Mediator of RNA polymerase II transcription subunit 12-like protein

Overview
NameMediator of RNA polymerase II transcription subunit 12-like protein
Smed IDSMED30021839
Length (bp)6029
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mediator of RNA polymerase II transcription subunit 12-like protein (SMED30021839) t-SNE clustered cells

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 12-like protein (SMED30021839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mediator of RNA polymerase II transcription subunit 12-like protein (SMED30021839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 12-like protein (SMED30021839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30021839SMESG000000954.1 SmedASXL_016893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30021839SMESG000067021.1 SMESG000000954.1 dd_Smed_v4_4053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021839SMESG000067021.1 SMESG000000954.1 dd_Smed_v4_4053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021839SMESG000026022.1 SMESG000000954.1 dd_Smed_v4_4740_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Match: MED12L (mediator complex subunit 12L [Source:HGNC Symbol;Acc:HGNC:16050])

HSP 1 Score: 504.212 bits (1297), Expect = 9.223e-146
Identity = 487/1780 (27.36%), Postives = 830/1780 (46.63%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC-SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH----PDRS----------------ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLN---RDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARG-LFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRSE--------CSGLNQILPSIPIVDYRNFN--RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFDL--TENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIH-TLFSIPNHGI---------KFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P + ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H    P+ S                +   ++++ SC+ H  +++ LS ++ +++L CP A+V+N       + N      L     +    PG     N   R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG L  + +  P  P+G     A    S  H    E+     G++ ++  +         C  L +      ++   N++  RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+      +  E   +K+R++ +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V  S      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q      +T       +   D +LL+++   +    +  +LK + +  D                  +G   D +  D+     N  S G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +      + S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+ TL S  ++            +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  +L++ H HP  + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLS-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLAKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPMDDDLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMMIGPNNSSIGAPSPGPPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKSANPGSPLDLLQVAPSSLPMPGGNTAFNQQVRARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSSSLAGSSLPVFQNVLLRFLDTQAPSLSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTRPRSPVG---ENADEHYSKDHDVKMEIFSPMPGESCENANTSLGRRMSVNCEKLVKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTETGVGDEG--QKARKNKQETFPTL----ETVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILSDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFLPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGNNSVSSLKNDDFTMRGLRCDGNADDIWTASQNPKSCG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPGSGSVAEMNNLLDNIAKATIEVFQQSADLN-NSSNSGMSLFNPNSIGSADTSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDIKARQMMHEALQLRLNLVGGMFDTVQRSTQWTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSNASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRRVIKYEEQHHLLLYHTHP--MPKPRSYY 1724          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Match: MED12 (mediator complex subunit 12 [Source:HGNC Symbol;Acc:HGNC:11957])

HSP 1 Score: 472.241 bits (1214), Expect = 3.300e-135
Identity = 481/1797 (26.77%), Postives = 801/1797 (44.57%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNKHPDRSITD-----------------------FYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKS-------PELDRMSTGDNPDSVRSE---------------CSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLR-----VLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK  V    KD   +    +S+  I  W   L+ T P  +L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK   +VD   +W     + L E+L  +  +  R               + H+ E+ + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L         +                          +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP   F   A +        S       P L      D   SV  E               C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L++     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L      VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   ++N ++ + + DD + K L+H ++K RL LVG +FD +Q S +   +W +LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  + KKL+KE+ ++   + +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EG+K    LS  WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVSFN------PAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQ--KDNFWL-VTARSQSAINTWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKK--RHVDPFMEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-SPFDDPADDPEHKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEGTLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVTGGTEELPEEEGGGGSGGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVHQIVNNWRDDQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAMLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKLQKELGER-QSDSLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1738          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Match: MED12 (mediator complex subunit 12 [Source:HGNC Symbol;Acc:HGNC:11957])

HSP 1 Score: 472.241 bits (1214), Expect = 3.762e-135
Identity = 481/1797 (26.77%), Postives = 801/1797 (44.57%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNKHPDRSITD-----------------------FYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKS-------PELDRMSTGDNPDSVRSE---------------CSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLR-----VLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK  V    KD   +    +S+  I  W   L+ T P  +L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK   +VD   +W     + L E+L  +  +  R               + H+ E+ + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L         +                          +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP   F   A +        S       P L      D   SV  E               C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L++     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L      VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   ++N ++ + + DD + K L+H ++K RL LVG +FD +Q S +   +W +LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  + KKL+KE+ ++   + +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EG+K    LS  WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVSFN------PAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQ--KDNFWL-VTARSQSAINTWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKK--RHVDPFMEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-SPFDDPADDPEHKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEGTLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVTGGTEELPEEEGGGGSGGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVHQIVNNWRDDQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAMLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKLQKELGER-QSDSLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1738          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Match: MED12 (mediator complex subunit 12 [Source:HGNC Symbol;Acc:HGNC:11957])

HSP 1 Score: 392.504 bits (1007), Expect = 8.039e-110
Identity = 426/1650 (25.82%), Postives = 721/1650 (43.70%), Query Frame = 2
Query:  545 RAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNKHPDRSITD-----------------------FYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKS-------PELDRMSTGDNPDSVRSE---------------CSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLR-----VLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGI----------KFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            RA W IK++  +    +E+  KK   +VD   +W     + L E+L  +  +  R               + H+ E+ + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L         +                          +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP   F   A +        S       P L      D   SV  E               C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L++     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L      VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   ++N ++ + + DD + K L+H ++K RL LVG +FD +Q S +   +W +LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  + KKL+KE+ ++   + +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EG+K    LS  WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:    2 RAAWLIKMTCAYYAAISETKVKK--RHVDPFMEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-SPFDDPADDPEHKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEGTLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVTGGTEELPEEEGGGGSGGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVHQIVNNWRDDQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAMLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKLQKELGER-QSDSLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1585          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Match: MED12L (mediator complex subunit 12L [Source:HGNC Symbol;Acc:HGNC:16050])

HSP 1 Score: 386.726 bits (992), Expect = 2.392e-108
Identity = 371/1368 (27.12%), Postives = 634/1368 (46.35%), Query Frame = 2
Query: 1226 RDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARG-LFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRSE--------CSGLNQILPSIPIVDYRNFN--RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVC--PPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFDL--TENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIH-TLFSIPNHGI---------KFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG L  + +  P  P+G     A    S  H    E+     G++ ++  +         C  L +      ++   N++  RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+      +  E   +K+R++ +E    +E    ++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V  S      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N   G       FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +  C      P  R+   +L  LF   Q      +T       +   D +LL+++   +    +  +LK + +  D                  +G   D +  D+     N  S G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +      + S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+ TL S  ++            +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  +L++ H HP  + +P +YY
Sbjct:  281 RARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSSSLAGSSLPVFQNVLLRFLDTQAPSLSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTRPRSPVG---ENADEHYSKDHDVKMEIFSPMPGESCENANTSLGRRMSVNCEKLVKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTETGVGDEG--QKARKNKQETFPTLE----TVFTKLQLLSYFDQHQVTSQISNNVLEQIT-------SFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILSDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSNHVWG-------FNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLL------AAACGDADAEPGARMTCRLLLHLFRAPQACFLPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGNNSVSSLKNDDFTMRGLRCDGNADDIWTASQNPKSCG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPGSGSVAEMNNLLDNIAKATIEVFQQSADLN-NSSNSGMSLFNPNSIGSADTSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDIKARQMMHEALQLRLNLVGGMFDTVQRSTQWTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSNASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRRVIKYEEQHHLLLYHTHP--MPKPRSYY 1584          

HSP 2 Score: 114.39 bits (285), Expect = 1.630e-24
Identity = 82/255 (32.16%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQ 844
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P + ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLS-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLAKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEK 261          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Celegans
Match: dpy-22 (Mediator of RNA polymerase II transcription subunit 12 [Source:UniProtKB/Swiss-Prot;Acc:Q20497])

HSP 1 Score: 53.1434 bits (126), Expect = 2.667e-6
Identity = 67/312 (21.47%), Postives = 127/312 (40.71%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPY---------AELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSL---------SDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC-----SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLL 976
            +G  DVY+Q   Q+ED+LT   +++G  Y  P+ +         +E  S  F    N  ++    +  + ++      +K      +   + IP  +      ++W   LSD + +          + +++RIP F +KE +  E   Y +   RAIW +K+  +     +   +KK   +V +L         + W+++ +            K  RN I    E T + + YL   M  M+D+ +LD  E L  L     Q        +  ++  ++ + +YF +    S +L R+    LC ++  L 
Sbjct:    9 MGTADVYKQNKNQEEDMLTTERLKKG--YQMPLTQ---------YELQSLVFNASENKLIRLEKAQKRSQSMIASVIHKKGEFHMNYDRERKIPKEQLPCFAPHNWKRILSDRVKFFSALARGTPLQQLSQRIPGFRRKELLFLEFSDYNISYDRAIWCVKLLCILGFNSSSKTQKKTLLDVATLELSQACNKTTIWLVTQL-----------YKSFRNPIKRR-EATKT-WNYLTGFMKYMFDDGVLDKQEFLNDLTEVFNQLFLQKNFKNPSVLSTFMKYYVYFVEDLSSSLVLARRSSTLLCQALGFLF 296          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Fly
Match: kto (gene:FBgn0001324 transcript:FBtr0074884)

HSP 1 Score: 140.198 bits (352), Expect = 1.279e-32
Identity = 136/517 (26.31%), Postives = 239/517 (46.23%), Query Frame = 2
Query: 3545 HMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQI--PEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHF-------CTHKNYQD---KENDLTKSS-------------LILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMP--DDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEE-HANLMIGHDHPDKLIRPDNYYTSFPEILPEDIK 5002
             + +  F   VL++IC    V  R  +         +++ID+ ++  QA+ +L++IC+P+        +  D    + R   NL  W+L    + +QL+  Q      E    ++ V++  I++F        +  E+V               +H+ KP       S +L+  LI KL     + +++  A + LES  +F       C      D   K N    S+             + L Y PF+ L++ CL  +D+ +   L SL  Q+   + +  E + +   D+ + +  I  +++ R +LVG +F+ IQ++     DW +LL++L+  GVV++ S + ELF TV+DM++TL+H+   + +    +  ++KKL+KEI +K N   + +I+  LLP +K   +VI        H     +        K+   +  K+RI+ W+++EG KN   LS  WF AV  +   L  EE H NL     H   L++P +YY     + PEDI+
Sbjct: 1410 QISLLEFAQAVLKQICAQEHVLERCLKNAEQLC---DMIIDEMLTAKQAQRVLHMICYPEPEF--NIISELDQRSMIVRILENLGQWTLRISWLDLQLMYRQSLSNNAELNVWLDTVARAAIDVF--------HMEEVVLPGAVKA--------THKPKP-------STWLVAPLIAKL-TPAVQGRILRVAGQVLESMNYFSKVSKSDCNSSGSGDEREKSNSCHSSNSYGLGGVPARNKKMPLDYQPFLGLILTCLKGQDEYKENLLVSLYAQLSQCLQSFAELDTIGGIDEPQAREEILDALQLRFSLVGGMFEAIQKNSTPTTDWAILLAQLVCQGVVDL-SCNRELFTTVVDMLATLVHSTL-VSDDERHYMNLMKKLKKEIGEK-NNASIRVIRQ-LLPLYKQPTEVIAC-----EHSGMDTKGNKICDIDKKQLRISDKQRISVWDILEGHKNPAPLSWVWFGAVKLERKPLTYEEAHRNLKY---HTHSLVKPSSYYYEPLPLPPEDIE 1885          

HSP 2 Score: 112.464 bits (280), Expect = 4.080e-24
Identity = 118/513 (23.00%), Postives = 221/513 (43.08%), Query Frame = 2
Query: 1853 DNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEH----NLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMKKLENV--FRNI--KPDKDRSSSIDYVESVGMDLFKINMVSCS------ENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSI-VCPPIVPTTRLASYILFRLF-TMEQQNSTANSVS 3337
            + PDS +    G  +  P   I      +RH  Y  HFPIP +D  +  +    N R   L+   + RD  K  +++++K+IGK++TK+ +  D+      +K SR          E   E+  S+ + + Y+D   V +QC    +  LN  ++        +N +LP    ++ L +L+E + N   L+ + D    +L+K +  +  Q  +   +L+ SY +   + I+  L ++ S L+   +    +F G+    R+  + +      RC  A +    +SC  L+         ++L+ +  F++I   P++       Y   +  +LF                + E   NV   +S V N L+ V + TD ++L  +     E  ++ ++LS EWI A+ S L  G+ SP Y     + +       L  +  ++  +  ++AR CF  +DF+ +     LA+ +      +        RL  +++ +LF T+E       SVS
Sbjct:  802 EAPDSPKIGPPGDGETNPGGSI------SRHYVYTKHFPIPQDDPSMSSYSSESNQRYILLFGVGKERDEKKHAVKKMSKEIGKLFTKK-FSIDVAAAGHVKKHSRN---------EFNFEATTSKCQQMAYFDQHVVTAQCAANVLEQLNGFAL-------GNNNYLPVQEHVAFLFDLMELALNIYSLLELCD----SLLKELPEVEHQLQLKKSNLVRSYTTSLALYIVSILRRYHSCLLLSPEQTLSVFEGVCRTIRHVSNPSECTSAERCIIAYLSDLHESCVLLQGKEQSTEYYQQLQCIKRFKDIFNTPEQLDLPPQGYNPLLLQELFMAPRRGGKLDPHWLGTLHESPANV---YSFVSNALIAVCRETDNERLNDVALACAELTASCNVLSEEWIYALQS-LCSGSKSPRYPHLGGQVD----IGQLKTHNALAVFVCILVARHCFSLADFVSKFALPTLARSVSAGGAELSVDAEAGARLTCHLVLKLFKTLEIPQPGMYSVS 1279          

HSP 3 Score: 98.9821 bits (245), Expect = 4.743e-20
Identity = 103/409 (25.18%), Postives = 165/409 (40.34%), Query Frame = 2
Query:  749 FEYLMRLMVAMYDEDLLDHTEVLQWLV----STNEQCSDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNKHPDRSITDF-------------YAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNI---KIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLN-RDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAG---LIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLVDNHSL----------------------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN---------IHQNQSHQS-----------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARG--LFESV 1747
            ++Y  +L   MY+E LLD  E L W++        Q S DE + K  L F L +   F +SE L RK+ + +   +  LL N     ++I +                E  SC  HR ++  LS ++  +++ECP A+V++ I   + P   L      L                N   R  +   E  I+ R+   E +W       + +  +AG      V+  LD  D +C+        + T+   +  + ++                       + +LCEW+VS  R G HR  +VA ++D            Q  S +                   Q+ L+ FLD  +P++D  +S+  +   F NLV LF  LI  ++FS N YM  +I+RG  L ESV
Sbjct:  334 WKYCHQLSKYMYEESLLDRQEFLNWILDLLDKMRTQASFDEPLKKLVLSFALQYMHDFVQSERLCRKMAYIVSKKLAQLL-NTVVEQQTIKELDEPKLQQDPYELALQEQMSCPHHRDIVLYLSTILQIITIECPTALVWSGIAAHRAPSSLLGSPLDHLPLAPSVLPMPTRCPRTNHEIRRQLRAAESDIVLRTQHAEQRW------FAAKWLSAGKNQYTSVLATLDHLDTHCFDRMEHNNSIDTLYAQIFPSPTVSRRREEDQVEPRPPYEPKQDKDTVRILCEWAVSGQRWGEHRAMVVAILLDKRQIDVTSTPADQQSSDKDDKDSLASGAGLIDGLPVFQHVLMHFLDHDAPVLDEHVSSPQQRTEFTNLVQLFSALIRHDVFSHNAYMHTLISRGDLLLESV 735          

HSP 4 Score: 92.0485 bits (227), Expect = 5.869e-18
Identity = 63/194 (32.47%), Postives = 96/194 (49.48%), Query Frame = 2
Query:  101 KVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL 682
            +  LGPPD+Y Q+ KQ+ED LT  NV+ GF  + P+ +E  +A +      S    + ++ F   V+ K        DT ++K  +    KD    P   + K  +  W   L+   P   L  KR P F+KKE++   + + QV + RA WFIK+SA +     ES  KK RS  D  ++W  + I+ + E L
Sbjct:   13 RTRLGPPDIYPQDAKQREDELTPTNVKHGFTTTPPLSDEFGTAHN------SNVNASKVSAFFSGVLAKKEELMTLPDTGRKKQQINC--KD-NFWPVSPRRKCTVDAWFKDLAGNKPLLSLA-KRAPSFNKKEEIFITLCENQVNMQRATWFIKLSAAYTLSFTESKNKK-RSIYDPAAEWTGNMIKFMKELL 195          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Zebrafish
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:566632])

HSP 1 Score: 503.442 bits (1295), Expect = 1.272e-145
Identity = 514/1821 (28.23%), Postives = 834/1821 (45.80%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNK---------------------------------HPDRSITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXX-----------XHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPD--NYYTSFPEILPEDIKDPSISDPME 5029
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F           ++   ++I +    N   DT KRK  V    KD   +    +S+  I +W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I    NK K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +NLLL++                                    P    TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++             + SP  ++ +      S   +  G++   P+ P+V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + +L  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +M+    N  EL  +   R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE  ++         +       +S S  +    S E +  +L+  LI KLP  + +  ++ AA E+LE G+H     + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  +  D  V   EE   L++ H H    I+P   +YY + P  LP++ ++P    P E
Sbjct:   20 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFNSSKI------SSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINNWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TENKMKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPAPPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLRLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSIGPGPGGHQAHGISAQQGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTISRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVSCKRSGPHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFYELIRHDVFSHNIYMCTLISRGDLASNSHLPRPRSPSDEPSDESERKDQDAGSSVKIEDTGMSESMEIDHNSSANFDEMFSPPMHCESKGSPSPEKQAQEQESKSTAKD-KGMD---PAFPLV-YEQ-PRHIQYATHFPIPQEESASHECNQRLVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSNLAGSYTTGLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYYNIDPSDSNMLWDQMFMIDAITNPTAHNLNHSMLGKITN--ELNDSPANRYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDGTKSDKSIVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLVVYAKY------VLKSICHQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAEMNSSNPSWNGSAVSGSSVSNSNSASKLKPVLSSSERSGVWLVAPLIGKLP-TSVQGHVLKAAGEELEKGQHLGP-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTIRVDRKVTKFEEQQRLLLYHTH----IKPKQRSYYLA-PLNLPQEEEEPLTPVPPE 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Zebrafish
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:566632])

HSP 1 Score: 503.056 bits (1294), Expect = 1.864e-145
Identity = 514/1821 (28.23%), Postives = 834/1821 (45.80%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNK---------------------------------HPDRSITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXX-----------XHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPD--NYYTSFPEILPEDIKDPSISDPME 5029
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F           ++   ++I +    N   DT KRK  V    KD   +    +S+  I +W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I    NK K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +NLLL++                                    P    TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++             + SP  ++ +      S   +  G++   P+ P+V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + +L  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +M+    N  EL  +   R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE  ++         +       +S S  +    S E +  +L+  LI KLP  + +  ++ AA E+LE G+H     + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  +  D  V   EE   L++ H H    I+P   +YY + P  LP++ ++P    P E
Sbjct:   20 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFNSSKI------SSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINNWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TENKMKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPAPPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLRLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSIGPGPGGHQAHGISAQQGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTISRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVSCKRSGPHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFYELIRHDVFSHNIYMCTLISRGDLASNSHLPRPRSPSDEPSDESERKDQDAGSSVKIEDTGMSESMEIDHNSSANFDEMFSPPMHCESKGSPSPEKQAQEQESKSTAKD-KGMD---PAFPLV-YEQ-PRHIQYATHFPIPQEESASHECNQRLVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSNLAGSYTTGLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYYNIDPSDSNMLWDQMFMIDAITNPTAHNLNHSMLGKITN--ELNDSPANRYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDGTKSDKSIVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLVVYAKY------VLKSICHQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAEMNSSNPSWNGSAVSGSSVSNSNSASKLKPVLSSSERSGVWLVAPLIGKLP-TSVQGHVLKAAGEELEKGQHLGP-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTIRVDRKVTKFEEQQRLLLYHTH----IKPKQRSYYLA-PLNLPQEEEEPLTPVPPE 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Zebrafish
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:566632])

HSP 1 Score: 503.056 bits (1294), Expect = 1.864e-145
Identity = 514/1821 (28.23%), Postives = 834/1821 (45.80%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNK---------------------------------HPDRSITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXX-----------XHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPD--NYYTSFPEILPEDIKDPSISDPME 5029
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F           ++   ++I +    N   DT KRK  V    KD   +    +S+  I +W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I    NK K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +NLLL++                                    P    TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++             + SP  ++ +      S   +  G++   P+ P+V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + +L  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +M+    N  EL  +   R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE  ++         +       +S S  +    S E +  +L+  LI KLP  + +  ++ AA E+LE G+H     + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  +  D  V   EE   L++ H H    I+P   +YY + P  LP++ ++P    P E
Sbjct:   20 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFNSSKI------SSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINNWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TENKMKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPAPPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLRLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSIGPGPGGHQAHGISAQQGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTISRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVSCKRSGPHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFYELIRHDVFSHNIYMCTLISRGDLASNSHLPRPRSPSDEPSDESERKDQDAGSSVKIEDTGMSESMEIDHNSSANFDEMFSPPMHCESKGSPSPEKQAQEQESKSTAKD-KGMD---PAFPLV-YEQ-PRHIQYATHFPIPQEESASHECNQRLVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSNLAGSYTTGLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYYNIDPSDSNMLWDQMFMIDAITNPTAHNLNHSMLGKITN--ELNDSPANRYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDGTKSDKSIVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLVVYAKY------VLKSICHQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAEMNSSNPSWNGSAVSGSSVSNSNSASKLKPVLSSSERSGVWLVAPLIGKLP-TSVQGHVLKAAGEELEKGQHLGP-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTIRVDRKVTKFEEQQRLLLYHTH----IKPKQRSYYLA-PLNLPQEEEEPLTPVPPE 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000020345.1 (mediator complex subunit 12 [Source:NCBI gene;Acc:100495585])

HSP 1 Score: 478.019 bits (1229), Expect = 3.080e-137
Identity = 479/1767 (27.11%), Postives = 795/1767 (44.99%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL----DLIRIKLM-----RNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE-QMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNS--VNLLLTNNKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVY------NNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAA----GLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS----------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSSSIDYVESVGMDLF---KINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCT-DVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGP-PFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   +++ +    N   DT +RK  V    KD   +  + +++  I  W   L+ T P   L  K++P F KKE+V   + ++ VP+ RA W IK++  +     E+  KK R  +D + +W     R L E+L    D  R  L         +  E E+ + ++EY  +L + M+ + +LD  E L W++   E+    E +++K  LP LL + +   +S  L+R+L +  C      LL  +  HP   +T                        +++   C  HR ++F LS ++ S+ L CP A+V+      N IK  G  L+  P+      +        Q+    R  +  +EQ I +R  +VE +W   SF+   E TA      ++  +E+LD + +     S+  + L   +  L    D H +      ++ LLCEW+VS  R G HR  +VA++++     I   +   S                       Q  L++FLDT++P++ D    ++   F NLV LF ELI  ++FS N YM  +I+RG      + P P                            +   + + H S   S     E       D    +R    GLN   P   + D     RH+QY  HFPIP  +   HE N R   LY   R RD  +  ++R+ +DI K+  ++       +  K   + RR  + E+      AE I  RF+ L+++D   V +Q      N L   +  A  L    +  LP    I  + +L+E S N S LI    + ++ L+  +  +  + L+ + SL+ SY     +CI+  L  + + L+   +   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P     S++ + +   +D       + V+C      L  +   R+S V N L+HV     D D++  I  +  E   +   LS+EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S          RL   IL  LF   Q N      +  +V      D +LL++S  ++    +  +LK + V  D   L+   +   T  +  S      RR+     S     +  +   VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L  T          +     NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE             N    +     + + KP   S+E + A+L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD +   L+H  +K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EGIK    LS  WF  V  D  V  +EE   L++ H H     +P +YY
Sbjct:   19 LGPPDVYPQDAKQKEDELTALNVKQGFN-NQPAVSADEHGSAKNVNFN------PAKISSNFSSIMSEKLRCNTLPDTGRRKPQVNQ--KDNFMLVTV-RTQSSINTWFSDLAGTKPLTHLA-KKVPIFGKKEEVFGFLARFSVPVMRAAWLIKMTCAYYAAITETKVKK-RHVMDPIIEWTQIITRYLWEQLQKIADYYRPALGGCSSPSGPMPPEVEVALKQWEYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRQGEDELLKLLLPLLLRYSNSLVQSAYLSRRLAY-FCTRRLAQLLEGSGSHPGHLMTAQTGTALPPAPAPPPPSGSAPSSPFSDLLQCPQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDNRIKT-GSPLDHLPIAPSSLPMPGGSSAFTQQV---RRKLRDMEQQIKERGRSVEVRW---SFDKCQEATAGFPIGRVLHTLEVLDSHSFEKSDFSNNLDSLYNRIFGLGLGKDGHEISPDDDAVVTLLCEWAVSCKRYGHHRALVVAKLLEKRQAEIEAERCGDSEAVDEKGSVSSGSLSALSAPPVFQEVLLQFLDTQAPMLTDPANESERVEFYNLVLLFCELIRHDVFSHNMYMCTLISRGDLGIDPHAPRPRSPYEDPSDDTDRKEGEANSSIKLEDTTLSETMDIDHGSGMFSPAMRCEGRSPGPEDGDRDIRRTVKGLNGEGPLSALYDQ---PRHIQYATHFPIPQEESCSHECNQRLVVLYGVGRQRDDARHIIKRITRDILKVLNRK----STSETGKVVGQRRRRAKPEAF---PTAEEIFCRFQQLSHFDQHQVTAQ---VSRNVLEQITSFALGL----SYHLPLVQHIQFIFDLMEYSLNISGLI----DFAIQLLNELSVVEAELLLKSSSLVGSYTMGLCLCIVAVLRHYHTCLILNQEQTAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPS---DSNMLWEQEFMLDTIINPSGHSVNCGMLGKLLSDSPTNRYSFVCNALVHVCAGDHDTDRVNDIAILCAELTGSCKALSSEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILVARQCLLLEDL---IRCAAIPSLLNAACSEQDSEA------GARLTCRILLHLFKTPQLNPCEPDGSKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELRGSGFSHPTGTDNASEEDIATRRAGGRPVSIETASLDEYAKYVLRSICQQEWVGERCVRS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLNDTEQGDNPQRQRIKHILQNLDQWTMRQSALELQLMIKQTPSNEMNSLLENIAKATIEVFQQSAENACAAPANSAALSNATSSNA--PPNSKTKPVLSSLERSGAWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYGQVQQIVSNWRE-DQYQDDCKTPQLLHDVLKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGIKQSAPLSWGWFGTVRVDRRVSRMEEQQRLLLYHTHLKP--KPRSYY 1710          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000034172.1 (mediator complex subunit 12 [Source:NCBI gene;Acc:100495585])

HSP 1 Score: 475.707 bits (1223), Expect = 1.697e-136
Identity = 479/1779 (26.93%), Postives = 797/1779 (44.80%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL----DLIRIKLM-----RNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE-QMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNS--VNLLLTNNKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVY------NNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTA----AGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS----------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK--------SPELDRMSTGDNPD----SVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSSSIDYVESVGMDLF---KINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCT-DVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGP-PFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   +++ +    N   DT +RK  V    KD   +  + +++  I  W   L+ T P   L  K++P F KKE+V   + ++ VP+ RA W IK++  +     E+  KK R  +D + +W     R L E+L    D  R  L         +  E E+ + ++EY  +L + M+ + +LD  E L W++   E+    E +++K  LP LL + +   +S  L+R+L +  C      LL  +  HP   +T                        +++   C  HR ++F LS ++ S+ L CP A+V+      N IK  G  L+  P+      +        Q+    R  +  +EQ I +R  +VE +W   SF+   E TA      ++  +E+LD + +     S+  + L   +  L    D H +      ++ LLCEW+VS  R G HR  +VA++++     I   +   S                       Q  L++FLDT++P++ D    ++   F NLV LF ELI  ++FS N YM  +I+RG      + P P                            +   + + H S +             SP +        P+     +R    GLN   P   + D     RH+QY  HFPIP  +   HE N R   LY   R RD  +  ++R+ +DI K+  ++         E    + RR  + E+      AE I  RF+ L+++D   V +Q      N L   +  A  L    +  LP    I  + +L+E S N S LI    + ++ L+  +  +  + L+ + SL+ SY     +CI+  L  + + L+   +   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P     S++ + +   +D       + V+C      L  +   R+S V N L+HV     D D++  I  +  E   +   LS+EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S          RL   IL  LF   Q N      +  +V      D +LL++S  ++    +  +LK + V  D   L+   +   T  +  S      RR+     S     +  +   VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L  T          +     NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE             N    +     + + KP   S+E + A+L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD +   L+H  +K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EGIK    LS  WF  V  D  V  +EE   L++ H H     +P +YY
Sbjct:   19 LGPPDVYPQDAKQKEDELTALNVKQGFN-NQPAVSADEHGSAKNVNFN------PAKISSNFSSIMSEKLRCNTLPDTGRRKPQVNQ--KDNFMLVTV-RTQSSINTWFSDLAGTKPLTHLA-KKVPIFGKKEEVFGFLARFSVPVMRAAWLIKMTCAYYAAITETKVKK-RHVMDPIIEWTQIITRYLWEQLQKIADYYRPALGGCSSPSGPMPPEVEVALKQWEYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRQGEDELLKLLLPLLLRYSNSLVQSAYLSRRLAY-FCTRRLAQLLEGSGSHPGHLMTAQTGTALPPAPAPPPPSGSAPSSPFSDLLQCPQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDNRIKT-GSPLDHLPIAPSSLPMPGGSSAFTQQ---VRRKLRDMEQQIKERGRSVEVRW---SFDKCQEATAGFPIGRVLHTLEVLDSHSFEKSDFSNNLDSLYNRIFGLGLGKDGHEISPDDDAVVTLLCEWAVSCKRYGHHRALVVAKLLEKRQAEIEAERCGDSEAVDEKGSVSSGSLSALSAPPVFQEVLLQFLDTQAPMLTDPANESERVEFYNLVLLFCELIRHDVFSHNMYMCTLISRGDLGIDPHAPRPRSPYEDPSDDTDRKEGEANSSIKLEDTTLSETMDIDHGSGALFEDMEKSEFPMFSPAMRCEGRSPGPEDGDRDIRRTVKGLNGEGPLSALYDQ---PRHIQYATHFPIPQEESCSHECNQRLVVLYGVGRQRDDARHIIKRITRDILKVLNRKSTS------ETDEGQRRRRAKPEAF---PTAEEIFCRFQQLSHFDQHQVTAQ---VSRNVLEQITSFALGL----SYHLPLVQHIQFIFDLMEYSLNISGLI----DFAIQLLNELSVVEAELLLKSSSLVGSYTMGLCLCIVAVLRHYHTCLILNQEQTAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPS---DSNMLWEQEFMLDTIINPSGHSVNCGMLGKLLSDSPTNRYSFVCNALVHVCAGDHDTDRVNDIAILCAELTGSCKALSSEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILVARQCLLLEDL---IRCAAIPSLLNAACSEQDSEA------GARLTCRILLHLFKTPQLNPCEPDGSKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELRGSGFSHPTGTDNASEEDIATRRAGGRPVSIETASLDEYAKYVLRSICQQEWVGERCVRS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLNDTEQGDNPQRQRIKHILQNLDQWTMRQSALELQLMIKQTPSNEMNSLLENIAKATIEVFQQSAENACAAPANSAALSNATSSNA--PPNSKTKPVLSSLERSGAWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYGQVQQIVSNWRE-DQYQDDCKTPQLLHDVLKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGIKQSAPLSWGWFGTVRVDRRVSRMEEQQRLLLYHTHLKP--KPRSYY 1720          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000020359.1 (mediator complex subunit 12 [Source:NCBI gene;Acc:100495585])

HSP 1 Score: 473.011 bits (1216), Expect = 1.264e-135
Identity = 483/1801 (26.82%), Postives = 802/1801 (44.53%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL----DLIRIKLM-----RNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE-QMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNS--VNLLLTNNKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVY------NNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTA----AGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS----------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK--------SPELDRMSTGDNPD----SVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRG--------YMFDIIQIEKS--------------RKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSSSIDYVESVGMDLF---KINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCT-DVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGP-PFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   +++ +    N   DT +RK  V    KD   +  + +++  I  W   L+ T P   L  K++P F KKE+V   + ++ VP+ RA W IK++  +     E+  KK R  +D + +W     R L E+L    D  R  L         +  E E+ + ++EY  +L + M+ + +LD  E L W++   E+    E +++K  LP LL + +   +S  L+R+L +  C      LL  +  HP   +T                        +++   C  HR ++F LS ++ S+ L CP A+V+      N IK  G  L+  P+      +        Q+    R  +  +EQ I +R  +VE +W   SF+   E TA      ++  +E+LD + +     S+  + L   +  L    D H +      ++ LLCEW+VS  R G HR  +VA++++     I   +   S                       Q  L++FLDT++P++ D    ++   F NLV LF ELI  ++FS N YM  +I+RG      + P P                            +   + + H S +             SP +        P+     +R    GLN   P   + D     RH+QY  HFPIP  +   HE N R   LY   R RD  +  ++R+ +DI K+  ++          M  + QIEK                 + RR  + E+      AE I  RF+ L+++D   V +Q      N L   +  A  L    +  LP    I  + +L+E S N S LI    + ++ L+  +  +  + L+ + SL+ SY     +CI+  L  + + L+   +   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P     S++ + +   +D       + V+C      L  +   R+S V N L+HV     D D++  I  +  E   +   LS+EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S          RL   IL  LF   Q N      +  +V      D +LL++S  ++    +  +LK + V  D   L+   +   T  +  S      RR+     S     +  +   VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L  T          +     NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE             N    +     + + KP   S+E + A+L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD +   L+H  +K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EGIK    LS  WF  V  D  V  +EE   L++ H H     +P +YY
Sbjct:   19 LGPPDVYPQDAKQKEDELTALNVKQGFN-NQPAVSADEHGSAKNVNFN------PAKISSNFSSIMSEKLRCNTLPDTGRRKPQVNQ--KDNFMLVTV-RTQSSINTWFSDLAGTKPLTHLA-KKVPIFGKKEEVFGFLARFSVPVMRAAWLIKMTCAYYAAITETKVKK-RHVMDPIIEWTQIITRYLWEQLQKIADYYRPALGGCSSPSGPMPPEVEVALKQWEYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRQGEDELLKLLLPLLLRYSNSLVQSAYLSRRLAY-FCTRRLAQLLEGSGSHPGHLMTAQTGTALPPAPAPPPPSGSAPSSPFSDLLQCPQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDNRIKT-GSPLDHLPIAPSSLPMPGGSSAFTQQ---VRRKLRDMEQQIKERGRSVEVRW---SFDKCQEATAGFPIGRVLHTLEVLDSHSFEKSDFSNNLDSLYNRIFGLGLGKDGHEISPDDDAVVTLLCEWAVSCKRYGHHRALVVAKLLEKRQAEIEAERCGDSEAVDEKGSVSSGSLSALSAPPVFQEVLLQFLDTQAPMLTDPANESERVEFYNLVLLFCELIRHDVFSHNMYMCTLISRGDLGIDPHAPRPRSPYEDPSDDTDRKEGEANSSIKLEDTTLSETMDIDHGSGALFEDMEKSEFPMFSPAMRCEGRSPGPEDGDRDIRRTVKGLNGEGPLSALYDQ---PRHIQYATHFPIPQEESCSHECNQRLVVLYGVGRQRDDARHIIKRITRDILKVLNRKSTSETGKVVVMGKVKQIEKQVNVPKLTLSPCGTDEGQRRRRAKPEAF---PTAEEIFCRFQQLSHFDQHQVTAQ---VSRNVLEQITSFALGL----SYHLPLVQHIQFIFDLMEYSLNISGLI----DFAIQLLNELSVVEAELLLKSSSLVGSYTMGLCLCIVAVLRHYHTCLILNQEQTAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPS---DSNMLWEQEFMLDTIINPSGHSVNCGMLGKLLSDSPTNRYSFVCNALVHVCAGDHDTDRVNDIAILCAELTGSCKALSSEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILVARQCLLLEDL---IRCAAIPSLLNAACSEQDSEA------GARLTCRILLHLFKTPQLNPCEPDGSKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELRGSGFSHPTGTDNASEEDIATRRAGGRPVSIETASLDEYAKYVLRSICQQEWVGERCVRS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLNDTEQGDNPQRQRIKHILQNLDQWTMRQSALELQLMIKQTPSNEMNSLLENIAKATIEVFQQSAENACAAPANSAALSNATSSNA--PPNSKTKPVLSSLERSGAWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYGQVQQIVSNWRE-DQYQDDCKTPQLLHDVLKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGIKQSAPLSWGWFGTVRVDRRVSRMEEQQRLLLYHTHLKP--KPRSYY 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000034146.1 (mediator complex subunit 12 [Source:NCBI gene;Acc:100495585])

HSP 1 Score: 472.241 bits (1214), Expect = 1.765e-135
Identity = 483/1801 (26.82%), Postives = 802/1801 (44.53%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL----DLIRIKLM-----RNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE-QMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNS--VNLLLTNNKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVY------NNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTA----AGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS----------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK--------SPELDRMSTGDNPD----SVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRG--------YMFDIIQIEKS--------------RKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSSSIDYVESVGMDLF---KINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCT-DVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGP-PFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   +++ +    N   DT +RK  V    KD   +  + +++  I  W   L+ T P   L  K++P F KKE+V   + ++ VP+ RA W IK++  +     E+  KK R  +D + +W     R L E+L    D  R  L         +  E E+ + ++EY  +L + M+ + +LD  E L W++   E+    E +++K  LP LL + +   +S  L+R+L +  C      LL  +  HP   +T                        +++   C  HR ++F LS ++ S+ L CP A+V+      N IK  G  L+  P+      +        Q+    R  +  +EQ I +R  +VE +W   SF+   E TA      ++  +E+LD + +     S+  + L   +  L    D H +      ++ LLCEW+VS  R G HR  +VA++++     I   +   S                       Q  L++FLDT++P++ D    ++   F NLV LF ELI  ++FS N YM  +I+RG      + P P                            +   + + H S +             SP +        P+     +R    GLN   P   + D     RH+QY  HFPIP  +   HE N R   LY   R RD  +  ++R+ +DI K+  ++          M  + QIEK                 + RR  + E+      AE I  RF+ L+++D   V +Q      N L   +  A  L    +  LP    I  + +L+E S N S LI    + ++ L+  +  +  + L+ + SL+ SY     +CI+  L  + + L+   +   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P     S++ + +   +D       + V+C      L  +   R+S V N L+HV     D D++  I  +  E   +   LS+EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S          RL   IL  LF   Q N      +  +V      D +LL++S  ++    +  +LK + V  D   L+   +   T  +  S      RR+     S     +  +   VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L  T          +     NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE             N    +     + + KP   S+E + A+L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD +   L+H  +K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EGIK    LS  WF  V  D  V  +EE   L++ H H     +P +YY
Sbjct:   19 LGPPDVYPQDAKQKEDELTALNVKQGFN-NQPAVSADEHGSAKNVNFN------PAKISSNFSSIMSEKLRCNTLPDTGRRKPQVNQ--KDNFMLVTV-RTQSSINTWFSDLAGTKPLTHLA-KKVPIFGKKEEVFGFLARFSVPVMRAAWLIKMTCAYYAAITETKVKK-RHVMDPIIEWTQIITRYLWEQLQKIADYYRPALGGCSSPSGPMPPEVEVALKQWEYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRQGEDELLKLLLPLLLRYSNSLVQSAYLSRRLAY-FCTRRLAQLLEGSGSHPGHLMTAQTGTALPPAPAPPPPSGSAPSSPFSDLLQCPQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDNRIKT-GSPLDHLPIAPSSLPMPGGSSAFTQQ---VRRKLRDMEQQIKERGRSVEVRW---SFDKCQEATAGFPIGRVLHTLEVLDSHSFEKSDFSNNLDSLYNRIFGLGLGKDGHEISPDDDAVVTLLCEWAVSCKRYGHHRALVVAKLLEKRQAEIEAERCGDSEAVDEKGSVSSGSLSALSAPPVFQEVLLQFLDTQAPMLTDPANESERVEFYNLVLLFCELIRHDVFSHNMYMCTLISRGDLGIDPHAPRPRSPYEDPSDDTDRKEGEANSSIKLEDTTLSETMDIDHGSGALFEDMEKSEFPMFSPAMRCEGRSPGPEDGDRDIRRTVKGLNGEGPLSALYDQ---PRHIQYATHFPIPQEESCSHECNQRLVVLYGVGRQRDDARHIIKRITRDILKVLNRKSTSETGKVVVMGKVKQIEKQVNVPKLTLSPCGTDEGQRRRRAKPEAF---PTAEEIFCRFQQLSHFDQHQVTAQ---VSRNVLEQITSFALGL----SYHLPLVQHIQFIFDLMEYSLNISGLI----DFAIQLLNELSVVEAELLLKSSSLVGSYTMGLCLCIVAVLRHYHTCLILNQEQTAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPS---DSNMLWEQEFMLDTIINPSGHSVNCGMLGKLLSDSPTNRYSFVCNALVHVCAGDHDTDRVNDIAILCAELTGSCKALSSEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILVARQCLLLEDL---IRCAAIPSLLNAACSEQDSEA------GARLTCRILLHLFKTPQLNPCEPDGSKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELRGSGFSHPTGTDNASEEDIATRRAGGRPVSIETASLDEYAKYVLRSICQQEWVGERCVRS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLNDTEQGDNPQRQRIKHILQNLDQWTMRQSALELQLMIKQTPSNEMNSLLENIAKATIEVFQQSAENACAAPANSAALSNATSSNA--PPNSKTKPVLSSLERSGAWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYGQVQQIVSNWRE-DQYQDDCKTPQLLHDVLKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGIKQSAPLSWGWFGTVRVDRRVSRMEEQQRLLLYHTHLKP--KPRSYY 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000020329.1 (mediator complex subunit 12 [Source:NCBI gene;Acc:100495585])

HSP 1 Score: 472.241 bits (1214), Expect = 1.981e-135
Identity = 485/1801 (26.93%), Postives = 805/1801 (44.70%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKL----DLIRIKLM-----RNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE-QMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNS--VNLLLTNNKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVY------NNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAA----GLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS----------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK--------SPEL--DRMSTG--DNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRG--------YMFDIIQIEKS--------------RKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSSSIDYVESVGMDLF---KINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCT-DVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGP-PFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   +++ +    N   DT +RK  V    KD   +  + +++  I  W   L+ T P   L  K++P F KKE+V   + ++ VP+ RA W IK++  +     E+  KK R  +D + +W     R L E+L    D  R  L         +  E E+ + ++EY  +L + M+ + +LD  E L W++   E+    E +++K  LP LL + +   +S  L+R+L +  C      LL  +  HP   +T                        +++   C  HR ++F LS ++ S+ L CP A+V+      N IK  G  L+  P+      +        Q+    R  +  +EQ I +R  +VE +W   SF+   E TA      ++  +E+LD + +     S+  + L   +  L    D H +      ++ LLCEW+VS  R G HR  +VA++++     I   +   S                       Q  L++FLDT++P++ D    ++   F NLV LF ELI  ++FS N YM  +I+RG      + P P                            +   + + H S +             SP +  +  S G  D    +R    GLN   P   + D     RH+QY  HFPIP  +   HE N R   LY   R RD  +  ++R+ +DI K+  ++          M  + QIEK                 + RR  + E+      AE I  RF+ L+++D   V +Q      N L   +  A  L    +  LP    I  + +L+E S N S LI    + ++ L+  +  +  + L+ + SL+ SY     +CI+  L  + + L+   +   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P     S++ + +   +D       + V+C      L  +   R+S V N L+HV     D D++  I  +  E   +   LS+EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S          RL   IL  LF   Q N      +  +V      D +LL++S  ++    +  +LK + V  D   L+   +   T  +  S      RR+     S     +  +   VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L  T          +     NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE             N    +     + + KP   S+E + A+L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD +   L+H  +K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EGIK    LS  WF  V  D  V  +EE   L++ H H     +P +YY
Sbjct:   19 LGPPDVYPQDAKQKEDELTALNVKQGFN-NQPAVSADEHGSAKNVNFN------PAKISSNFSSIMSEKLRCNTLPDTGRRKPQVNQ--KDNFMLVTV-RTQSSINTWFSDLAGTKPLTHLA-KKVPIFGKKEEVFGFLARFSVPVMRAAWLIKMTCAYYAAITETKVKK-RHVMDPIIEWTQIITRYLWEQLQKIADYYRPALGGCSSPSGPMPPEVEVALKQWEYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRQGEDELLKLLLPLLLRYSNSLVQSAYLSRRLAY-FCTRRLAQLLEGSGSHPGHLMTAQTGTALPPAPAPPPPSGSAPSSPFSDLLQCPQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDNRIKT-GSPLDHLPIAPSSLPMPGGSSAFTQQV---RRKLRDMEQQIKERGRSVEVRW---SFDKCQEATAGFPIGRVLHTLEVLDSHSFEKSDFSNNLDSLYNRIFGLGLGKDGHEISPDDDAVVTLLCEWAVSCKRYGHHRALVVAKLLEKRQAEIEAERCGDSEAVDEKGSVSSGSLSALSAPPVFQEVLLQFLDTQAPMLTDPANESERVEFYNLVLLFCELIRHDVFSHNMYMCTLISRGDLGIDPHAPRPRSPYEDPSDDTDRKEGEANSSIKLEDTTLSETMDIDHGSGALFEDMEKSEFPMFSPAMRCEGRSPGPEDGDRDIRRTVKGLNGEGPLSALYDQ---PRHIQYATHFPIPQEESCSHECNQRLVVLYGVGRQRDDARHIIKRITRDILKVLNRKSTSETGKVVVMGKVKQIEKQVNVPKLTLSPCGTDEGQRRRRAKPEAF---PTAEEIFCRFQQLSHFDQHQVTAQ---VSRNVLEQITSFALGL----SYHLPLVQHIQFIFDLMEYSLNISGLI----DFAIQLLNELSVVEAELLLKSSSLVGSYTMGLCLCIVAVLRHYHTCLILNQEQTAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPS---DSNMLWEQEFMLDTIINPSGHSVNCGMLGKLLSDSPTNRYSFVCNALVHVCAGDHDTDRVNDIAILCAELTGSCKALSSEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILVARQCLLLEDL---IRCAAIPSLLNAACSEQDSEA------GARLTCRILLHLFKTPQLNPCEPDGSKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELRGSGFSHPTGTDNASEEDIATRRAGGRPVSIETASLDEYAKYVLRSICQQEWVGERCVRS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLNDTEQGDNPQRQRIKHILQNLDQWTMRQSALELQLMIKQTPSNEMNSLLENIAKATIEVFQQSAENACAAPANSAALSNATSSNA--PPNSKTKPVLSSLERSGAWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYGQVQQIVSNWRE-DQYQDDCKTPQLLHDVLKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGIKQSAPLSWGWFGTVRVDRRVSRMEEQQRLLLYHTHLKP--KPRSYY 1748          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Match: Med12l (mediator complex subunit 12-like [Source:MGI Symbol;Acc:MGI:2139916])

HSP 1 Score: 513.842 bits (1322), Expect = 3.537e-149
Identity = 489/1782 (27.44%), Postives = 825/1782 (46.30%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSD-DEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH-------------------PDRSITDF-YAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYN------NIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRK---SPELDRMSTGDNPD-SVRSECSGLNQILPSIP--IVDYRNFN--RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFD--LTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHT-----LFSIPNHGIK-----FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLT---TAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P A ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H                   P  S     ++++ SC+ H  +++ LS ++ +++L CP A+V+N       I  PG  L+   +      +        Q+    R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG     A+  L    G  S  H S     +    SP         NP  S R   +G   +    P  ++   N++  RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+G     +  E   +K+R+  +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V+ +      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q       T       +   D +LL+++   +    +  +LK + +  D                  +G  +D +  D   T  N  S+G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +        S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD + + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+      L S    G +     +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++    + +K   +G  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  + ++ H H   + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLA-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLVKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPVDDSLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMIIGTNNTSIGTPSPGTPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKISNPGSPLDLLQVAPSSLPMPGGNTAFNQQV---RARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSASLAGSSLPVFQNVLLRFLDTQAPALSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTGLRSPAGENSDEHYSKDHDMKMEIFSPMPGESCENINPSLSRRLSVNGEKLLKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKGTTESGVGDEG--QKARKTKQE----VFPTPENVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILNDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFFPQGTGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGSNNVNTMKNEDFGMRGLRRDGNAEDAWATSQNSKSYG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPSSGSVAEMNNLLDNIAKATIEVFQQSADLNNNASNSGMSLFNPNTIGSVDPSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDTKARQMMHEALQLRLNLVGGMFDTVQRSTQGTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSSASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQARGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRKVIKYEEQQHFLLYHTH--TMPKPRSYY 1727          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Match: Med12l (mediator complex subunit 12-like [Source:MGI Symbol;Acc:MGI:2139916])

HSP 1 Score: 506.908 bits (1304), Expect = 1.003e-146
Identity = 490/1815 (27.00%), Postives = 823/1815 (45.34%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSD-DEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH-------------------PDRSITDF-YAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYN------NIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGG-----FLSVAHNXXXXXHRKSPELDRMSTG----DNPDS--VRSECSGLNQILPSIPIVDYRNFN--------------------------------RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFD--LTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHT-----LFSIPNHGIK-----FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P A ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H                   P  S     ++++ SC+ H  +++ LS ++ +++L CP A+V+N       I  PG  L+   +      +        Q+    R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG     A+  L    G       S  H+     H     L   S      D+ D    +S+ +    I   +P     N N                                RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+G     +  E   +K+R+  +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V+ +      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q       T       +   D +LL+++   +    +  +LK + +  D                  +G  +D +  D   T  N  S+G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +        S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD + + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+      L S    G +     +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  + ++ H H   + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLA-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLVKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPVDDSLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMIIGTNNTSIGTPSPGTPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKISNPGSPLDLLQVAPSSLPMPGGNTAFNQQV---RARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSASLAGSSLPVFQNVLLRFLDTQAPALSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTGLRSPAGENSDEHYSKDHDMKMEEHSVMARLGLGSGATHIFDDVDKSDFKSDPASEFPIFSPMPGESCENINPSLSRRLSVNGEKLLKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKGTTESGVGDEG--QKARKTKQE----VFPTPENVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILNDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFFPQGTGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGSNNVNTMKNEDFGMRGLRRDGNAEDAWATSQNSKSYG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPSSGSVAEMNNLLDNIAKATIEVFQQSADLNNNASNSGMSLFNPNTIGSVDPSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDTKARQMMHEALQLRLNLVGGMFDTVQRSTQGTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSSASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRKVIKYEEQQHFLLYHTH--TMPKPRSYY 1760          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Match: Med12l (mediator complex subunit 12-like [Source:MGI Symbol;Acc:MGI:2139916])

HSP 1 Score: 504.982 bits (1299), Expect = 4.883e-146
Identity = 489/1817 (26.91%), Postives = 824/1817 (45.35%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSD-DEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH-------------------PDRSITDF-YAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYN------NIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGG-----FLSVAHNXXXXXHRKSPELDRMSTG----DNPDS--VRSECSGLNQILPSIPIVDYRNFN--------------------------------RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFD--LTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHT-----LFSIPNHGIK-----FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLT---TAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P A ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H                   P  S     ++++ SC+ H  +++ LS ++ +++L CP A+V+N       I  PG  L+   +      +        Q+    R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG     A+  L    G       S  H+     H     L   S      D+ D    +S+ +    I   +P     N N                                RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+G     +  E   +K+R+  +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V+ +      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q       T       +   D +LL+++   +    +  +LK + +  D                  +G  +D +  D   T  N  S+G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +        S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD + + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+      L S    G +     +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++    + +K   +G  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  + ++ H H   + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLA-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLVKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPVDDSLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMIIGTNNTSIGTPSPGTPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKISNPGSPLDLLQVAPSSLPMPGGNTAFNQQV---RARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSASLAGSSLPVFQNVLLRFLDTQAPALSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTGLRSPAGENSDEHYSKDHDMKMEEHSVMARLGLGSGATHIFDDVDKSDFKSDPASEFPIFSPMPGESCENINPSLSRRLSVNGEKLLKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKGTTESGVGDEG--QKARKTKQE----VFPTPENVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILNDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFFPQGTGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGSNNVNTMKNEDFGMRGLRRDGNAEDAWATSQNSKSYG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPSSGSVAEMNNLLDNIAKATIEVFQQSADLNNNASNSGMSLFNPNTIGSVDPSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDTKARQMMHEALQLRLNLVGGMFDTVQRSTQGTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSSASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQARGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRKVIKYEEQQHFLLYHTH--TMPKPRSYY 1762          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Match: Med12 (mediator complex subunit 12 [Source:MGI Symbol;Acc:MGI:1926212])

HSP 1 Score: 474.937 bits (1221), Expect = 3.300e-136
Identity = 485/1824 (26.59%), Postives = 809/1824 (44.35%), Query Frame = 2
Query:   44 SLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTN-NKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRS--------------------------ECSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRV-----LREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIK---NLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            S E  PLK L+           LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK ++     +   + A  +S+  I  W   L+ T P   L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK ++  D  ++W     + L E+L  +  +  R               + H+ EM + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L   + H    I                         +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP     S   + +    RK  E    S  ++P    S                           C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L V     LR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   + N +E + + DD + K L+H ++K RL LVG +FD +Q S +   +W  LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKL+K++ ++   + +E +   LLP  K   DVI   P      ++  ++   +    K+G  V  K++I+PWE+ EG+K      S +WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:    8 SYEHRPLKRLR-----------LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFN------PAKISSNFSSIIAEKLRCNTLSDTGRRK-SLMNQKDNFWLVTA--RSQSAINTWFTDLAGTKPLTHLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAMSETKVKK-KNTADPFTEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEMAIRQWDYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVIAAQSTSSLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSVASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-----SPFDDPTDDPERKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPAKEKIEGTLGILYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVPGGTEELPEEEGGGGSSGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILKNLDQWTMRQSSLELQLMIKQTPNTEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLASLHSQVHQIVINWRENQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAQLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLQKDLGER-QSDSLEKVHQ-LLPLPKQNRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWELFEGLKPSTAPLSWAWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1740          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Match: Med12 (mediator complex subunit 12 [Source:MGI Symbol;Acc:MGI:1926212])

HSP 1 Score: 474.937 bits (1221), Expect = 3.433e-136
Identity = 485/1824 (26.59%), Postives = 809/1824 (44.35%), Query Frame = 2
Query:   44 SLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTN-NKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRS--------------------------ECSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRV-----LREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIK---NLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            S E  PLK L+           LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK ++     +   + A  +S+  I  W   L+ T P   L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK ++  D  ++W     + L E+L  +  +  R               + H+ EM + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L   + H    I                         +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP     S   + +    RK  E    S  ++P    S                           C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L V     LR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   + N +E + + DD + K L+H ++K RL LVG +FD +Q S +   +W  LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKL+K++ ++   + +E +   LLP  K   DVI   P      ++  ++   +    K+G  V  K++I+PWE+ EG+K      S +WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:    8 SYEHRPLKRLR-----------LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFN------PAKISSNFSSIIAEKLRCNTLSDTGRRK-SLMNQKDNFWLVTA--RSQSAINTWFTDLAGTKPLTHLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAMSETKVKK-KNTADPFTEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEMAIRQWDYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVIAAQSTSSLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSVASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-----SPFDDPTDDPERKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPAKEKIEGTLGILYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVPGGTEELPEEEGGGGSSGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILKNLDQWTMRQSSLELQLMIKQTPNTEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLASLHSQVHQIVINWRENQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAQLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLQKDLGER-QSDSLEKVHQ-LLPLPKQNRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWELFEGLKPSTAPLSWAWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1740          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Match: sp|Q8BQM9|MD12L_MOUSE (Mediator of RNA polymerase II transcription subunit 12-like protein OS=Mus musculus OX=10090 GN=Med12l PE=1 SV=2)

HSP 1 Score: 513.842 bits (1322), Expect = 2.474e-148
Identity = 489/1782 (27.44%), Postives = 825/1782 (46.30%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSD-DEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH-------------------PDRSITDF-YAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYN------NIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRK---SPELDRMSTGDNPD-SVRSECSGLNQILPSIP--IVDYRNFN--RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFD--LTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHT-----LFSIPNHGIK-----FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLT---TAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P A ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H                   P  S     ++++ SC+ H  +++ LS ++ +++L CP A+V+N       I  PG  L+   +      +        Q+    R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG     A+  L    G  S  H S     +    SP         NP  S R   +G   +    P  ++   N++  RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+G     +  E   +K+R+  +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V+ +      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q       T       +   D +LL+++   +    +  +LK + +  D                  +G  +D +  D   T  N  S+G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +        S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD + + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+      L S    G +     +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++    + +K   +G  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  + ++ H H   + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLA-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLVKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPVDDSLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMIIGTNNTSIGTPSPGTPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKISNPGSPLDLLQVAPSSLPMPGGNTAFNQQV---RARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSASLAGSSLPVFQNVLLRFLDTQAPALSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTGLRSPAGENSDEHYSKDHDMKMEIFSPMPGESCENINPSLSRRLSVNGEKLLKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKGTTESGVGDEG--QKARKTKQE----VFPTPENVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILNDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFFPQGTGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGSNNVNTMKNEDFGMRGLRRDGNAEDAWATSQNSKSYG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPSSGSVAEMNNLLDNIAKATIEVFQQSADLNNNASNSGMSLFNPNTIGSVDPSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDTKARQMMHEALQLRLNLVGGMFDTVQRSTQGTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSSASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQARGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRKVIKYEEQQHFLLYHTH--TMPKPRSYY 1727          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Match: sp|Q86YW9|MD12L_HUMAN (Mediator of RNA polymerase II transcription subunit 12-like protein OS=Homo sapiens OX=9606 GN=MED12L PE=1 SV=2)

HSP 1 Score: 504.212 bits (1297), Expect = 4.429e-145
Identity = 487/1780 (27.36%), Postives = 830/1780 (46.63%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIR--IKLMRNTIDH------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC-SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHG--------LCNSVNLLLTNNKH----PDRS----------------ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLN---RDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVV---------SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARG-LFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRSE--------CSGLNQILPSIPIVDYRNFN--RHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKL-ENVFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTII---VETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQ----NSTANSVSAFKKE-DVNLLSSSLQKVTTELLVDLLKMLAVHSD------------------KGRLQDQDYFDL--TENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLI-DKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDT--MNRTFTNLNIWSLHFDQMKIQLLLTQIPEE-------ERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTE----SIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIH-TLFSIPNHGI---------KFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P    +EH SA++I    +  P  + +  +  +++ +    N  QDT K+K  V    KD   +    +S+  I+ W   L+   P + ++ K++P   KKEDV   + KY VP+ RA W IK++  + +  +E+  KK R   D   +W     R L E+L  I     +  +T D       E E  + ++EY  +L   M+ E +L+  E L W++   E+    D+ ++K  LP +L + D F +S  L+R+L +         L +S NLL  ++ H    P+ S                +   ++++ SC+ H  +++ LS ++ +++L CP A+V+N       + N      L     +    PG     N   R  I ++EQ I QR  AVE +W   SF+   E TA   I  V    E+LDR+ ++    S+  E L   +           +  N   ++ LLCEW+VS  R+G HR   VA++++     I   +  +S                      QN L+ FLDT++P + D     +   F NLV LF E I  ++FS + YM  +I+RG L  + +  P  P+G     A    S  H    E+     G++ ++  +         C  L +      ++   N++  RHLQY  HFPIP+++   HE N R+  LY   + RD  +  L+++ KDI K+  K+      +  E   +K+R++ +E    +    E++ ++ + L+Y+D   V SQ     +  +           S ++  LP    I  + +L+E + N + LI    + ++ L+  +  +  + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+  + ++ V  S      RC  A +   + SC+ LRS     F     K+ + ++ N+ P       D    +D++E+        +M+        L  N   R+S V N L++V  C       RIN I     E  +  ++LS+EW+  + +L    N        V  FN +L +   +DL F+++++T IA ++ARQCF   D +  V   +L       +       P  R+   +L  LF   Q      +T       +   D +LL+++   +    +  +LK + +  D                  +G   D +  D+     N  S G    +SI  E + +      +   VLR IC   WV     +E P RL  D  LI D  +SN QA+ LL +IC+P        CT  D +    + R   NL  W+L    +++QL++ Q  ++       E  ++++N++K  I +F+  A+   N        +N +      + S RQ   +    S E    +L+  LI +LP  + + +++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   DW LLL ++I  G V+MH+++ ELF TVLDM+  LI+ TL S  ++            +  ++KKL+KE+ DK + E ++ ++  LLP  K T DVI   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF  V  D  V+  EE  +L++ H HP  + +P +YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTAVNVKQGFN-NQPAFTGDEHGSARNI----VINP--SKIGAYFSSILAEKLKLNTFQDTGKKKPQVNA--KDNYWL-VTARSQSAIHSWFSDLAGNKPLS-ILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKK-RQAPDPNLEWTQISTRYLREQLAKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHMFQEGMLEKHEYLTWILDVLEKIRPMDDDLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCARRLSLLLSDSPNLLAAHSPHMMIGPNNSSIGAPSPGPPGPGMSPVQLAFSDFLSCAQHGPLVYGLSCMLQTVTLCCPSALVWNYSTNENKSANPGSPLDLLQVAPSSLPMPGGNTAFNQQVRARIYEVEQQIKQRGRAVEVRW---SFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSMETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEAERCGESEVLDEKESISSSSLAGSSLPVFQNVLLRFLDTQAPSLSDPNSECEKVEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTRPRSPVG---ENADEHYSKDHDVKMEIFSPMPGESCENANTSLGRRMSVNCEKLVKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSSHECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTETGVGDEG--QKARKNKQETFPTL----ETVFTKLQLLSYFDQHQVTSQISNNVLEQI-------TSFASGTSYHLPLAHHIQLIFDLMEPALNINGLI----DFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQTAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQTIYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLG-----KILSDNAANRYSFVCNTLMNV--CMGHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSN-------HVWGFNDVLCTVDVSDLSFHDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADA----EPGARMTCRLLLHLFRAPQACFLPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGNNSVSSLKNDDFTMRGLRCDGNADDIWTASQNPKSCG----KSISIETANLR----EYARYVLRTICQQEWVGEHCLKE-PERLCTDKELILDPVLSNMQAQKLLQLICYPHGI---KECTEGDNLQRQHIKRILQNLEQWTLRQSWLELQLMIKQCLKDPGSGSVAEMNNLLDNIAKATIEVFQQSADLN-NSSNSGMSLFNPNSIGSADTSSTRQNGIKTFLSSSERRGVWLVAPLIARLP-TSVQGRVLKAAGEELEKGQHLGS-SSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNWRE-ERYQDDIKARQMMHEALQLRLNLVGGMFDTVQRSTQWTTDWALLLLQIITSGTVDMHTNN-ELFTTVLDMLGVLINGTLASDLSNASPGGSEENKRAYMNLVKKLKKELGDKRS-ESIDKVRQ-LLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQKNPAPLSWAWFGTVRVDRRVIKYEEQHHLLLYHTHP--MPKPRSYY 1724          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Match: sp|Q2QCI8|MED12_DANRE (Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 1.274e-144
Identity = 514/1821 (28.23%), Postives = 834/1821 (45.80%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNK---------------------------------HPDRSITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXX-----------XHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPD--NYYTSFPEILPEDIKDPSISDPME 5029
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F           ++   ++I +    N   DT KRK  V    KD   +    +S+  I +W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I    NK K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +NLLL++                                    P    TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++             + SP  ++ +      S   +  G++   P+ P+V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + +L  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +M+    N  EL  +   R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE  ++         +       +S S  +    S E +  +L+  LI KLP  + +  ++ AA E+LE G+H     + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  +  D  V   EE   L++ H H    I+P   +YY + P  LP++ ++P    P E
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFNSSKI------SSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINNWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TENKMKKRHVIDPCIEWTPIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPAPPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLRLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSIGPGPGGHQAHGISAQQGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTISRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVSCKRSGPHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFYELIRHDVFSHNIYMCTLISRGDLASNSHLPRPRSPSDEPSDESERKDQDAGSSVKMEDTGMSESMEIDHNSSANFDEMFSPPMHCESKGSPSPEKQAQEQESKSTAKD-KGMD---PAFPLV-YEQ-PRHIQYATHFPIPQEESASHECNQRLVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSNLAGSYTTGLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYYNIDPSDSNMLWDQMFMIDAITNPTAHNLNHSMLGKITN--ELNDSPANRYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDGTKSDKSIVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLVVYAKY------VLKSICHQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAEMNSSNPSWNGSAVSGSSVSNSNSASKLKPVLSSSERSGVWLVAPLIGKLP-TSVQGHVLKAAGEELEKGQHLGP-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTIRVDRKVTKFEEQQRLLLYHTH----IKPKQRSYYLA-PLNLPQEEEEPLTPVPPE 1747          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Match: sp|A2AGH6|MED12_MOUSE (Mediator of RNA polymerase II transcription subunit 12 OS=Mus musculus OX=10090 GN=Med12 PE=1 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 2.401e-135
Identity = 485/1824 (26.59%), Postives = 809/1824 (44.35%), Query Frame = 2
Query:   44 SLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTN-NKHPDRSIT----------------------DFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRS--------------------------ECSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRV-----LREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIK---NLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            S E  PLK L+           LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK ++     +   + A  +S+  I  W   L+ T P   L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK ++  D  ++W     + L E+L  +  +  R               + H+ EM + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L   + H    I                         +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP     S   + +    RK  E    S  ++P    S                           C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L+S     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L V     LR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   + N +E + + DD + K L+H ++K RL LVG +FD +Q S +   +W  LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKL+K++ ++   + +E +   LLP  K   DVI   P      ++  ++   +    K+G  V  K++I+PWE+ EG+K      S +WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:    8 SYEHRPLKRLR-----------LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFN------PAKISSNFSSIIAEKLRCNTLSDTGRRK-SLMNQKDNFWLVTA--RSQSAINTWFTDLAGTKPLTHLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAMSETKVKK-KNTADPFTEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEMAIRQWDYNEKLALFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVIAAQSTSSLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSVASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-----SPFDDPTDDPERKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPAKEKIEGTLGILYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKSKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVPGGTEELPEEEGGGGSSGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILKNLDQWTMRQSSLELQLMIKQTPNTEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLASLHSQVHQIVINWRENQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAQLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLQKDLGER-QSDSLEKVHQ-LLPLPKQNRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWELFEGLKPSTAPLSWAWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1740          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Match: sp|Q5RCU2|MED12_PONPY (Mediator of RNA polymerase II transcription subunit 12 OS=Pongo pygmaeus OX=9600 GN=MED12 PE=2 SV=2)

HSP 1 Score: 472.626 bits (1215), Expect = 1.231e-134
Identity = 481/1797 (26.77%), Postives = 802/1797 (44.63%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMR-------------NTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNKHPDRSITD-----------------------FYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPII-DSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKS-------PELDRMSTGDNPDSVRSE---------------CSGLNQILPSIPIVDYR-----------------NFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYM-------------FDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFV--SVNGYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDKDRSS-----SIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHV-VQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN---STAN--SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLR-----VLREICCVSWVRIRFSQETPSRLIRD-NVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIK----------FFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT +RK  V    KD   +    +S+  I  W   L+ T P  +L  K++P F KKE+V   + KY VP+ RA W IK++  +    +E+  KK   +VD   +W     + L E+L  +  +  R               + H+ E+ + +++Y  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     + L L         +                          +++   C  HR ++F LS ++ ++ L CP A+V++          GSPLD LP A S LP P G        R  + ++EQ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + LC  +  L    D H +      ++ LLCEW+VS  R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ D +  ++   F NLV LF ELI  ++FS N Y   +I+RG     A  P PP   F   A +        S       P L      D   SV  E               C G     P  P V+                   +  RH+QY  HFPIP  +   HE N R   L+   + RD  +  ++++ KDI K+  ++G                D+  +     + RR  R E+      AE I ++F+ L++YD   V +Q     +  +   ++         +  LP    +  + +L+E    YSL I  + + ++ L+  +  +  + L+ +  L+ SY +   +CI+  L  + + L+   D   ++F G+  + ++ +  S      RC  A +   + SC+ L++     F     K++N ++ N++P +          ID +E+     F    +  S     L  N   R+S V N L+HV V   D D++  I  +  E       LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    + C A+     A   +Q S       P  RL   IL  LF   Q N   S  N  +V      D +LL++S  ++    +  +LK + V  D   L+   +       ++        S    +   ++ +   +L      VLR IC   WV  R  +     L  D N L D  +S++QA+ L+ +IC+P   L             + R   NL+ W++    +++QL++ Q P  E   ++EN++K  I +F+  AE  ++      +             S + KP   S+E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q+   ++N ++ + + DD + K L+H ++K RL LVG +FD +Q S +   +W +LL ++II G V+M S++ ELF TVLDM+S LI+   +     I           +  + KKL+KE+ ++ + + +E ++  LLP  K T DVI   P      ++  ++   +    K+G  V  K++I+PW++ EG+K    LS  WF  V  D  V   EE   L++ H H     RP  YY
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVSFN------PAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQ--KDNFWL-VTARSQSAINTWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKK--RHVDPFMEWTQIITKYLWEQLQKM-AEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGE-FVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVFGLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAKLREIEQQIKERGQAVEVRW---SFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPP-SPFDDPADDPEHKEAEGSSSSKLEDPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEGTLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILKVLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAF---PTAEDIFAKFQHLSHYDQHQVTAQVSRNVLEQITSFAL-------GMSYHLPLVQHVQFIFDLME----YSLSISGLIDFAIQLLNELSVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMNRSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKS-----LSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNG------TCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---IRCAAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGD-AELKGSGFTVTGGTEELPEEEGGGGSGGRRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKS----LCEDSNDLQDPVLSSAQAQRLMQLICYPH-RLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETGSSSGSTASNM----------PSSSKTKPVLSSLERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVHQIVNNWRDDQYL-DDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAMLLLEIIISGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKLQKELGERQS-DSLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVSTKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRP--RPRAYY 1738          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Match: G7Y604 (Mediator of RNA polymerase II transcription subunit 12-like protein OS=Clonorchis sinensis OX=79923 GN=CLF_101547 PE=4 SV=1)

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 628/1976 (31.78%), Postives = 941/1976 (47.62%), Query Frame = 2
Query:   29 MSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLT---DLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNE----QCSDDEQM------------------------------MKFYLPFLLYFGDRFKESEILTRKLLHGLCNSV-NLLLTNNK----------HPDRS----ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNL--NGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVV---SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNI-HQNQSH----QSIQNCLVEFLDTKS----PIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPI-----------------GGFLSVAHNXX------------XXXHRKSPELDRMSTGDNPDSVRSE---------CSGLNQILP----SIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEK-SRKKSRRDPREESM--------------------------------LIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSL-------------------------------NIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMK--KLENVFRNIKPDK-----DRSSSIDYVESVGMD---LFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNST--AN----------------------------SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYF------DLTENNQVSFGPPFRRSIDTEESF--------IHMKIWNF----------TLR----------VLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQ--QANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETE-KMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQ-MIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQ-------------YRLTTAEKSG---------------------------------KQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTS--FPEILPEDIKDPSISDPMEIINSSGPPS 5056
            MS + SLE   LK  K+++          PPDVY Q  +QKEDL++E  VR+G+ Y KPV +E++S +          FLT    L  F   V+ K ++ +  QD  K+    A+  ++   +P ++K++     W  +LS + P  +++ +R+PY   K+++L E+  ++VPI+RA+W I +  +H   Q E+ K+K R  V   S+W  +  + L   L    ++L   +   E      +++YL  L++A+YD D+ DH EVL WL    E    Q S+DE                                +KF+L +LL FG RF E+E++ R+LL   C +  +++L+ ++          HP+ +    + + Y E  SC  HR+V+  LS +I  L L CP A V+N+I     +L   GSPLD++P + +ALP P G E    R  +  +E  I+ RS   E  W  ++F     +    LIKV+++LDR DY+  K+ +  E L   +    ++  + ++L+  LCEW+VS  R G +R  +VA +++ + H  QS     Q +Q  L++FLDT +    P    Q   D+EP RNLVCLF ELI+RE+F  + Y+  MIARG+F +V   PL                    G F +V++ +             S +   S + DR S  DNPDSVRSE         C G     P    S P+      + H  YL HFP+P ++ Y HE N R Q LY + R RD  +  +R+L +DI K++T++ Y+ D++  E   RKKS+   RE S                                 LI+KL E I SRF CL+Y+DMECV+SQC PT    L                               N   +LAN L + S +++P P  I     LIE S N + LI  I +    L  L E  SR   +T       YMS   +  IG L + Q VL TMSD   R+F  +    R        G   RC  A +   F S A ++S    + N    K+  +FR+++P +     D+  + D +++ G D   LF+           +L+ N N RFS V   ++ V Q T ++++  +  +  E  S+   L+ EW+ A+Y+++ P     GY   V    S +   D+  Y+++S+LI T+L R+C   SDFL RVIC A+AQG+ Q   V P + P+ RLA +IL RLFT E   ST  AN                            S   F+  +  LL+ +LQKVT ELLVD+LKML VH+DK   +DQ         D TE +    G       D E S         IH  +  F           LR          VLREIC V WVR RF +    R  R+NVLID+  S +QAR LL++I HP D  W  + +   +  +M +  ++L++W+L    +K QLL TQI   ++KDV+++V + I+  F+ QA    +AN   +  D            +     P         +L+P+LI KLP    K Q++  A E L+  KHF  HKN +DKE +L K S++L +P F  LL VC+A+ D     +  L +Q+ Y+++NA +TE ++PD+LR + ++   ++ RL LVG  F  +Q+  EL  DW LLL+KLI +GV+E  S+ + LFY V DM+ +L+HT+ +      K +Q + KK+R+E+  + +Y G+E I+  LLP  K    VIVT      H +Q+                + A KSG                                 K+G  +  KER+ PW++ +  K    LS   A S +      EE AN +I HDH  +L RP  +Y +  +PE     ++D   SD  E      PPS
Sbjct:    1 MSAFPSLENRSLK--KKSDC---------PPDVYNQRDEQKEDLMSEDFVRDGYKYIKPVRDEYDSCRK------ESKFLTVNDSLWKFYHDVLAKKYDCSTYQDLKKKS---ASNVRET-IVPVVDKNQ--ANAWFRELSGSTPL-QILGRRVPYSKDKQEILSELVAHKVPISRAVWLINLILLHTPAQPENAKRKQRPTVHP-SEWTSNICQMLERNL----VQLCSES--GEQPSVEEDWDYLFTLLLALYDSDVADHWEVLLWLTKRAEGLWKQPSEDEAAPTQQQYSNYDNNGDEPLPTETIEETNMLNNVKFFLFYLLKFGRRFTENELIARRLLFWCCGTFRSIVLSESRVPAADNQAGNHPNNTEMQLVLEEYLETCSCPLHRSVVLSLSSMITCLILSCPSAAVWNSIPTGTDHLYLEGSPLDVIPYSTAALPMPQGPETTEIRQCLFDVENVIITRSQLAEVGWNRQAFTDVSGEEMERLIKVLDILDRQDYHSVKEHNPMEALFNRIFNDDAINVDTAILVTTLCEWAVSVHRVGIYRSVIVACLLEQLTHSFQSDPNPFQMLQQTLLDFLDTFTSNLPPYSTDQAPVDNEPMRNLVCLFAELIDREVFDHDIYVRRMIARGVF-AVECHPLATSTVTESHTATLTLSTSTHGKFQAVSNTTLLSNLPNNVTTQCSVASEMSEDNDRCSV-DNPDSVRSEAGFPSVTTSCCGYVTSAPHHPASEPLTGPARCSPHFHYLTHFPLPQDESYSHEENQRYQLLYGSLRARDRARSRIRQLVRDIVKIFTRKFYLIDVVHGEMCKRKKSKDREREVSTAPVANMPSSSGHRVVAVTTTGGGSGGASDDAHLIDKLHEDIMSRFICLSYHDMECVISQCTPTFTKVLSGCNGQGNPTVIGDDYHSGSTLGMANPPSPPNNAGVLAN-LTNQSPIYMPVPNSIFLFFELIETSLNITSLIATIVDTLERLQTLFE--SRTPFMT------LYMSSVCLRSIGILQRHQPVLFTMSDLPNRLFPALIAQVRQVREPTQCGPFERCVLAYLNDLFTSNAQIKSHFASIYNKAHPKVAALFRSVEPSEGLATFDQDYASDLLKAAGSDYPSLFRAY-------ADDLRNNPNSRFSFVCRAIIFVCQATTLERVNYLCGLCAELTSHCGDLTPEWLGALYAVIAPRPYRHGYGPIV----SAVEPGDMNMYDSVSSLIGTLLFRRCMTISDFLCRVICPAMAQGLVQP--VGPQLEPSIRLACHILHRLFTAESSASTIQANMSALTPGHEPPTSAMATANTTSTSATDLSTPPFRISEPLLLTGALQKVTPELLVDVLKMLMVHNDKACSEDQVQSGMHVADDATEGSDSDVGQADDEVHDEEHSHRRLTGGKAIHPIVRRFLESGILPTVIELRNLPLIGLIQLVLREICSVPWVRERFFRMPSDRWTRENVLIDRKFSPTQARRLLHVIFHPFDITWSDTSS---LATSMCQVLSSLDLWTLRCALVKFQLLYTQIRLSQQKDVLDSVGQAIVRGFQTQALNWLKANGSGMSADVCLAPIGGISRFELEENDPV--------WLVPALIAKLP-RQLKAQIVTGALEILQGIKHFWKHKNDEDKEGELLKHSIVLAHPAFFRLLQVCMAEIDP----IDKLYEQVGYFVENAHDTEDRVPDNLRTRQVVQECLRLRLTLVGQCFKALQKEHELTTDWSLLLTKLISHGVIEPESN-TTLFYMVYDMLQSLVHTMAARSGVEGKHYQNLAKKIRRELSRRPSY-GIEQIR-LLLPPLKAACTVIVTG-----HNAQRLSASGSSGTSEGGGPGSGANKSGGIGKVSTSKGAGKGGGSSHHGGPRDNTFRRPGKKRGFTIIGKERLAPWDLQDPSKQAILLSMHGATSIEAIPSRTEEQANRLIRHDHFIRLRRPPEFYLTPVYPEEEDAKVQD-KRSDATEQPTLGPPPS 1896          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Match: A0A419PSG5 (Mediator of RNA polymerase II transcription subunit 12-like protein OS=Clonorchis sinensis OX=79923 GN=MED12L PE=4 SV=1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 627/1976 (31.73%), Postives = 940/1976 (47.57%), Query Frame = 2
Query:   29 MSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLT---DLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNE----QCSDDEQM------------------------------MKFYLPFLLYFGDRFKESEILTRKLLHGLCNSV-NLLLTNNK----------HPDRS----ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNL--NGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVV---SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNI-HQNQSH----QSIQNCLVEFLDTKS----PIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPI-----------------GGFLSVAHNXX------------XXXHRKSPELDRMSTGDNPDSVRSE---------CSGLNQILPSIP----IVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEK-SRKKSRRDPREESM--------------------------------LIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSL-------------------------------NIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMK--KLENVFRNIKPDK-----DRSSSIDYVESVGMD---LFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNST--AN----------------------------SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYF------DLTENNQVSFGPPFRRSIDTEESF--------IHMKIWNF----------TLR----------VLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQ--QANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETE-KMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQ-MIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQ-------------YRLTTAEKSG---------------------------------KQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTS--FPEILPEDIKDPSISDPMEIINSSGPPS 5056
            MS + SLE   LK  K+++          PPDVY Q  +QKEDL++E  VR+G+ Y KPV +E++S +          FLT    L  F   V+ K ++ +  QD  K+    A+  ++   +P ++K++     W  +LS + P  +++ +R+PY   K+++L E+  ++VPI+RA+W I +  +H   Q E+ K+K R  V   S+W  +  + L   L    ++L   +   E      +++YL  L++A+YD D+ DH EVL WL    E    Q S+DE                                +KF+L +LL FG RF E+E++ R+LL   C +  +++L+ ++          HP+ +    + + Y E  SC  HR+V+  LS +I  L L CP A V+N+I     +L   GSPLD++P + +ALP P G E    R  +  +E  I+ RS   E  W  ++F     +    LIKV+++LDR DY+  K+ +  E L   +    ++  + ++L+  LCEW+VS  R G +R  +VA +++ + H  QS     Q +Q  L++FLDT +    P    Q   D+EP RNLVCLF ELI+RE+F  + Y+  MIARG+F +V   PL                    G F +V++ +             S +   S + DR S  DNPDSVRSE         C G     P  P    +      + H  YL HFP+P ++ Y HE N R Q LY + R RD  +  +R+L +DI K++T++ Y+ D++  E   RKKS+   RE S                                 LI+KL E I SRF CL+Y+DMECV+SQC PT    L                               N   +LAN L + S +++P P  I     LIE S N + LI  I +    L  L E  SR   +T       YMS   +  IG L + Q VL TMSD   R+F  +    R        G   RC  A +   F S A ++S    + N    K+  +FR+++P +     D+  + D +++ G D   LF+           +L+ N N RFS V   ++ V Q T ++++  +  +  E  S+   L+ EW+ A+Y+++ P     GY   V    S +   D+  Y+++S+LI T+L R+C   SDFL RVIC A+AQG+ Q   V P + P+ RLA +IL RLFT E   ST  AN                            S   F+  +  LL+ +LQKVT ELLVD+LKML VH+DK   +DQ         D TE +    G       D E S         IH  +  F           LR          VLREIC V WVR RF +    R  R+NVLID+  S +QAR LL++I HP D  W  + +   +  +M +  ++L++W+L    +K QLL TQI   ++KDV+++V + I+  F+ QA    +AN   +  D            +     P         +L+P+LI KLP    K Q++  A E L+  KHF  HKN +DKE +L K S++L +P F  LL VC+A+ D     +  L +Q+ Y+++NA +TE ++PD+LR + ++   ++ RL LVG  F  +Q+  EL  DW LLL+KLI +GV+E  S+ + LFY V DM+ +L+HT+ +      K +Q + KK+R+E+  + +Y G+E I+  LLP  K    VIVT      H +Q+                + A KSG                                 K+G  +  KER+ PW++ +  K    LS   A S +      EE AN +I HDH  +L RP  +Y +  +PE     ++D   SD  E      PPS
Sbjct:    1 MSAFPSLENRSLK--KKSDC---------PPDVYNQRDEQKEDLMSEDFVRDGYKYIKPVRDEYDSCRK------ESKFLTVNDSLWKFYHDVLAKKYDCSTYQDLKKKS---ASNVRET-IVPVVDKNQ--ANAWFRELSGSTPL-QILGRRVPYSKDKQEILSELVAHKVPISRAVWLINLILLHTPAQPENAKRKQRPTVHP-SEWTSNICQMLERNL----VQLCSES--GEQPSVEEDWDYLFTLLLALYDSDVADHWEVLLWLTKRAEGLWKQPSEDEAAPTQQQYSNYDNNGDEPLPTETIEETNMLNNVKFFLFYLLKFGRRFTENELIARRLLFWCCGTFRSIVLSESRVPAADNQAGNHPNNTEMQLVLEEYLETCSCPLHRSVVLSLSSMITCLILSCPSAAVWNSIPTGTDHLYLEGSPLDVIPYSTAALPMPQGPETTEIRQCLFDVENVIITRSQLAEVGWNRQAFTDVSGEEMERLIKVLDILDRQDYHSVKEHNPMEALFNRIFNDDAINVDTAILVTTLCEWAVSVHRVGIYRSVIVACLLEQLTHSFQSDPNPFQMLQQTLLDFLDTFTSNLPPYSTDQAPVDNEPMRNLVCLFAELIDREVFDHDIYVRRMIARGVF-AVECHPLATSTVTESHTATLTLSTSTHGKFQAVSNTTLLSNLPNNVTTQCSVASEMSEDNDRCSV-DNPDSVRSEAGFPSVTTSCCGYVTSAPHHPASESLTGPARCSPHFHYLTHFPLPQDESYSHEENQRYQLLYGSLRARDRARSRIRQLVRDIVKIFTRKFYLIDVVHGEMCKRKKSKDREREVSTAPVANMPSSSGHRVVAVTTTGGGSGGASDDAHLIDKLHEDIMSRFICLSYHDMECVISQCTPTFTKVLSGCNGQGNPTVIGDDYHSGSTLGMANPPSPPNNAGVLAN-LTNQSPIYMPVPNSIFLFFELIETSLNITSLIATIVDTLERLQTLFE--SRTPFMT------LYMSSVCLRSIGILQRHQPVLFTMSDLPNRLFPALIAQVRQVREPTQCGPFERCVLAYLNDLFTSNAQIKSHFASIYNKAHPKVAALFRSVEPSEGLATFDQDYASDLLKAAGSDYPSLFRAY-------ADDLRNNPNSRFSFVCRAIIFVCQATTLERVNYLCGLCAELTSHCGDLTPEWLGALYAVIAPRPYRHGYGPIV----SAVEPGDMNMYDSVSSLIGTLLFRRCMTISDFLCRVICPAMAQGLVQP--VGPQLEPSIRLACHILHRLFTAESSASTIQANMSALTPGHEPPTSAMATANTTSTSATDLSTPPFRISEPLLLTGALQKVTPELLVDVLKMLMVHNDKACSEDQVQSGMHVADDATEGSDSDVGQADDEVHDEEHSHRRLTGGKAIHPIVRRFLESGILPTVIELRNLPLIGLIQLVLREICSVPWVRERFFRMPSDRWTRENVLIDRKFSPTQARRLLHVIFHPFDITWSDTSS---LATSMCQVLSSLDLWTLRCALVKFQLLYTQIRLSQQKDVLDSVGQAIVRGFQTQALNWLKANGSGMSADVCLAPIGGISRFELEENDPV--------WLVPALIAKLP-RQLKAQIVTGALEILQGIKHFWKHKNDEDKEGELLKHSIVLAHPAFFRLLQVCMAEIDP----IDKLYEQVGYFVENAHDTEDRVPDNLRTRQVVQECLRLRLTLVGQCFKALQKEHELTTDWSLLLTKLISHGVIEPESN-TTLFYMVYDMLQSLVHTMAARSGVEGKHYQNLAKKIRRELSRRPSY-GIEQIR-LLLPPLKAACTVIVTG-----HNAQRLSASGSSGTSEGGGPGSGANKSGGIGKVSTSKGAGKGGGSSHHGGPRDNTFRRPGKKRGFTIIGKERLAPWDLQDPSKQAILLSMHGATSIEAIPSRTEEQANRLIRHDHFIRLRRPPEFYLTPVYPEEEDAKVQD-KRSDATEQPTLGPPPS 1896          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Match: A0A4S2MCS9 (Med12 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002356 PE=4 SV=1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 624/1977 (31.56%), Postives = 935/1977 (47.29%), Query Frame = 2
Query:   29 MSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLT---DLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSE-FEYLMRLMVAMYDEDLLDHTEVLQWLVSTNE----QCSDDEQM------------------------------MKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLL-----------TNNKHPDRS----ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNL--NGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVV---SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNI-HQNQSH----QSIQNCLVEFLDTKS----PIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPI-----------------GGFLSVAHNXX------------XXXHRKSPELDRMSTGDNPDSVRSE---------CSGLNQILP----SIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEK-SRKKSRRDPREESM--------------------------------LIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSL-------------------------------NIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMK--KLENVFRNIKPDK-----DRSSSIDYVESVGMD---LFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTAN------------------------------SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYF------DLTENNQVSFGPPFRRSIDTEESF--------IHMKIWNF----------TLR----------VLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQ--QANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETE-KMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQ-MIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQ-------------YRLTTAEKSG---------------------------------KQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTS--FPEILPEDIKDPSISDPMEIINSSGPPS 5056
            MS + SLE   LK  K+++          PPDVY Q  +QKEDL++E  VR+G+ Y KPV +E++S +          FLT    L  F   V+ K ++ +  QD  K+  + + + + +  +P ++K++     W  +L+ + P  +++ +R+PY   K+++L E+  ++VPI+RA+W I +  +H   Q E+ K+K R  V   S+W  +  + L   L       M+   +   + +V E ++YL  L++A+YD D+ DH EVL WL    E    Q S+DE                                +KF+L +LL FG RF E+E++ R+LL   C +  +++            +  HP+ +    + + Y E  SC  HR V+  LS +I  L L CP A V+N+I     +L   GSPLD++P + +ALP P G E    R  +  +E  I+ RS   E  W  ++F     +    LIKV+++LDR DY+  K+ +  E L   +    ++  + ++L+  LCEW+VS  R G +R  LVA +++ + H  QS     Q +Q  L++FLDT +    P    Q   D+EP RNLVCLF ELI+RE+F  + Y+  MIARG F +V   PL                    G F +V++ +             S +   S + DR S  DNPDSVRSE         C G     P    S P+      + H  YL HFP+P ++ Y HE N R Q LY + R RD  +  +R+L +DI K++T++ Y+ D++  E   RKKS+   RE S                                 LI+KL E I SRF CL+Y+DMECV+SQC PT    L                               N   +LAN L + S +++P P  I     LIE S N + LI  I +    L  L E  SR   +T       YMS   +  IG L + Q VL TM D   R+F  +    R        G   RC  A +   F S A ++S    + N    K+  +FR+++P +     D+  + D + + G D   LF++          +L+ N N RFS V   ++ V Q T ++++  +  +  E  S+   L+ EW+ A+Y+++ P     GY   V    S +   D+  Y+++S+LI T+L R+C   SDFL RVIC A+AQG+ Q   V P + P+ RLA +IL RLFT E   ST                                S   F+  +  LL+ +LQKVT ELLVD+LKML VH+DK   +DQ         D TE +    G     + D E S         IH  +  F           LR          VLREIC V WVR RF +    R  R+NVLID+  S +QAR LL++I HP D  W  + +   +   M +  ++L++W+L    +K QLL TQI   ++KDV+++V + I+  F+ QA    +AN   +  D            +     P         +L+P+LI KLP    K Q++  A E L+  KHF  HKN +DKE +L K S++L +P F  LL VC+A+ D     +  L +Q+ Y+++NA +TE ++PD+LR + ++   ++ RL LVG  F  +Q+  EL  DW LLL+KLI +GV+E  S+ + LFY V DM+ +L+HT+ +      K +Q + KK+R+E+  + +Y G+E I+  LLP  K    VIVT      H +Q+                + A KSG                                 K+G  +  KER+ PW++ +  K    LS   A S +      EE AN +I HDH  +L RP  +Y +  +PE     ++D   SD  E      PPS
Sbjct:    1 MSAFPSLENRSLK--KKSDC---------PPDVYNQRDEQKEDLMSEDFVRDGYKYIKPVRDEYDSCRK------ESKFLTVNDSLWKFYHDVLAKKYDCSTYQDLKKK--SSSNIRETI--VPVVDKNQ--ANAWFRELAGSTPL-QILGRRVPYSKDKQEILSELVAHKVPISRAVWLINLILLHTPAQPENAKRKQRPTVHP-SEWTSNICQMLERNL-------MQLCSESGEQPSVEEDWDYLFTLLLALYDSDVADHWEVLLWLAKRAEGLWKQPSEDEAPPTQQQYSNYDNSSDDPLPSETVEETNMLNNVKFFLFYLLKFGRRFTENELIARRLLFWCCGTFRIIVLSESRVPAADNQSGNHPNNTGMQLVLEEYLETCSCPLHRNVVLSLSSMITCLILSCPSAAVWNSIPTGTDHLYLEGSPLDVIPYSTAALPMPQGPETTEIRQCLFDVENVIITRSQLAEVGWNRQAFTDVSGEEMERLIKVLDILDRQDYHSVKEHNPTEALFNRIFNDDAINVDTAILVTTLCEWAVSVHRVGIYRSVLVACLLEQLTHSFQSDPNPFQMLQQTLLDFLDTFTSNLPPYTTDQAPVDNEPMRNLVCLFAELIDREVFDHDIYVRRMIARGAF-AVECHPLATSAVTESHTATLTLSTSTHGKFQAVSNTTLLTNLPNNVTTQCSVASEMSEDNDRCSV-DNPDSVRSEAGFPSVTTSCCGYAASAPHHPASEPLTGPARCSPHFHYLTHFPLPQDESYSHEENQRYQLLYGSLRARDRARSRIRQLVRDIVKIFTRKFYLIDVVHGEMCKRKKSKDRERELSTAPVANMPSSSGHRVVAVTTTGGGSGGASDDAHLIDKLHEDIMSRFICLSYHDMECVISQCTPTFTKVLSGCNGQGNPTAIGDEYHSGSTLGMANPPSPPNNAGVLAN-LTNQSPIYMPVPNSIFLFFELIETSLNITSLIATIVDTLERLQTLFE--SRTPFMT------LYMSSVCLRSIGILQRHQPVLFTMGDLPNRLFPALIAQVRQVREPTQCGPFERCVLAYLNDLFTSNAQIKSHFASIYNKAHPKVAALFRSVEPSEGLATFDQDYASDLLRAAGSDYPSLFRVY-------ADDLRNNPNSRFSFVCRAIIFVCQATTLERVNYLCGLCAELTSHCGDLTPEWLGALYAVIAPRPYRHGYGPIV----SAVEPGDMNMYDSVSSLIGTLLFRRCMTISDFLCRVICPAMAQGLVQP--VGPQLEPSIRLACHILHRLFTAESSASTLQTNTNALTPGHEPPASAIATANTTSTSATDLSTPPFRISEPLLLTGALQKVTPELLVDVLKMLMVHNDKACSEDQVQSGMHVADDATEGSDSDVGQVDDEAHDEEHSHRRLTVGKAIHPIVRRFLESGILPTVIELRNLPLIGLIQLVLREICSVPWVRERFFRMPSDRWTRENVLIDRKFSPTQARRLLHVIFHPFDLTWSDTSS---LAAAMCQVLSSLDLWTLRCALVKFQLLYTQIRLSQQKDVLDSVGQAIVRGFQTQALNWLKANGSGMSADVCLAPIGGISRFELEENDPV--------WLVPALIAKLP-RQLKAQIVTGALEILQGIKHFWKHKNDEDKEGELLKHSIVLAHPAFFRLLQVCMAEIDP----IDKLYEQVGYFVENAHDTEDRVPDNLRTRQVVQECLRLRLTLVGQCFKALQKEHELTTDWSLLLTKLISHGVIEPESN-TTLFYMVYDMLQSLVHTMAARSGVEGKHYQNLAKKIRRELSKRPSY-GIEQIR-LLLPPLKAACTVIVTG-----HNAQRLSASGSSGTSESGGPGSGANKSGGIGKVSTSKGAGKGGGSSHHGGPRDSGFRRPGKKRGFTIIGKERLAPWDLQDPSKQAILLSMHGATSIEAIPSRTEEQANRLIRHDHFIRLRRPPEFYLAPVYPEEEDAKVQD-KRSDATEQPTLGPPPS 1896          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Match: A0A1S8X198 (Transcription mediator subunit Med12 (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03838 PE=4 SV=1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 623/1976 (31.53%), Postives = 938/1976 (47.47%), Query Frame = 2
Query:   29 MSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLT---DLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNE----QCSDDEQM------------------------------MKFYLPFLLYFGDRFKESEILTRKLLHGLCNSV-NLLLTNNK----------HPDRS----ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHN--LNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVV---SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNI-HQNQSH----QSIQNCLVEFLDTKS----PIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPI-----------------GGFLSVAHNXX------------XXXHRKSPELDRMSTGDNPDSVRSE---------CSGLNQILPSIP----IVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEK-SRKKSRRDPRE--------------------------------ESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSL-------------------------------NIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMK--KLENVFRNIKPDK-----DRSSSIDYVESVGMD---LFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNST--AN----------------------------SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQD--QDYF----DLTENNQVSFGPPFRRSIDTEESF--------IHMKIWNF----------TLR----------VLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQ--QANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETE-KMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQ-MIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQY---------------------------------------------RLTTAEKSGKQ-GCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTS--FPEILPEDIKDPSISDPMEIINSSGPPS 5056
            MS + SLE   LK  K+++          PPDVY Q  +QKEDL++E  VR+G+ Y KPV +E++S +          FLT    L  F   V+ K ++ +  QD  K+    A+  ++   +P ++K++     W  +L+ + P  +++ +R+PY   K+++L E+  ++VPI+RA+W I +  +H   Q E+ K+K R  V   S+W  +  + L   L    ++L   +   E      +++YL  L++A+YD D+ DH EVL WL    E    Q S+DE                                +KF+L +LL FG RF E+E++ R+LL   C +  +++L+ ++          HP+      I + Y E  SC  HR+V+  LS +I  L L CP A V+N+I     +  L GSPLD++P + +ALP P G E    R  +  +E  I+ RS   E  W  ++F     +    LIKV+++LDR DY+  K+ +  E L   +    ++  + ++L+  LCEW+VS  R G +R  +VA +++ + H  +S     Q +Q  L++FLDT S    P    +   D+EP RNLVCLF ELI+RE+F  + Y+  MIARG+F +V   PL                    G F +V++ +             S +   S + DR S  DNPDSVRSE         C G     P  P    +      + H  YL HFP+P ++ Y HE N R Q LY + R RD  +  +R+L +DI K++T++ Y+ D++  E   RKKS+   RE                                ++ LI+KL E I SRF CL+Y+DMECV+SQC PT    L                               N   I+AN L S S +++P P  I     LIE S N + LI  I +    L  L E  SR   +T       YMS   +  IG L + Q VL TMSD   R+F  +    R        G   RC  A +   F S A ++S    + N    K+  +FR+++P +     D+  + D +++ G D   LF+           +L+ N N RFS V   ++ V Q T ++++  +  +  E  S+   L+ EW+ A+Y+++ P     GY   V    S++   D+  Y+++S+LI T+L R+C   SDFL RVIC A+AQG+ Q   V P + P+ RLA +IL RLFT E   ST  AN                            S   F+  +  LL+ +LQKVT ELLVD+LKML VH+DK   +D  Q       D TE +    G     + D E S         IH  +  F           LR          VLREIC V WVR RF +    R  R+NVLID+  S +QAR LL++I HP D  W  + +   +   M +  ++L++W+L    +K QLL TQI   ++KDV+++V + I+  F+ QA    +AN   +  D            +     P         +L+P+LI KLP    K Q++  A E L+  KHF  HKN +DKE +L K S++L +P F  LL VC+A+ D     +  L +Q+ Y+++NA +TE ++PD+LR + ++   ++ RL LVG  F  +Q+  E   DW LLL+KLI +GV+E  S+ + LFY V DM+ +L+HT+ +      K +Q + KK+R+E+  + +Y G+E I+  LLP  K    VIVT      H +Q+                                              R +   + GK+ G  +  KER+ PW++ +  K    LS   A S +      EE AN +I HDH  +L RP  +Y +  +PE      +D   SD  E      PPS
Sbjct:    1 MSAFPSLENRSLK--KKSDC---------PPDVYNQRDEQKEDLMSEDFVRDGYKYIKPVRDEYDSCRK------ESKFLTVNDSLWKFYHDVLAKKYDCSTYQDLKKKS---ASNVRET-IVPVVDKNQ--ANAWFRELAGSTPL-QILGRRVPYSKDKQEILSELVAHKVPISRAVWLINLILLHTPAQPENAKRKQRPTVHP-SEWTSNICQMLERNL----VQLCSES--GEQPSVEEDWDYLFTLLLALYDSDVADHWEVLLWLTKRAESLWKQPSEDEAAPTQQQYSNYDNNSDEPLPTETIEETNVLNNVKFFLFYLLKFGRRFTENELIARRLLFWCCGTFRSIVLSESRVPAADNQAGNHPNNPEMQLILEEYLETCSCPLHRSVVLSLSSMITCLILSCPSAAVWNSIPTGTDHSYLEGSPLDVIPYSTAALPMPRGPETTEIRQCLFDVENVIITRSQLAEVGWNRQAFTDVSGEEMERLIKVLDILDRQDYHSVKEHNPMEALFNRIFNDDAINVDTAILVTTLCEWAVSVHRVGIYRSVIVACLLEQLTHSFESDPNPFQMLQQTLLDFLDTFSSSLPPYSTDRALVDNEPMRNLVCLFAELIDREVFDHDIYVRRMIARGVF-AVECHPLAASAVTESHTATLTFSTSTHGKFQAVSNTTLLSNLPNNVTTQCSVASEMSEDNDRCSV-DNPDSVRSEVGFPSVTTSCCGYATSAPHHPASESLTGPARCSPHFHYLTHFPLPQDESYSHEENQRYQLLYGSLRARDRARSRIRQLVRDIVKIFTRKFYLIDVVHGEMCKRKKSKDREREVSTAPVANMPSSSGHRVVAVSATGGGSGGVSDDAHLIDKLHEDIMSRFICLSYHDMECVISQCTPTFTKVLSGCNGQGNPTVIGDDYHSSSTLGMANPPSPPNNAGIVAN-LTSQSTIYMPVPNSIFLFFELIETSLNITSLIATIVDTLERLQTLFE--SRTPFMT------LYMSSVCLRSIGILQRHQPVLFTMSDLPNRLFPALIAQVRQVREPTQCGPFERCVLAYLNDLFTSNAQIKSHFASIYNKAHPKVAALFRSVEPSEGLATFDQDYASDLLKAAGSDYPSLFRAY-------ADDLRNNPNSRFSFVCRAIIFVCQATTLERVNYLCGLCAELTSHCGDLTPEWLGALYAVIAPRPYRHGYGPIV----SVVEPGDMNMYDSVSSLIGTLLFRRCMTISDFLCRVICPAMAQGLVQP--VGPQLEPSIRLACHILHRLFTAESSASTIQANMSALTPGHEPSASAIATANTTSTSATDLSTPPFRISEPLLLTGALQKVTPELLVDVLKMLMVHNDKACSEDLVQSGMHMGDDATEGSDSDVGQADDEAHDEEHSHRRFTGGKAIHPIVRRFLESGILPTVIELRNLPLIGLIQLVLREICSVPWVRERFFRMPSDRWTRENVLIDRKFSPTQARRLLHVIFHPFDLTWSDTSS---LATAMCQVLSSLDLWTLRCALVKFQLLYTQIRLSQQKDVLDSVGQAIVRGFQTQALNWLKANGSGMSADVCLAPIGGISRFELEENDPV--------WLVPALIAKLP-RQLKAQIVTGALEILQGIKHFWKHKNDEDKEGELLKHSIVLAHPAFFRLLQVCMAEIDP----VDKLYEQVGYFVENAHDTEDRVPDNLRTRQVVQECLRLRLTLVGQCFKALQKEHEPTTDWSLLLTKLISHGVIEPESN-TTLFYMVYDMLQSLVHTMAARSGVEGKHYQNLAKKIRRELSRRPSY-GIEQIR-LLLPPLKAACTVIVTG-----HNAQRLSASGSSGTSDGGGSGSGANKSGGIGKVSTSKGAGKGGGSGHHGGPRDSAFRRPGKKRGFTIIGKERLAPWDLQDPSKQAILLSMHGATSIEAIPSRTEEQANRLIRHDHFIRLRRPPEFYLTPVYPEEEDAKAQD-KRSDATEQPTLGPPPS 1896          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Match: A0A074Z6U9 (Med12 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10348 PE=4 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 625/1996 (31.31%), Postives = 940/1996 (47.09%), Query Frame = 2
Query:   11 YLN------FISMSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVVEEHESAKDIGFEFISKPFLT---DLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNE----QCSDDEQM------------------------------MKFYLPFLLYFGDRFKESEILTRKLLHGLCNSV-NLLLTNNK----------HPDRS----ITDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHN--LNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVV---SLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNI-HQNQSH----QSIQNCLVEFLDTKS----PIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPI-----------------GGFLSVAHNXX------------XXXHRKSPELDRMSTGDNPDSVRSE---------CSGLNQILPSIP----IVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEK-SRKKSRRDPRE--------------------------------ESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSL-------------------------------NIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMNMK--KLENVFRNIKPDK-----DRSSSIDYVESVGMD---LFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGN--------ASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNST--AN----------------------------SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQD--QDYF----DLTENNQVSFGPPFRRSIDTEESF--------IHMKIWNF----------TLR----------VLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQ--QANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETE-KMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQ-MIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQY---------------------------------------------RLTTAEKSGKQ-GCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTS--FPEILPEDIKDPSISDPMEIINSSGPPS 5056
            YLN      +  MS + SLE   LK  K+++          PPDVY Q  +QKEDL++E  VR+G+ Y KPV +E++S +          FLT    L  F   V+ K ++ +  QD  K+    A+  ++   +P ++K++     W  +L+ + P  +++ +R+PY   K+++L E+  ++VPI+RA+W I +  +H   Q E+ K+K R  V   S+W  +  + L   L    ++L   +   E      +++YL  L++A+YD D+ DH EVL WL    E    Q S+DE                                +KF+L +LL FG RF E+E++ R+LL   C +  +++L+ ++          HP+      I + Y E  SC  HR+V+  LS +I  L L CP A V+N+I     +  L GSPLD++P + +ALP P G E    R  +  +E  I+ RS   E  W  ++F     +    LIKV+++LDR DY+  K+ +  E L   +    ++  + ++L+  LCEW+VS  R G +R  +VA +++ + H  +S     Q +Q  L++FLDT S    P    +   D+EP RNLVCLF ELI+RE+F  + Y+  MIARG+F +V   PL                    G F +V++ +             S +   S + DR S  DNPDSVRSE         C G     P  P    +      + H  YL HFP+P ++ Y HE N R Q LY + R RD  +  +R+L +DI K++T++ Y+ D++  E   RKKS+   RE                                ++ LI+KL E I SRF CL+Y+DMECV+SQC PT    L                               N   I+AN L S S +++P P  I     LIE S N + LI  I +    L  L E  SR   +T       YMS   +  IG L + Q VL TMSD   R+F  +    R        G   RC  A +   F S A ++S    + N    K+  +FR+++P +     D+  + D +++ G D   LF+           +L+ N N RFS V   ++ V Q T ++++  +  +  E  S+   L+ EW+ A+Y+++ P          A   Y        S +   D+  Y+++S+LI T+L R+C   SDFL RVIC A+AQG+ Q   V P + P+ RLA +IL RLFT E   ST  AN                            S   F+  +  LL+ +LQKVT ELLVD+LKML VH+DK   +D  Q       D TE +    G     + D E S         IH  +  F           LR          VLREIC V WVR RF +    R  R+NVLID+  S +QAR LL++I HP D  W  + +   +   M +  ++L++W+L    +K QLL TQI   ++KDV+++V + I+  F+ QA    +AN   +  D            +     P         +L+P+LI KLP    K Q++  A E L+  KHF  HKN +DKE +L K S++L +P F  LL VC+A+ D     +  L +Q+ Y+++NA +TE ++PD+LR + ++   ++ RL LVG  F  +Q+  E   DW LLL+KLI +GV+E  S+ + LFY V DM+ +L+HT+ +      K +Q + KK+R+E+  + +Y G+E I+  LLP  K    VIVT      H +Q+                                              R +   + GK+ G  +  KER+ PW++ +  K    LS   A S +      EE AN +I HDH  +L RP  +Y +  +PE      +D   SD  E      PPS
Sbjct:    8 YLNSSPRPIYREMSAFPSLENRSLK--KKSDC---------PPDVYNQRDEQKEDLMSEDFVRDGYKYIKPVRDEYDSCRK------ESKFLTVNDSLWKFYHDVLAKKYDCSTYQDLKKKS---ASNVRE-TIVPVVDKNQ--ANAWFRELAGSTPL-QILGRRVPYSKDKQEILSELVAHKVPISRAVWLINLILLHTPAQPENAKRKQRPTVHP-SEWTSNICQMLERNL----VQLCSES--GEQPSVEEDWDYLFTLLLALYDSDVADHWEVLLWLTKRAESLWKQPSEDEAAPTQQQYSNYDNNSDEPLPTETIEETNVLNNVKFFLFYLLKFGRRFTENELIARRLLFWCCGTFRSIVLSESRVPAADNQAGNHPNNPEMQLILEEYLETCSCPLHRSVVLSLSSMITCLILSCPSAAVWNSIPTGTDHSYLEGSPLDVIPYSTAALPMPRGPETTEIRQCLFDVENVIITRSQLAEVGWNRQAFTDVSGEEMERLIKVLDILDRQDYHSVKEHNPMEALFNRIFNDDAINVDTAILVTTLCEWAVSVHRVGIYRSVIVACLLEQLTHSFESDPNPFQMLQQTLLDFLDTFSSSLPPYSTDRALVDNEPMRNLVCLFAELIDREVFDHDIYVRRMIARGVF-AVECHPLAASAVTESHTATLTFSTSTHGKFQAVSNTTLLSNLPNNVTTQCSVASEMSEDNDRCSV-DNPDSVRSEVGFPSVTTSCCGYATSAPHHPASESLTGPARCSPHFHYLTHFPLPQDESYSHEENQRYQLLYGSLRARDRARSRIRQLVRDIVKIFTRKFYLIDVVHGEMCKRKKSKDREREVSTAPVANMPSSSGHRVVAVSATGGGSGGVSDDAHLIDKLHEDIMSRFICLSYHDMECVISQCTPTFTKVLSGCNGQGNPTVIGDDYHSSSTLGMANPPSPPNNAGIVAN-LTSQSTIYMPVPNSIFLFFELIETSLNITSLIATIVDTLERLQTLFE--SRTPFMT------LYMSSVCLRSIGILQRHQPVLFTMSDLPNRLFPALIAQVRQVREPTQCGPFERCVLAYLNDLFTSNAQIKSHFASIYNKAHPKVAALFRSVEPSEGLATFDQDYASDLLKAAGSDYPSLFRAY-------ADDLRNNPNSRFSFVCRAIIFVCQATTLERVNYLCGLCAELTSHCGDLTPEWLGALYAVIAPRPYDMAVLIIAPRPYRHGYGPIVSDVEPGDMNMYDSVSSLIGTLLFRRCMTISDFLCRVICPAMAQGLVQP--VGPQLEPSIRLACHILHRLFTAESSASTIQANMSALTPGHEPSASAIATANTTSTSATDLSTPPFRISEPLLLTGALQKVTPELLVDVLKMLMVHNDKACSEDLVQSGMHMGDDATEGSDSDVGQADDEAHDEEHSHRRFTGGKAIHPIVRRFLESGILPTVIELRNLPLIGLIQLVLREICSVPWVRERFFRMPSDRWTRENVLIDRKFSPTQARRLLHVIFHPFDLTWSDTSS---LATAMCQVLSSLDLWTLRCALVKFQLLYTQIRLSQQKDVLDSVGQAIVRGFQTQALNWLKANGSGMSADVCLAPIGGISRFELEENDPV--------WLVPALIAKLP-RQLKAQIVTGALEILQGIKHFWKHKNDEDKEGELLKHSIVLAHPAFFRLLQVCMAEIDP----VDKLYEQVGYFVENAHDTEDRVPDNLRTRQVVQECLRLRLTLVGQCFKALQKEHEPTTDWSLLLTKLISHGVIEPESN-TTLFYMVYDMLQSLVHTMAARSGVEGKHYQNLAKKIRRELSRRPSY-GIEQIR-LLLPPLKAACTVIVTG-----HNAQRLSASGSSGTSDGGGSGSGANKSGGIGKVSTSKGAGKGGGSGHHGGPRDSAFRRPGKKRGFTIIGKERLAPWDLQDPSKQAILLSMHGATSIEAIPSRTEEQANRLIRHDHFIRLRRPPEFYLTPVYPEEEDAKAQD-KRSDATEQPTLGPPPS 1927          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Cavefish
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:566632])

HSP 1 Score: 347.051 bits (889), Expect = 6.728e-96
Identity = 397/1434 (27.68%), Postives = 635/1434 (44.28%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVN-------LLLTNNKHPDRSI--------------------------TDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK-SPELDRMSTGD-NPDSVRSECSGLNQ-----ILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN-------STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAE 3928
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F        + +++   ++I +    N   DT KRK  V    KD   +    +S+  I  W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I     K K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +N       L L+   HP  SI                          TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+V   R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++     SP +   + G  +P+    E  G +      + P+ P V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +MV    N +        R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N       S  ++V      D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFN------PSKISSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINIWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TETKVKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPATPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSLGLSTGGHPPHSISGQPGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTIGRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVCCKRSGRHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATVPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFCELIRHDVFSHNIYMCTLISRGDLASDSHLPRPRSPSDEPSDESERKEQDTGSSVKMEDTGLSEPMEIEHNSSANFDEMFSPPMHGEAKGSPSPEKAAPEQDGKSTAKEKCMDPAFPQV-YEQ-PRHIQYATHFPIPQEESASHECNQRQVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSSLAGSYTTSLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYWNIDPSDSNMLWDQVFMIDAIANPSAHNLNHSMVGKILNDSPAN-----RYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDGKSDKSTVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLDVYAKY------VLKSICQQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAE 1375          

HSP 2 Score: 124.405 bits (311), Expect = 8.637e-28
Identity = 81/222 (36.49%), Postives = 121/222 (54.50%), Query Frame = 2
Query: 4337 DDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  V  D  V   EE   L++ H H     RP +YY
Sbjct: 1443 DDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTNEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTVRVDRKVTRFEEQQRLLLYHTHVKP--RPRSYY 1656          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Cavefish
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:566632])

HSP 1 Score: 340.117 bits (871), Expect = 8.403e-94
Identity = 398/1454 (27.37%), Postives = 636/1454 (43.74%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDH-----------EYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVN-------LLLTNNKHPDRSI--------------------------TDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQE--NNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVV----ELLDRYDYNCYKDSSVFEGLCTVVVSLV---DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP---------------------------PIGGFLSVAHNXXXXXHRK--SPELDRMSTGD-NPDSVRSECSGLNQ-----ILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGY----------------------MFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRS--CPTFVMNMKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQN----STANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSD-----KGRLQDQDYFDLTENNQVSFGPPFRR-SIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAE 3928
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F        + +++   ++I +    N   DT KRK  V    KD   +    +S+  I  W   L+ T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I     K K R  +D   +W     + L E+L  +  +  R +              E E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +N       L L+   HP  SI                          TDFY     C  HR V+F LS ++ S+ L CP A+V++       N  GSPLDLLP A S LP P G    N   R  + ++E+ I +R  AVE +W   SF+   E TA   I  V    E+LD + +     S+  + L   +       D H +      ++ LLCEW+V   R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P++ ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                            +   + + HNSS++   +  SP +   + G  +P+    E  G +      + P+ P V Y    RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++                        +F     E+ +K+ R  P          AE I S+F+ L+++D   V SQ     +  +   ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + SL  SY +   +CI+  L ++ S L+   D   ++F G+ ++ ++ V+        RC  A +   + SC+ L+S     F     K++N ++ NI P       D+   ID + +        +MV    N +        R+S V N L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL F+++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N       ++V      D +LL++S   +    +  +LK + +  D      G        D+ E++  S     R  SI+T    ++ K       VL+ IC   WV  R   S    S  ++D VL+     N QA+ LL +IC+P   L  +          + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSGDEHGSAKNVNFN------PSKISSNFSSIIAEKLRCNTFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINIWFTDLAGTKPLTQLA-KKVPIFSKKEEVFGYLAKYSVPVMRSAWMIKMTCAYHAAI--TETKVKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQSPSQGCGSPLPATPAEVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDGSLGLSTGGHPPHSISGQPGNALPPTPTSQPAGGNQPQTPFTDFYI----CPQHRPVVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPIAPSNLPMPGGNSTFNQQVRAKVREIEEQIKERGQAVEFRW---SFDKCQETTAGFTIGRVLHTLEVLDNHSFEKSDFSNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVCCKRSGRHRAMVVAKLLEKRQTEIEAERCGESEVVDEKGSVSSGSLSAATVPVFQDVLLQFLDTQAPVL-TEPGNESERVEFSNLVLLFCELIRHDVFSHNIYMCTLISRGDLASDSHLPRPRSPSDEPSDESERKEQDTGSSVKMEDTGLSEPMEIEHNSSANFDEQMFSPPMHGEAKGSPSPEKAAPEQDGKSTAKEKCMDPAFPQV-YEQ-PRHIQYATHFPIPQEESASHECNQRQVVLYGVGKQRDEARHAIKKITKDILKVLNRKSTAETGTEPQNEIVSNMNVCFTLSLFLSQGGEEGQKRKRSKPEAFPT-----AEDIFSKFQHLSHFDQHQVTSQVSRNVLEQITSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSSLAGSYTTSLCLCIVAVLRRYHSCLILNPDQTAQVFDGLRIVVKSGVNPADCSSAERCILAYLYDLYTSCSHLKSKFGEIFSEFCSKVKNSIYWNIDPSDSNMLWDQVFMIDAIANPSAHNLNHSMVGKILNDSPAN-----RYSFVCNVLMDV--CVDHRDPERVNDIGILCAELTAYCRSLSAEWLGVLKALCCSSNNG------NCGFNDLLCNVDVSDLSFHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFRTPQRNPCPQDDKSTVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGDAELKGSGFSHPAGLDDIGEDDMGSKKSGGRNVSIETASLDVYAKY------VLKSICQQEWVGERCLKSLSEDSSALQDPVLV-----NIQAQRLLQLICYPHRQL-DSEEGDNPQRQRIKRILQNMDQWTMRQSSLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAE 1397          

HSP 2 Score: 124.79 bits (312), Expect = 7.906e-28
Identity = 81/222 (36.49%), Postives = 121/222 (54.50%), Query Frame = 2
Query: 4337 DDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF  V  D  V   EE   L++ H H     RP +YY
Sbjct: 1447 DDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTNEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTVRVDRKVTRFEEQQRLLLYHTHVKP--RPRSYY 1660          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002656.1 (pep scaffold:Pmarinus_7.0:GL481230:51:37267:1 gene:ENSPMAG00000002411.1 transcript:ENSPMAT00000002656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 1.460e-37
Identity = 116/449 (25.84%), Postives = 220/449 (49.00%), Query Frame = 2
Query: 3677 SNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNY----QDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFS------IPNH-----GIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            SN QA++LL +IC+P   L     +       + R   +L+ W+L    +++QL++ Q    E  +++EN++K  I +F+  AE   ++++      +          + R    E         +P  +NK    + +++       ++E      ++K +      +   + +S  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   +W +LL +++  G V++ +++ ELF TVLDMI  L  +  +      +P++     G+    +    +KE+ DK + E ++ ++  LLP  K T D+I   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF A   +      EE   L++ H H     RP  YY
Sbjct:   12 SNKQAQHLLQLICYPHG-LPDAQDSDNPQRQRIKRILQHLDQWTLRQSWLELQLMIKQCHNSEMNNLLENIAKVTIEVFQQSAESNVSKKDTFTKLPSTRPKKFVLQSTGRG--GEWCASPRVITLPGTVNKSVGKSEEKET------RMEEWGGAGSNKEWDVCVSARARCVRRSMSLLSQQPFLSLVLTCLKGQDEQRESLLTSLQNQVNQIVSNWQE-ERYQDDMKARQMMHEALQLRLNLVGGMFDTVQRSSQCTTEWAVLLLQIVSTGTVDVQTNN-ELFTTVLDMIGVLRMSSCAADMPRLVPHYQAWPEGLYLSMLCYSRQKELGDKRS-ESIDKLRQ-LLPLPKQTVDIITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDMFEGQKNPAPLSWAWFGAARVERRAPRYEEQHRLLLYHTHAHP--RPLAYY 445          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002660.1 (pep scaffold:Pmarinus_7.0:GL481230:54:36427:1 gene:ENSPMAG00000002411.1 transcript:ENSPMAT00000002660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 3.352e-36
Identity = 121/461 (26.25%), Postives = 221/461 (47.94%), Query Frame = 2
Query: 3677 SNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPE-------EERKDVIENVSKDIINLFKNQAE--QQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLP---FDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNH-------GIKFFQMI--------KKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            SN QA++LL +IC+P   L     +       + R   +L+ W+L    +++QL++ Q          +E  +++EN++K  I +F+  AE    +N   L    +           S   +   +      +L    +  LP   +   KR+   +  E   +G +         +   + +S  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   +W +LL +++  G V++ +++ ELF TVLDMI  L+  L +IP +       G+ + + +         + +KE+ DK + E ++ ++  LLP  K T D+I   P+     ++  ++   +    KQG  V  K++++PW++ EG KN   LS  WF A   +      EE   L++ H H     RP  YY
Sbjct:   11 SNKQAQHLLQLICYPHG-LPDAQDSDNPQRQRIKRILQHLDQWTLRQSWLELQLMIKQCHNSVSSQRVQEMNNLLENIAKVTIEVFQQSAEMNSSSNLMSLGLLGHGGGGPGTGVGSSDAAQNAAAAAKKKPFLSSPRVITLPGGVWGKAKRKKHTSMEEWGGAGSNKEWDVCVSARARCVRRSMSLLSQQPFLSLVLTCLKGQDEQRESLLTSLQNQVNQIVSNWQE-ERYQDDMKARQMMHEALQLRLNLVGGMFDTVQRSSQCTTEWAVLLLQIVSTGTVDVQTNN-ELFTTVLDMIGVLLKNLKTIPKYLPFVQRGGVHYSRHMYSRSTGIDAEKKKELGDKRS-ESIDKLRQ-LLPLPKQTVDIITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDMFEGQKNPAPLSWAWFGAARVERRAPRYEEQHRLLLYHTHAHP--RPLAYY 464          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002662.1 (pep scaffold:Pmarinus_7.0:GL481230:54:36427:1 gene:ENSPMAG00000002411.1 transcript:ENSPMAT00000002662.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 4.861e-36
Identity = 120/461 (26.03%), Postives = 221/461 (47.94%), Query Frame = 2
Query: 3677 SNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPE-------EERKDVIENVSKDIINLFKNQAE--QQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLP---FDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNH-------GIKFFQMI--------KKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEK-SGKQGCAVQRKERINPWEVIEGIKN--LFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            SN QA++LL +IC+P   L     +       + R   +L+ W+L    +++QL++ Q          +E  +++EN++K  I +F+  AE    +N   L    +           S   +   +      +L    +  LP   +   KR+   +  E   +G +         +   + +S  +L+  PF+SL++ CL  +D+ R   L SL +Q+   + N +E E+  DD++ + ++H +++ RL LVG +FD +Q S +   +W +LL +++  G V++ +++ ELF TVLDMI  L+  L +IP +       G+ + + +         + +KE+ DK + E ++ ++  LLP  K T D+I   P+     ++  ++   +    KQG  V  K++++PW++ EG KN    S +WF A   +      EE   L++ H H     RP  YY
Sbjct:   11 SNKQAQHLLQLICYPHG-LPDAQDSDNPQRQRIKRILQHLDQWTLRQSWLELQLMIKQCHNSVSSQRVQEMNNLLENIAKVTIEVFQQSAEMNSSSNLMSLGLLGHGGGGPGTGVGSSDAAQNAAAAAKKKPFLSSPRVITLPGGVWGKAKRKKHTSMEEWGGAGSNKEWDVCVSARARCVRRSMSLLSQQPFLSLVLTCLKGQDEQRESLLTSLQNQVNQIVSNWQE-ERYQDDMKARQMMHEALQLRLNLVGGMFDTVQRSSQCTTEWAVLLLQIVSTGTVDVQTNN-ELFTTVLDMIGVLLKNLKTIPKYLPFVQRGGVHYSRHMYSRSTGIDAEKKKELGDKRS-ESIDKLRQ-LLPLPKQTVDIITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDMFEGQKNPAPLSWAWFGAARVERRAPRYEEQHRLLLYHTHAHP--RPLAYY 464          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Nematostella
Match: EDO45183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC1])

HSP 1 Score: 86.2705 bits (212), Expect = 1.456e-16
Identity = 63/227 (27.75%), Postives = 107/227 (47.14%), Query Frame = 2
Query: 4325 EKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHS--DHSELFYTVLDMISTLIHTL-----FSIP---NHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFK-NTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKN--LFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            E+ P DL+ K ++  ++  R++LVG +FD IQ S  L  DW  +L +L+  G +   S     EL   VLDM+  LI  +      S P           + KKL++E+  K   + ++  +   LP    N Y V            +    T+  ++  QG  +  K++I+ WE++EG KN   F+ +WF AV  +   L  E+    ++ H+H  +  +P +Y+
Sbjct: 1117 ERCPADLKSKEVLQEALHLRISLVGAMFDTIQRSVALSSDWASVLFQLVSSGTITTESLPSKKELLTNVLDMVCVLISVVTNTDGLSGPAAEESRKAAGALFKKLKRELAGKSPMDIIQCKQLLPLPSLSHNVYTV------------EPSTETSPAQTDMQGLQINGKQKISAWELMEGQKNPSPFAWAWFGAVRIERKPLRYEQEFRKLMHHNHARR--KPASYF 1329          

HSP 2 Score: 61.2326 bits (147), Expect = 5.035e-9
Identity = 54/214 (25.23%), Postives = 92/214 (42.99%), Query Frame = 2
Query: 3302 MEQQNSTANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGR----------------------LQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDII---------DTMNRTFTNLNIWSLHFDQMKIQLLLTQ 3850
            M   +S+A+  S     D NLL+++ + +  + ++ +LK +   S+ GR                       +  D+ D + +    F PP   S    E+        FTL+V   IC   WVR R   +   +L    +L+D  ++ SQAR LL++IC+P      TS     I+         +  +R   NL+ WSL    +++QL++ Q
Sbjct:   34 MSHDHSSASKYSFKSSPDHNLLAAAHEHIVVDAVLAVLKAMLKLSEAGRNNGLGSHGTESSRDDGFRTWFSAKLDDFMDSSGSTGDIFPPPLASSRSAMETSNTSAFAGFTLQV---ICSQEWVRERCLHDL-EKLCSPELLLDPALTVSQARKLLHLICYPAGV--PTSLGGPSILPGGETETVKEAASRILQNLDQWSLRKSWLELQLMIKQ 241          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Nematostella
Match: EDO45182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB9])

HSP 1 Score: 85.1149 bits (209), Expect = 2.397e-16
Identity = 82/347 (23.63%), Postives = 143/347 (41.21%), Query Frame = 2
Query: 1022 EYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNI---------------KIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKL---EQFILQRSLAVENQWKHESFECSIEQTAAGLIKV------VELLDRYDY------NC--------YKDSS----------VFEGLCTVVVSLVD-------------NHSL------------LLMLLCEWSVSTMRTGTHRPFLVAQIIDNIHQN-----------------QSHQSI-----QNCLVEFLDTKSPIIDSQISADSEP-FRNLVCLFGELIERELFSMNDYMSYMIARGLFE--SVANLPLPP 1768
            +Y +CS H +++  L  +I ++++ CP A+V+N+                +     L      L     +      G  N +N++ +  L   E+ +  R LAVE++W  + ++         +I V      +E+LD+YD+      NC        +  +S          VF  L  +   L++             N SL            + +LLCEW++S  R G HR F+VA+++     +                   H  I     Q  L+EFLD  +P+++S   +  +P F  LV LF EL+  ++FS N Y+  +I+RG  +     ++P PP
Sbjct:   80 QYKNCSQHNSLVLALGAIIQAVTICCPGALVWNSTVCSSGQSSSSNNSGDQTKPQVLGSPLDRLPMAPSALPMPGGGNNNPINQEVMLSLLASEESVKTRGLAVESRWSPDKYQDKTSAVCFSVIAVNRVLTTLEILDKYDFTRADNTNCIDLLYAKIFTSASKGNREVNITCVFWYLKLLPPHLINMLESSSSVSSSNINFSLRITSWLTSTDEAIALLLCEWAISKHRVGKHRAFVVAKLLQRRQSDLLNKKDDSTSGGEESNSSRHNPIATPVCQKVLLEFLDNYAPVVESYQHSKGDPSFAQLVLLFVELVRHDVFSHNAYLCTLISRGDLQPTPAVSIPSPP 426          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Nematostella
Match: EDO25821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVD8])

HSP 1 Score: 50.0618 bits (118), Expect = 1.848e-6
Identity = 40/164 (24.39%), Postives = 73/164 (44.51%), Query Frame = 2
Query: 4508 ELFYTVLDMISTLIHTLFSIPNHGIKFFQ--------MIKKLRKEICDKLNYEGVELIKPFLLPCFK-NTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKN--LFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            EL   VLDM+  LI  + +         +        + KKL++E+  K   + ++  +   LP    N Y V  +              T+  ++  QG  +  K++I+ WE++EG KN   F+ +WF AV  +   L  E+    ++ H+H  +  +P +Y+
Sbjct:    1 ELLTNVLDMVCVLISVVTNTDGLSGPAAEESRKAAGALFKKLKRELAGKSPMDIIQCKQLLPLPSLSHNVYTVEPSTE------------TSPAQTDMQGLQINGKQKISAWELMEGQKNPSPFAWAWFGAVRIERKPLRYEQEFRKLMHHNHARR--KPASYF 150          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Medaka
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:101155359])

HSP 1 Score: 479.559 bits (1233), Expect = 6.577e-138
Identity = 495/1787 (27.70%), Postives = 818/1787 (45.78%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRN-----------TIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQC--SDDEQMMKFYLPFLLYFGDRFKESEILTRKLLHGLCNSVNLLLTNNK-------HPDRSI--------------------------TDFYAEYSSCSTHRTVMFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKL---EQFILQRSLAVENQWKHESFECSIEQTAAGLI-KVVELLDRYDYNCYKDSSVFEGLCTVVVSLV------DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLP------------------------PIGGFLSVAHNXXXXXHRK-SPELDRMSTG------DNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMN--MKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLF----------SIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT KRK  V    KD   +    +S+  I  W   L  T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I     K K R  +D   +W     + L E+L  +  +  R                + E  + ++EY  +L + M+ + +LD  E L W++   E+    +DE +       L Y G+ F +S  L+R+L +     +NLLL++         HP  SI                          TDFY     C  HR ++F LS ++ S+ L CP A+V++       N  GSPLDLLP A S+LP P G      +   AKL   E+ I +R  AVE +W   SF+   E TA   I +V+  L+  D + ++ S     L ++   +       D H +      ++ LLCEW+V   R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P + ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P                         +   + + HNSS++     SP +   S G      + PD           + P+ P     +  RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++       +  + RK+S+ +           AE + S+F+ L+++D   V SQ     +  +N  ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + SL+ SY +   +CI+  L ++ + L+   +   ++F G+ ++ +  V+        RC  A +   + SC+ L++    +++    K++N ++ NI P       D    ++ + +     F  ++V    N +        R+S VVN L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL  +++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK + +  D   L+          + +S     RR++  E + + +    +   VL+ IC   WV  R   S    S  ++D VL      N QA+ LL +IC+P   L  +       +  + R   N++ W++    +++QL++ Q    E   ++EN++K  I +F+  AE  ++         +       +S + + KP   S E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+             S+  +   +  ++KKLRKE+ D+ + E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF     D      EE    ++ H H     +P +YY
Sbjct:   20 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSSDEHGSAKNVNFN------PAKISSNFSSIIAEKLRFNSFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINSWFTDLGGTKPLTQLA-KKVPIFSKKEEVFAYLAKYSVPVMRSAWMIKMTCAYHAAI--TETKVKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQCPSQGCSSPPPATPADVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKVRPGEDELLRLLLPLLLQYSGE-FVQSAYLSRRLAYFCTRRLNLLLSDRSLVPGTVGHPGHSILTQQGNALPSTPTSQPAGGNQPQTPFTDFYI----CQQHRPLVFGLSCMLQSIVLCCPSALVWHYSLTDSRNKTGSPLDLLPFAPSSLPMP-GCNTAFTQQVRAKLREIEEQIKERGQAVEFRW---SFDKCQETTAGFTIGRVLHTLEVLDNHSFEKSDFNNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVCCKRSGRHRAMVVAKLLEKRQAEIEAERCAESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPTL-TEPGNESERVEFSNLVLLFCELIRHDVFSHNIYMCTLISRGDLASESHLPRPRSPSDDESERKEQDAGSSVKMEDTGLSESMEIEHNSSANFDEMFSPPMHCESKGSPSPEKNAPDQDSKANCKDKSMDPAFP--QLYDQPRHIQYATHFPIPQEESASHECNQRLVVLYGVGKLRDEARHTIKKITKDILKVLNRKSTAETGGEEGQKRKRSKPE-------AFPTAEDLFSKFQHLSHFDQHQVTSQVSRNVLEQINSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSSLVGSYTTSLCLCIVAVLRRYHTCLILNPEQTAQVFDGLQIVVKLVVNPADCSSAERCILAYLYDLYTSCSHLKNKFGEIISELCSKVKNSIYCNIDPSDSNMLWDPGFMLEAIANPSAHNFNHSVVGKILNDSPAN-----RYSFVVNVLMDV--CMDHRDPERVNDIGILCAELTAYCRSLSAEWLGILKALCCSSNNG------NCGFNDLLCNVDVSDLSLHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQRNPVPQDGAKSDKSMVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGD-AELRGSGLSHPAGLDDISD----RRNVSIETASLDV----YAKYVLKTICQQEWVGERCLKSLSEDSSALQDPVL-----GNIQAQRLLQLICYPHRQL-DSDEGENPQLQRIKRILQNMDQWTMRQSCLELQLMIKQSSNNELYSLLENIAKATIEVFQKSAEMNSSNPSGNGTAAHGGSASNSNSTTSKIKPILSSSERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDRQS-ESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTTRVDRKTTKFEEQHRFLLYHTHMKP--KPRSYY 1714          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Medaka
Match: med12 (mediator complex subunit 12 [Source:NCBI gene;Acc:101155359])

HSP 1 Score: 353.599 bits (906), Expect = 2.122e-98
Identity = 360/1351 (26.65%), Postives = 616/1351 (45.60%), Query Frame = 2
Query: 1226 RDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLI-KVVELLDRYDYNCYKDSSVFEGLCTVVVSLV------DNHSL------LLMLLCEWSVSTMRTGTHRPFLVAQIIDN----IHQNQSHQS---------------------IQNCLVEFLDTKSPIIDSQISADSE--PFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDS------VRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVN--GYVNRCSAAVVIQQFQSCATLRSCPTFVMN--MKKLEN-VFRNIKPDK-----DRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIV---ETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVS---NDLLFYENISTLIATMLARQCFYFSDFLGRVICVAL-----AQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKE--------DVNLLSSSLQKVTTELLVDLLKM-------LAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWV--RIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTS------KDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPT-ESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCL-AKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGI----------KFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLS--WFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYY 4966
            R  + ++E+ I +R  AVE +W   SF+   E TA   I +V+  L+  D + ++ S     L ++   +       D H +      ++ LLCEW+V   R+G HR  +VA++++     I   +  +S                      Q+ L++FLDT++P + ++   +SE   F NLV LF ELI  ++FS N YM  +I+RG   S ++LP P      S + + S    + +    +M    +P+        ++ C     + P+ P     +  RH+QY  HFPIP  +   HE N R   LY   + RD  +  ++++ KDI K+  ++    +    E+ +K+ R  P          AE + S+F+ L+++D   V SQ     +  +N  ++         +  LP    I  + +L+E S N S LI    +  LN + L+E    + L+ + SL+ SY +   +CI+  L ++ + L+   +   ++F G+ ++ +  V+        RC  A +   + SC+ L++    +++    K++N ++ NI P       D    ++ + +     F  ++V    N +        R+S VVN L+ V  C D     R+N I +   E  +    LS EW+  + +L    N           FN LL +   +DL  +++++T +A ++ARQC    D    V CVA+     A   +Q S       P  RL   IL  LF   Q+N      +   K         D +LL++S   +    +  +LK        L++H     L+          + +S     RR++  E + + +    +   VL+ IC   WV  R   S    S  ++D VL      N QA+ LL +IC+P   L      +      K I+    R     N W + F ++++QLL       E   ++EN++K  I +F+  AE  ++         +       +S + + KP   S E +  +L+  LI KLP  + +  ++ AA E+LE G+H  +  + ++++    KS  +L+  PF+SL++ CL  +D+ R   L SL  Q++  + N +E ++  DD + K ++H ++K RL LVG +FD +Q S +   +W +LL  +I  G V+M S++ ELF TVLDM+S LI+   +     I           +  ++KKLRKE+ D+   E +E ++  LLP  K T DVI   P      ++  ++   EK G Q   V  K++I+PW+V EG+K+   LS  WF     D      EE    ++ H H     +P +YY
Sbjct:  283 RAKLREIEEQIKERGQAVEFRW---SFDKCQETTAGFTIGRVLHTLEVLDNHSFEKSDFNNSLDSLYNRIFGSGQSKDGHEMSPDDDAVVTLLCEWAVCCKRSGRHRAMVVAKLLEKRQAEIEAERCAESEVVDEKGSVSSGSLSAATLPVFQDVLLQFLDTQAPTL-TEPGNESERVEFSNLVLLFCELIRHDVFSHNIYMCTLISRGDLASESHLPRP-----RSPSDDESERKEQDAGSSVKMEGSPSPEKNAPDQDSKANCKD-KSMDPAFP--QLYDQPRHIQYATHFPIPQEESASHECNQRLVVLYGVGKLRDEARHTIKKITKDILKVLNRKSTA-ETGDGEEGQKRKRSKPEAFPT-----AEDLFSKFQHLSHFDQHQVTSQVSRNVLEQINSFAL-------GMSYHLPLVQHIQFIFDLMEYSLNISGLIDFAIQL-LNELSLVE---AELLLKSSSLVGSYTTSLCLCIVAVLRRYHTCLILNPEQTAQVFDGLQIVVKLVVNPADCSSAERCILAYLYDLYTSCSHLKNKFGEIISELCSKVKNSIYCNIDPSDSNMLWDPGFMLEAIANPSAHNFNHSVVGKILNDSPAN-----RYSFVVNVLMDV--CMDHRDPERVNDIGILCAELTAYCRSLSAEWLGILKALCCSSNNGNC------GFNDLLCNVDVSDLSLHDSLATFVAILIARQCLLLEDL---VRCVAIPSLLNAACSEQDS------EPGARLTCRILLHLFKTPQRNPVPQDGAKSDKSMVGIRSSCDRHLLAASQNSIVVGAVFAVLKAVFMLGMNLSLHRQTRTLRGSGLSHPAGLDDISD----RRNVSIETASLDV----YAKYVLKTICQQEWVGERCLKSLSEDSSALQDPVL-----GNIQAQRLLQLICYPHRQLDSDEGENPQLQRIKRILQVQERGVFQPNGW-IGFIKLQLQLLRFVSGASELYSLLENIAKATIEVFQKSAEMNSSNPSGNGTAAHGGSASNSNSTTSKIKPILSSSERSGVWLVAPLIAKLP-TSVQGHVLKAAGEELEKGQHLGS-SSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVQQIVTNWRE-DQYQDDCKAKQMMHEALKLRLNLVGGMFDTVQRSTQQTTEWAVLLLDIISSGTVDMQSNN-ELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLVKKLRKELGDR-QSESLEKVRQ-LLPLPKQTRDVITCEPQGSLIDTKGNKIAGFEKEGLQ---VSTKQKISPWDVFEGLKHSAPLSWGWFGTTRVDRKTTKFEEQHRFLLYHTHMKP--KPRSYY 1557          

HSP 2 Score: 113.235 bits (282), Expect = 1.991e-24
Identity = 85/264 (32.20%), Postives = 129/264 (48.86%), Query Frame = 2
Query:  110 LGPPDVYQQEYKQKEDLLTEFNVREGFNYSKPVV--EEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIKQDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKRIPYFHKKEDVLKEIFKYQVPITRAIWFIKVS-AMHATIQAESNKKKPRSNVDSLSDWVLSFIRTLNEKLDLIRIKLMRN-----------TIDHEYEMTVSEFEYLMRLMVAMYDEDLLDHTEVLQWLVSTNEQCSDDE 859
            LGPPDVY Q+ KQKED LT  NV++GFN ++P V  +EH SAK++ F          +++   ++I +    N   DT KRK  V    KD   +    +S+  I  W   L  T P  +L  K++P F KKE+V   + KY VP+ R+ W IK++ A HA I     K K R  +D   +W     + L E+L  +  +  R                + E  + ++EY  +L + M+ + +LD  E L W++   E+    E
Sbjct:   19 LGPPDVYPQDPKQKEDELTALNVKQGFN-NQPAVSSDEHGSAKNVNFN------PAKISSNFSSIIAEKLRFNSFPDTGKRKPQVNQ--KDNFWL-VTARSQSSINSWFTDLGGTKPLTQLA-KKVPIFSKKEEVFAYLAKYSVPVMRSAWMIKMTCAYHAAIT--ETKVKKRHVIDPCIEWTQIITKYLWEQLQKV-AEFYRQCPSQGCSSPPPATPADVETAMKQWEYNEKLAMFMFQDGMLDRHEFLTWVLECFEKVRPGE 268          
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Planmine SMEST
Match: SMESG000000954.1 (SMESG000000954.1)

HSP 1 Score: 3125.88 bits (8103), Expect = 0.000e+0
Identity = 1640/1641 (99.94%), Postives = 1640/1641 (99.94%), Query Frame = 2
Query: 1055 MFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGXXXXXXXXXXXXXXXXXGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNIHQNQSHQSIQNCLVEFLDTKSPIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNXXXXXHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVNGYVNRCSAAVVIQQFQSCATLRSCPTFVMNMKKLENVFRNIKPDKDRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVXXXXXXXXXXXXHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTSFPEILPEDIKDPSISDPMEIINSSGPPSVQXXXXXXXXXXXXXXXXXXXXXMENPRDNNPGSVKINQENPSMPPLTRPRSNASSGIGPTKRKKPKRSNNQSNSGQSIMANQISNHHPMSRNVPSPAILPGNPNLMMRHHPPGMSMVPPNGNIGLAIAAHRYPNHGIDYSGYGSHQIGSGFSELPSNAYLQSQHYSQSVYDSNQRANQMSCTRPNRTSRSNINQTLKSKIQQRQPSQDHPMLSSFHGNTXXXXXXXXXXXXXXXXXXXXXXXXLEDIXXXXXXXXXXXXXXTLMNNYQLTRTYSDSSXXXXXXXXXXXXXXXSRLHPSQYNRYGQF 5977
            MFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGSPLDLLPCALSALPCPPGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNIHQNQSHQSIQNCLVEFLDTKSPIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNSSSSSHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVNGYVNRCSAAVVIQQFQSCATLRSCPTFVMNMKKLENVFRNIKPDKDRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVDDDYNDDRYDQYHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTSFPEILPEDIKDPSISDPMEIINSSGPPSVQNGINNSNNNTSNHINNINSNSMENPRDNNPGSVKINQENPSMPPLTRPRSNASSGIGPTKRKKPKRSNNQSNSGQSIMANQISNHHPMSRNV SPAILPGNPNLMMRHHPPGMSMVPPNGNIGLAIAAHRYPNHGIDYSGYGSHQIGSGFSELPSNAYLQSQHYSQSVYDSNQRANQMSCTRPNRTSRSNINQTLKSKIQQRQPSQDHPMLSSFHGNTQQQQQQSILPPPPPYHNNSSSNIPLEDINNVAPVPPPNYNNPTLMNNYQLTRTYSDSSMQQYMQQQQQQQQQQSRLHPSQYNRYGQF
Sbjct:    1 MFCLSGLIVSLSLECPCAVVYNNIKIPGHNLNGSPLDLLPCALSALPCPPGQENNLNRDTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYNCYKDSSVFEGLCTVVVSLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQIIDNIHQNQSHQSIQNCLVEFLDTKSPIIDSQISADSEPFRNLVCLFGELIERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNSSSSSHRKSPELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPVNDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDIIQIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTCVNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDECSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMSDCRCRIFHGIFVLSRNFVSVNGYVNRCSAAVVIQQFQSCATLRSCPTFVMNMKKLENVFRNIKPDKDRSSSIDYVESVGMDLFKINMVSCSENVTELQLNVNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIYSLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFSDFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTANSVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLTENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQETPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMNRTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAEQQANQRELVDDDYNDDRYDQYHSQSHRQKPTESIEINSAYLIPSLINKLPFDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISLLIVCLAKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMKSRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVLDMISTLIHTLFSIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPCFKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIEGIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTSFPEILPEDIKDPSISDPMEIINSSGPPSVQNGINNSNNNTSNHINNINSNSMENPRDNNPGSVKINQENPSMPPLTRPRSNASSGIGPTKRKKPKRSNNQSNSGQSIMANQISNHHPMSRNVLSPAILPGNPNLMMRHHPPGMSMVPPNGNIGLAIAAHRYPNHGIDYSGYGSHQIGSGFSELPSNAYLQSQHYSQSVYDSNQRANQMSCTRPNRTSRSNINQTLKSKIQQRQPSQDHPMLSSFHGNTQQQQQQSILPPPPPYHNNSSSNIPLEDINNVAPVPPPNYNNPTLMNNYQLTRTYSDSSMQQYMQQQQQQQQQQSRLHPSQYNRYGQF 1641          
The following BLAST results are available for this feature:
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MED12L9.223e-14627.36mediator complex subunit 12L [Source:HGNC Symbol;A... [more]
MED123.300e-13526.77mediator complex subunit 12 [Source:HGNC Symbol;Ac... [more]
MED123.762e-13526.77mediator complex subunit 12 [Source:HGNC Symbol;Ac... [more]
MED128.039e-11025.82mediator complex subunit 12 [Source:HGNC Symbol;Ac... [more]
MED12L2.392e-10827.12mediator complex subunit 12L [Source:HGNC Symbol;A... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dpy-222.667e-621.47Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kto1.279e-3226.31gene:FBgn0001324 transcript:FBtr0074884[more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
med121.272e-14528.23mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
med121.864e-14528.23mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
med121.864e-14528.23mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020345.13.080e-13727.11mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
ENSXETT00000034172.11.697e-13626.93mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
ENSXETT00000020359.11.264e-13526.82mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
ENSXETT00000034146.11.765e-13526.82mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
ENSXETT00000020329.11.981e-13526.93mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Med12l3.537e-14927.44mediator complex subunit 12-like [Source:MGI Symbo... [more]
Med12l1.003e-14627.00mediator complex subunit 12-like [Source:MGI Symbo... [more]
Med12l4.883e-14626.91mediator complex subunit 12-like [Source:MGI Symbo... [more]
Med123.300e-13626.59mediator complex subunit 12 [Source:MGI Symbol;Acc... [more]
Med123.433e-13626.59mediator complex subunit 12 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BQM9|MD12L_MOUSE2.474e-14827.44Mediator of RNA polymerase II transcription subuni... [more]
sp|Q86YW9|MD12L_HUMAN4.429e-14527.36Mediator of RNA polymerase II transcription subuni... [more]
sp|Q2QCI8|MED12_DANRE1.274e-14428.23Mediator of RNA polymerase II transcription subuni... [more]
sp|A2AGH6|MED12_MOUSE2.401e-13526.59Mediator of RNA polymerase II transcription subuni... [more]
sp|Q5RCU2|MED12_PONPY1.231e-13426.77Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y6040.000e+031.78Mediator of RNA polymerase II transcription subuni... [more]
A0A419PSG50.000e+031.73Mediator of RNA polymerase II transcription subuni... [more]
A0A4S2MCS90.000e+031.56Med12 domain-containing protein OS=Opisthorchis fe... [more]
A0A1S8X1980.000e+031.53Transcription mediator subunit Med12 (Fragment) OS... [more]
A0A074Z6U90.000e+031.31Med12 domain-containing protein OS=Opisthorchis vi... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
med126.728e-9627.68mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
med128.403e-9427.37mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002656.11.460e-3725.84pep scaffold:Pmarinus_7.0:GL481230:51:37267:1 gene... [more]
ENSPMAT00000002660.13.352e-3626.25pep scaffold:Pmarinus_7.0:GL481230:54:36427:1 gene... [more]
ENSPMAT00000002662.14.861e-3626.03pep scaffold:Pmarinus_7.0:GL481230:54:36427:1 gene... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO451831.456e-1627.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451822.397e-1623.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258211.848e-624.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
med126.577e-13827.70mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
med122.122e-9826.65mediator complex subunit 12 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 12-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000954.10.000e+099.94SMESG000000954.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021839 ID=SMED30021839|Name=Mediator of RNA polymerase II transcription subunit 12-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6029bp
GGTTTAGTTATATCTCAATTTTATTAGTATGAGTTATTATCATTCATTAG
AAACTCATCCTTTAAAATGTCTAAAGCAAACAGAAGGATATAATTCACAT
AAAGTTTTATTAGGACCCCCAGATGTTTATCAGCAAGAATATAAACAAAA
AGAAGACCTACTTACTGAATTCAACGTAAGAGAAGGATTTAATTACAGTA
AACCAGTAGTAGAAGAACATGAATCGGCCAAAGATATTGGATTCGAATTT
ATTTCGAAGCCATTTCTTACGGATCTGAACAATTTTATGCAAGCTGTGAT
TGTTAAAAGTCATAATAACAATATTAAACAAGATACTACAAAACGAAAAG
TAACTGTTGCAACACTATTTAAAGACTTACAATGTATACCAGCGATTGAG
AAATCTAAAGAAATAATCTACGATTGGATGATTCAGTTATCTGACACCAT
TCCATACGCCGAATTAATTAACAAACGAATTCCATACTTTCATAAAAAGG
AAGATGTATTGAAAGAGATTTTTAAATACCAAGTTCCAATAACTCGAGCA
ATATGGTTTATTAAAGTGAGTGCAATGCATGCTACAATTCAAGCTGAGAG
CAATAAGAAAAAACCCAGATCCAATGTCGATAGTTTATCGGATTGGGTTT
TAAGTTTTATTCGTACATTGAATGAGAAATTGGATTTGATTCGAATCAAA
TTGATGAGAAACACAATCGATCATGAATACGAAATGACAGTATCCGAATT
CGAGTATTTAATGCGATTGATGGTTGCAATGTATGATGAGGATTTACTAG
ATCACACCGAAGTGTTGCAATGGCTAGTGTCAACGAATGAACAATGCAGT
GACGATGAGCAAATGATGAAATTTTATTTGCCATTCTTATTGTATTTTGG
GGATCGGTTTAAAGAGAGCGAAATCCTGACGAGAAAATTGTTACATGGAC
TTTGCAACAGTGTCAATTTATTGTTGACGAATAACAAACATCCCGATCGT
TCGATAACAGATTTCTATGCTGAATATTCCAGCTGTTCTACGCATCGCAC
TGTCATGTTTTGTCTGAGTGGATTGATCGTTTCGTTGAGCCTCGAATGTC
CATGTGCAGTCGTATACAACAACATCAAAATTCCCGGACATAATCTCAAT
GGATCGCCGTTGGATTTACTGCCATGCGCGTTGTCAGCATTGCCGTGTCC
ACCGGGCCAAGAAAACAATCTTAACCGGGACACAATTGCTAAACTCGAGC
AATTCATCCTCCAACGTAGCTTGGCCGTAGAAAACCAATGGAAACACGAA
TCGTTTGAGTGTTCAATCGAACAAACGGCGGCCGGTCTAATTAAAGTCGT
CGAGTTGTTGGACAGATACGATTACAACTGCTATAAAGATTCAAGCGTGT
TTGAGGGCCTGTGCACAGTGGTTGTGAGCTTGGTCGATAACCACAGCTTG
CTGTTGATGCTGCTCTGTGAGTGGTCGGTGTCAACAATGCGGACCGGCAC
CCATCGGCCGTTCCTCGTGGCCCAAATCATTGACAACATTCACCAAAATC
AATCCCACCAATCTATCCAAAACTGTCTTGTGGAATTTCTAGACACAAAA
TCTCCAATAATCGATTCGCAAATCTCCGCCGACTCAGAACCGTTCCGAAA
TCTCGTTTGTCTGTTTGGGGAATTAATCGAACGGGAATTGTTCTCAATGA
ACGATTACATGAGCTACATGATCGCTCGAGGTCTATTTGAATCAGTCGCT
AATTTGCCGCTGCCACCGATCGGTGGATTTCTCTCAGTCGCTCACAACTC
CTCTTCGTCCTCCCATCGGAAATCCCCGGAACTCGACCGGATGTCAACCG
GTGACAATCCCGATTCAGTGAGATCCGAATGCAGCGGCCTCAATCAAATA
TTGCCTTCCATACCGATTGTCGATTATCGGAACTTCAATCGCCACCTGCA
GTATCTGATCCATTTCCCGATTCCAGTGAATGATGATTACGTGCACGAGC
ACAATTTGCGCTCCCAAAAGCTCTATTGCACCTCGAGAACCCGAGACGCT
AACAAACAGTTTCTGCGACGATTGGCGAAAGATATCGGGAAAATGTACAC
GAAACGCGGCTACATGTTCGACATAATCCAGATCGAAAAATCTCGGAAGA
AATCCCGCCGCGATCCACGAGAAGAATCGATGCTGATCGAAAAACTGGCC
GAGTCGATCCAATCGAGATTCAAATGTCTCACGTATTACGATATGGAATG
CGTGCTGTCTCAATGCTTGCCGACTTGCGTGAACTCCCTGAATATCCATT
CGATTCTCGCCAACAAGCTCCAGTCGACCAGCAACATGTTCCTGCCATAT
CCGACAATCATTTCCACTCTGCTCAATCTGATTGAGCAGTCGTGCAATTA
CTCGCTGCTCATTCGCATTATCGATGAGTGTTCGCTCAACCTGGTCAAGC
TGATCGAACATTTGTCTCGCCAGGGCCTCATCACGAATTACTCGTTGATT
TATTCGTACATGTCTCGGTTCCGGATCTGTATCATTGGGTTCCTATTTAA
ATTTCAATCGGTGCTCATGACCATGAGTGATTGCCGCTGCCGCATATTCC
ATGGCATTTTCGTGTTGTCACGTAACTTTGTCAGTGTCAATGGCTACGTG
AACCGGTGCTCAGCCGCAGTGGTTATCCAGCAGTTTCAGTCGTGCGCCAC
TCTCAGATCCTGCCCCACTTTCGTGATGAATATGAAGAAGCTCGAAAATG
TGTTCCGTAATATCAAACCCGACAAAGATCGAAGTTCGAGTATTGATTAT
GTCGAATCTGTCGGCATGGATCTGTTCAAGATCAACATGGTTTCCTGTAG
CGAAAACGTAACGGAATTGCAGTTGAATGTTAATCTTCGGTTCAGTCTCG
TTGTCAACTGTCTGTTGCACGTTGTCCAGTGTACCGATGTCGATCAGTTG
GCAAGGATCAACACGATAATCGTGGAGACAGTTTCCAATGCTTCGATGCT
CTCCACCGAATGGATTACTGCGATTTACAGTCTTCTGTTGCCTGGCAACG
CGTCACCAGGTTACGAGCAGTTCGTCAATAAATTCAATTCGCTTCTCGTA
TCGAACGATCTTCTGTTCTATGAAAACATTTCCACTCTCATCGCTACAAT
GCTCGCTCGGCAATGCTTCTATTTCTCTGATTTCCTTGGTCGAGTCATCT
GTGTTGCCTTGGCCCAAGGTATCGATCAACAGTCAATCGTCTGTCCGCCA
ATCGTCCCGACCACCCGATTGGCCAGCTATATTCTATTCCGATTGTTCAC
AATGGAACAGCAGAATTCTACCGCAAATTCCGTGAGCGCATTCAAAAAGG
AGGACGTCAATTTGCTGTCGTCATCGTTACAGAAAGTCACAACAGAACTG
CTCGTGGATCTGTTGAAAATGCTGGCAGTCCACAGTGACAAAGGACGATT
GCAAGACCAGGACTATTTCGATTTGACGGAAAACAATCAGGTTTCCTTCG
GTCCCCCGTTTAGGCGCTCAATCGATACCGAGGAGAGTTTTATCCACATG
AAAATCTGGAATTTCACGCTTCGAGTTTTGCGAGAGATCTGCTGCGTGTC
GTGGGTCCGAATCCGGTTCTCCCAGGAAACCCCGTCACGGCTGATTCGCG
ACAACGTCCTGATCGATAAGAACATCTCCAACAGCCAAGCGAGGAACCTG
TTGAACATCATTTGCCACCCAAAAGATCACCTCTGGCAGACGAGCTGCAC
CAGCAAAGACATAATCGATACAATGAATCGAACATTCACCAATCTCAATA
TCTGGTCGTTGCATTTCGATCAGATGAAAATCCAGCTGTTACTCACGCAA
ATTCCGGAAGAGGAACGAAAAGACGTCATCGAAAACGTGTCAAAAGATAT
TATAAATCTCTTCAAAAATCAAGCCGAACAGCAAGCCAATCAACGAGAAC
TTGTCGACGATGATTACAACGATGATCGCTATGATCAATATCACAGCCAG
AGCCACCGACAGAAACCGACGGAATCCATAGAAATCAATTCCGCCTATCT
CATCCCGTCACTGATCAATAAGCTGCCATTCGACAATTTCAAGCGCCAAT
TGATTGCCGCCGCATCTGAGAAACTGGAAAGCGGCAAACATTTCTGCACC
CACAAAAACTACCAAGACAAAGAAAACGATCTCACCAAGAGCTCGCTGAT
ATTGACCTATCCGCCGTTTATTTCCCTTCTCATCGTCTGTCTGGCAAAGG
ACGACAACCGATCCGAGTTTCTCAAATCTCTCGCCGATCAAATCGAATAC
TACATCGACAACGCGAAAGAAACGGAAAAAATGCCCGACGATTTGCGGGT
GAAGCATTTGATCCACACGAGCATGAAATCTCGATTGGCATTGGTCGGTT
ATCTGTTCGATCGGATCCAAGAGTCCTGGGAGCTGATCGGCGATTGGTGT
CTGTTGCTGAGCAAATTGATCATTTACGGAGTCGTGGAAATGCATTCCGA
CCATTCCGAGCTGTTCTACACGGTGCTCGACATGATCAGCACTCTGATCC
ATACTCTGTTCTCGATCCCGAATCACGGGATCAAGTTCTTTCAGATGATC
AAGAAGCTCCGAAAGGAAATCTGTGACAAATTGAACTATGAAGGAGTGGA
ATTGATTAAACCGTTTTTGTTGCCGTGCTTCAAAAACACCTACGATGTCA
TAGTGACGGTTCCGCTGAGAATGCCCCACAAATCGCAACAGTATCGACTG
ACAACGGCGGAAAAATCCGGCAAGCAAGGCTGTGCTGTCCAGAGAAAAGA
ACGAATCAATCCCTGGGAAGTTATCGAGGGAATTAAGAATCTATTTTCGT
TGTCATGGTTTGCTGCAGTCAGCTGTGATACCCCAGTGTTACCGATCGAG
GAACACGCAAATCTGATGATCGGACACGATCACCCCGATAAATTGATCCG
GCCCGACAATTACTACACGAGTTTCCCGGAAATCCTCCCAGAAGACATCA
AAGATCCCTCGATTAGTGATCCAATGGAAATTATCAATTCCAGCGGCCCC
CCGAGTGTACAAAACGGAATCAATAACAGCAACAACAACACCAGTAACCA
CATTAACAACATCAACAGTAACAGCATGGAAAACCCCCGAGATAACAACC
CGGGAAGTGTGAAAATCAATCAGGAAAATCCCTCAATGCCGCCATTAACT
CGCCCCCGAAGCAATGCCAGTTCCGGTATCGGTCCAACTAAGCGCAAAAA
ACCGAAAAGATCCAACAACCAATCAAATAGCGGCCAATCGATAATGGCCA
ATCAAATATCGAATCACCATCCTATGTCGAGGAATGTCCCGTCACCGGCA
ATTCTCCCCGGTAATCCCAACCTGATGATGAGGCATCATCCACCGGGCAT
GTCGATGGTGCCCCCGAACGGCAACATCGGATTGGCTATTGCAGCACATC
GATATCCAAACCACGGGATAGATTACTCCGGTTACGGTTCCCATCAAATC
GGATCAGGATTCTCTGAGCTCCCCAGCAATGCCTATTTGCAGTCGCAGCA
TTATTCACAGAGTGTTTACGATTCCAATCAACGGGCCAATCAAATGAGTT
GCACCCGACCAAATCGGACTTCTCGGTCGAATATCAATCAGACTCTCAAA
TCGAAAATCCAACAGCGCCAACCGTCACAAGATCATCCGATGCTTTCATC
GTTCCATGGTAACACTCAACAGCAACAACAACAGTCGATATTACCTCCGC
CGCCTCCATATCACAATAACTCGAGTTCAAATATTCCATTGGAGGACATC
AATAATGTCGCCCCCGTTCCTCCACCCAATTACAATAACCCGACGCTAAT
GAACAACTACCAGTTGACCAGAACGTATTCCGACTCCTCAATGCAGCAGT
ACATGCAACAACAGCAACAACAACAACAGCAGCAATCTCGACTCCATCCA
TCACAATACAATCGCTATGGCCAATTTTAATTCTCATTTTATTTGCCGGT
TGTAAATAGCATTCACAACTAATTTGTAC
back to top

protein sequence of SMED30021839-orf-1

>SMED30021839-orf-1 ID=SMED30021839-orf-1|Name=SMED30021839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1984bp
MSYYHSLETHPLKCLKQTEGYNSHKVLLGPPDVYQQEYKQKEDLLTEFNV
REGFNYSKPVVEEHESAKDIGFEFISKPFLTDLNNFMQAVIVKSHNNNIK
QDTTKRKVTVATLFKDLQCIPAIEKSKEIIYDWMIQLSDTIPYAELINKR
IPYFHKKEDVLKEIFKYQVPITRAIWFIKVSAMHATIQAESNKKKPRSNV
DSLSDWVLSFIRTLNEKLDLIRIKLMRNTIDHEYEMTVSEFEYLMRLMVA
MYDEDLLDHTEVLQWLVSTNEQCSDDEQMMKFYLPFLLYFGDRFKESEIL
TRKLLHGLCNSVNLLLTNNKHPDRSITDFYAEYSSCSTHRTVMFCLSGLI
VSLSLECPCAVVYNNIKIPGHNLNGSPLDLLPCALSALPCPPGQENNLNR
DTIAKLEQFILQRSLAVENQWKHESFECSIEQTAAGLIKVVELLDRYDYN
CYKDSSVFEGLCTVVVSLVDNHSLLLMLLCEWSVSTMRTGTHRPFLVAQI
IDNIHQNQSHQSIQNCLVEFLDTKSPIIDSQISADSEPFRNLVCLFGELI
ERELFSMNDYMSYMIARGLFESVANLPLPPIGGFLSVAHNSSSSSHRKSP
ELDRMSTGDNPDSVRSECSGLNQILPSIPIVDYRNFNRHLQYLIHFPIPV
NDDYVHEHNLRSQKLYCTSRTRDANKQFLRRLAKDIGKMYTKRGYMFDII
QIEKSRKKSRRDPREESMLIEKLAESIQSRFKCLTYYDMECVLSQCLPTC
VNSLNIHSILANKLQSTSNMFLPYPTIISTLLNLIEQSCNYSLLIRIIDE
CSLNLVKLIEHLSRQGLITNYSLIYSYMSRFRICIIGFLFKFQSVLMTMS
DCRCRIFHGIFVLSRNFVSVNGYVNRCSAAVVIQQFQSCATLRSCPTFVM
NMKKLENVFRNIKPDKDRSSSIDYVESVGMDLFKINMVSCSENVTELQLN
VNLRFSLVVNCLLHVVQCTDVDQLARINTIIVETVSNASMLSTEWITAIY
SLLLPGNASPGYEQFVNKFNSLLVSNDLLFYENISTLIATMLARQCFYFS
DFLGRVICVALAQGIDQQSIVCPPIVPTTRLASYILFRLFTMEQQNSTAN
SVSAFKKEDVNLLSSSLQKVTTELLVDLLKMLAVHSDKGRLQDQDYFDLT
ENNQVSFGPPFRRSIDTEESFIHMKIWNFTLRVLREICCVSWVRIRFSQE
TPSRLIRDNVLIDKNISNSQARNLLNIICHPKDHLWQTSCTSKDIIDTMN
RTFTNLNIWSLHFDQMKIQLLLTQIPEEERKDVIENVSKDIINLFKNQAE
QQANQRELVDDDYNDDRYDQYHSQSHRQKPTESIEINSAYLIPSLINKLP
FDNFKRQLIAAASEKLESGKHFCTHKNYQDKENDLTKSSLILTYPPFISL
LIVCLAKDDNRSEFLKSLADQIEYYIDNAKETEKMPDDLRVKHLIHTSMK
SRLALVGYLFDRIQESWELIGDWCLLLSKLIIYGVVEMHSDHSELFYTVL
DMISTLIHTLFSIPNHGIKFFQMIKKLRKEICDKLNYEGVELIKPFLLPC
FKNTYDVIVTVPLRMPHKSQQYRLTTAEKSGKQGCAVQRKERINPWEVIE
GIKNLFSLSWFAAVSCDTPVLPIEEHANLMIGHDHPDKLIRPDNYYTSFP
EILPEDIKDPSISDPMEIINSSGPPSVQNGINNSNNNTSNHINNINSNSM
ENPRDNNPGSVKINQENPSMPPLTRPRSNASSGIGPTKRKKPKRSNNQSN
SGQSIMANQISNHHPMSRNVPSPAILPGNPNLMMRHHPPGMSMVPPNGNI
GLAIAAHRYPNHGIDYSGYGSHQIGSGFSELPSNAYLQSQHYSQSVYDSN
QRANQMSCTRPNRTSRSNINQTLKSKIQQRQPSQDHPMLSSFHGNTQQQQ
QQSILPPPPPYHNNSSSNIPLEDINNVAPVPPPNYNNPTLMNNYQLTRTY
SDSSMQQYMQQQQQQQQQQSRLHPSQYNRYGQF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003712transcription cofactor activity
GO:0001104RNA polymerase II transcription cofactor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: cellular component
TermDefinition
GO:0016592mediator complex
Vocabulary: INTERPRO
TermDefinition
IPR019035Mediator_Med12
IPR021990Mediator_Med12_LCEWAV
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021990Mediator complex, subunit Med12, LCEWAV-domainPFAMPF12145Med12-LCEWAVcoord: 2..163
e-value: 5.8E-27
score: 94.7
coord: 170..236
e-value: 4.4E-13
score: 48.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1504..1560
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1375..1409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1375..1393
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1504..1563
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1610..1641
NoneNo IPR availablePANTHERPTHR46007:SF1MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 12coord: 4..1628
NoneNo IPR availablePANTHERPTHR46007FAMILY NOT NAMEDcoord: 4..1628
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.563