAATCTTGATGATTGGATGTGACAGATCAAATTTTCCTAATTCTGAAG
CCATCCAGAGTCTTCCGATTGAAACTTTTCAGTTAACCAACCATTTATTG
GCGAAACCAGAATTCCCGAATGAAATAAGGGCCTTGCTATGCCATGCGAC
TGCTCATTTATTCACTCCTGACAAAAAGAGATTTCTTGTCAAAATTCTTC
TGTTCACCGATTTTCTGATGATCACAAAAATAGTAAAGAAAATGACCCCA
ATTAAACTTAAAGTTTTTCGTTCAATATCCCTTCACACGTTATGTTGCTT
TAGCAATGATAAAGAAAATTCCTTTAATCTATTTGATGACAAATCATTCC
AAAATTACAGAGAAAGTTTCACTATCGTTTTCAGCAAGAAATTTAACCAT
TTTGAACTGTTTTTGAAAAACGTCGAAATAGCTAAAAGAAACGCATTGAA
GCTTCTTCAAACTAATGTGATGAGAAACGAATCAAAATTGAAGAGAACGG
ATTCCATTTGTACAGTTTATAAGTATCACAGTACTTCGTCAAATCCCCGG
CTTTCCCTGGACTCGTGGTTGGATGATTGTGTCGATGCCAGTCCATACTT
GAATGATTTAATTTTTGATAGAATATTTCCTTTAAACTCGGCATTGAACC
TGAAGGCTGTCTTCACAATTCATCCGAAACCTTTATCGGAGGACAAATAT
AATTCGATTGATAATAATAATAATTAACAAAAATAATCGAACATTCAAAT
TGAAATAATAAGACAAACCATTTTTATTTCTAAATAAATTAATAATTTCA
ATTAAAAAAAA
back to top

protein sequence of SMED30021849-orf-1

>SMED30021849-orf-1 ID=SMED30021849-orf-1|Name=SMED30021849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MTVLDLFSKEYFPEFDMRCLFGNWVDLYRNSSQFWLECLFPIFEYLTSNS
SKDKSTATLIEETLKAFTKIDGYFQSHFKFHIHSPQYFNYYKAMEVTYPA
FKEVILWCNKQEIFIRLFKKITIENLFMFPRLNFGTVGTIFEQLQRKFPI
PRKTLTYRLCYDDMKDTLERAKSIIRVEDMLRKLRKIEILMIGCDRSNFP
NSEAIQSLPIETFQLTNHLLAKPEFPNEIRALLCHATAHLFTPDKKRFLV
KILLFTDFLMITKIVKKMTPIKLKVFRSISLHTLCCFSNDKENSFNLFDD
KSFQNYRESFTIVFSKKFNHFELFLKNVEIAKRNALKLLQTNVMRNESKL
KRTDSICTVYKYHSTSSNPRLSLDSWLDDCVDASPYLNDLIFDRIFPLNS
ALNLKAVFTIHPKPLSEDKYNSIDNNNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity