DUF4709 domain-containing protein

Overview
NameDUF4709 domain-containing protein
Smed IDSMED30021838
Length (bp)1545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4709 domain-containing protein (SMED30021838) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4709 domain-containing protein (SMED30021838) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4709 domain-containing protein (SMED30021838) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4709 domain-containing protein (SMED30021838) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021838

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021838h1SMcG0014126 dd_Smed_v4_13431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021838h1SMcG0014126 dd_Smed_v4_13431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021838h1SMcG0014126 dd_Smed_v6_13431_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021838h1SMcG0014126 dd_Smed_v4_13431_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4709 domain-containing protein vs. Ensembl Human
Match: C10orf67 (chromosome 10 open reading frame 67 [Source:HGNC Symbol;Acc:HGNC:28716])

HSP 1 Score: 50.8322 bits (120), Expect = 3.118e-6
Identity = 40/160 (25.00%), Postives = 84/160 (52.50%), Query Frame = 2
Query:  206 LTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEE---SLK--YTKKIADLTAKLRKSEAKIKELNMQINEYQEF 670
             + D  +QT+ ++I+ + EL+ +  ++     +L  +   ++  LQ  F   L + +  L+  ++ ++ EIE+  +   + +R++F  QL+DA++ ++ +Y +           F E EE   SL+   T K   L  KL++ E  IKEL  ++++Y++F
Sbjct:   32 FSTDHATQTDSSEILSVKELSSSTQKLAQMMKSLQVDFGFLKQLLQLKFEDRLKEESLSLFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKGMYQQ-----------FFEVEEENVSLQDASTVKTNILLRKLKEKEEVIKELKEELDQYKDF 180          
BLAST of DUF4709 domain-containing protein vs. Ensembl Human
Match: C10orf67 (chromosome 10 open reading frame 67 [Source:HGNC Symbol;Acc:HGNC:28716])

HSP 1 Score: 48.9062 bits (115), Expect = 5.523e-6
Identity = 40/160 (25.00%), Postives = 84/160 (52.50%), Query Frame = 2
Query:  206 LTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEE---SLK--YTKKIADLTAKLRKSEAKIKELNMQINEYQEF 670
             + D  +QT+ ++I+ + EL+ +  ++     +L  +   ++  LQ  F   L + +  L+  ++ ++ EIE+  +   + +R++F  QL+DA++ ++ +Y +           F E EE   SL+   T K   L  KL++ E  IKEL  ++++Y++F
Sbjct:   49 FSTDHATQTDSSEILSVKELSSSTQKLAQMMKSLQVDFGFLKQLLQLKFEDRLKEESLSLFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKGMYQQ-----------FFEVEEENVSLQDASTVKTNILLRKLKEKEEVIKELKEELDQYKDF 197          
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Match: A0A210QQN2 (Uncharacterized protein C10orf67 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19578 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 7.270e-20
Identity = 77/249 (30.92%), Postives = 139/249 (55.82%), Query Frame = 2
Query:  134 ENKVGDLYKLTFPNGYNFNDYYKSLTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTMIMETESXXXXXXXXXXXXXXXXXXXXXXXXKMKTLINDLNQKIEELEKENSSFEKIIEKLNSTV 880
            EN+V DL++ +  + +    +    T D  SQT+ T+++ + ++TE I  +  +  NL R+ N  +  +Q+D+ + L + A +LYCR+N K+ ++ER   DRV+ VRRAF+ QL+DA++ +  LY++ +  K   +K+   S++  K  ++  ++ A +++SE  I  L MQ++ YQ+   Q    METES    +           +   E +IK K+   D+N ++E+L +E S   + I KL  T+
Sbjct:   33 ENEV-DLFRPSLADQHKVGFF----TLDRCSQTDVTEVVDLKQMTEIIQILLQDVTNLRRDINFAKHVMQADYEKKLQEKALELYCRINDKVTQLERMHEDRVDTVRRAFRQQLADAIARISVLYSKNMENKIQREKSKRASDKD-KLGEQYKEMQATIQRSEQVIAMLKMQLSHYQQ---QQHNNMETESPAPSDRPSNRTPSSYVSSVEELSIKSKS--PDINPELEDLREEVSGMSRKINKLEKTI 270          
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Match: K1PW16 (Uncharacterized protein C10orf67 OS=Crassostrea gigas OX=29159 GN=CGI_10013420 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.103e-17
Identity = 59/164 (35.98%), Postives = 99/164 (60.37%), Query Frame = 2
Query:  182 NFNDYYKS--LTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQE 667
            N  D +K    T D  SQTE T+++ + E+TE +  +  +  NL R+ NL +  +Q+D+   L + + +LY R+N+K+ E+ER   DRV  VRRAF+ QLSDA++ +  LYN+ L  K   +K   E E   K+ +K  ++ A ++++E  I+ L MQ+ ++Q+
Sbjct:   42 NIADQHKVGFFTLDRCSQTEVTEVVDLKEMTEVLQILLQDVTNLRRDINLTKHVMQADYESKLQEKSLELYVRINEKVRELERIHEDRVTTVRRAFRQQLSDAIARVAVLYNKNLESKIKKEKRKQE-EGQGKHDEKYKEMQATIQRNETVIQMLKMQLAQFQQ 204          
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Match: R7UFL9 (DUF4709 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220477 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.125e-17
Identity = 55/154 (35.71%), Postives = 97/154 (62.99%), Query Frame = 2
Query:  227 QTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTM 688
            QTE+++I+ I ELT  I  +  + A++ R+ N  R+ +Q+DF   L   A  LY RVN+K+++IER   DRV  VRRAF+ QLSDA++ M++ Y + L +  + ++   E EE+ K+  K  DL   ++++E+ I  L  Q++++Q+ + + ++
Sbjct:   55 QTEKSEILDIKELTYNIHELLDDAASMKRDINFARNVMQADFEAKLQQKAIDLYVRVNEKISDIERMHGDRVATVRRAFRQQLSDAIARMKTHYTKNLSENVLIEQRRKE-EEAKKWEMKFRDLQGTIQRNESIILMLRQQLSDFQQREDRASL 207          
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Match: V4AV50 (DUF4709 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_172717 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.536e-15
Identity = 50/139 (35.97%), Postives = 84/139 (60.43%), Query Frame = 2
Query:  215 DIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKI 631
            D  SQTE T+++ + E+TE I  +  +   L ++ N+ +  +Q+D+   L + +  LYCR+N K+A +E+   DR++V+R+A++ QLSDA+S +  LYN+ L  K    K   +  ES K  +K  DL  +++K EA I
Sbjct:   52 DRGSQTELTEVLDLKEMTEVIQILLQDVETLRKDINVTKHVMQADYEAKLQEKSLDLYCRINDKVAALEKMHEDRIDVIRKAYRQQLSDAISRVAVLYNKNLENKISKVKK-KQDRESGKVDEKYRDLQNQIQKDEAVI 189          
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Match: A0A1S3K1T0 (uncharacterized protein C10orf67, mitochondrial isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177868 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.190e-13
Identity = 50/149 (33.56%), Postives = 90/149 (60.40%), Query Frame = 2
Query:  215 DIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEY 661
            D  +QTE T+I+ + E+TE +  +  +   L RE +  R  + +DF   L   A +LYCR+N ++ E+E+   DRV V+RRAF+ QLSDALS++ S++++  + K M+     ++ ++ K   KI +L   +++++  I+ L  Q+ +Y
Sbjct:   54 DRPTQTEVTEIVDLQEMTEVLQTLLQDVNILKREIHTARGLMLADFESKLQKKALELYCRINSRVDELEKMHADRVGVIRRAFRQQLSDALSNVASIFDKNYQNK-MNSDQKKKNAKADKLEAKIRELQGVIQRNDMVIEMLKTQLAQY 201          
BLAST of DUF4709 domain-containing protein vs. Planmine SMEST
Match: SMESG000029222.1 (SMESG000029222.1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 471/472 (99.79%), Postives = 471/472 (99.79%), Query Frame = 2
Query:   98 MNGXXXXXXXXXENKVGDLYKLTFPNGYNFNDYYKSLTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTMIMETESXXXXXXXXXXXXXXXXXXXXXXXXKMKTLINDLNQKIEELEKENSSFEKIIEKLNSTVQSVKDELISKSNFAXXXXXXXXXXXXXIQNLCQQNQKFQLEINAFKTTEPPKLPTPRKEVKVEKPPTKSTDIQKNFKEFPDLSKEVSELKDKIQKLQINELERENELNQMKNSLLSDNRKYLEEIKILQSINIKLKEEMFKRNELQNNFKTLHSASVAYAMNKQPIGILPNQSITESKINTINMENIPNFKNKLQFTENDKILLENFIEIK 1513
            MNGSSKTSDSSSENKVGDLYKLTFPNGYNFNDYYKSLTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHR LADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTMIMETESEVSENPLIEIEEEENNTEFIEENIKMKTLINDLNQKIEELEKENSSFEKIIEKLNSTVQSVKDELISKSNFAEELKLEKHHLEEKIQNLCQQNQKFQLEINAFKTTEPPKLPTPRKEVKVEKPPTKSTDIQKNFKEFPDLSKEVSELKDKIQKLQINELERENELNQMKNSLLSDNRKYLEEIKILQSINIKLKEEMFKRNELQNNFKTLHSASVAYAMNKQPIGILPNQSITESKINTINMENIPNFKNKLQFTENDKILLENFIEIK
Sbjct:    1 MNGSSKTSDSSSENKVGDLYKLTFPNGYNFNDYYKSLTQDIESQTEETDIIQITELTEAIARITTENANLCREQNLMRSSLQSDFHRRLADAANQLYCRVNQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKTFMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTMIMETESEVSENPLIEIEEEENNTEFIEENIKMKTLINDLNQKIEELEKENSSFEKIIEKLNSTVQSVKDELISKSNFAEELKLEKHHLEEKIQNLCQQNQKFQLEINAFKTTEPPKLPTPRKEVKVEKPPTKSTDIQKNFKEFPDLSKEVSELKDKIQKLQINELERENELNQMKNSLLSDNRKYLEEIKILQSINIKLKEEMFKRNELQNNFKTLHSASVAYAMNKQPIGILPNQSITESKINTINMENIPNFKNKLQFTENDKILLENFIEIK 472          
The following BLAST results are available for this feature:
BLAST of DUF4709 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C10orf673.118e-625.00chromosome 10 open reading frame 67 [Source:HGNC S... [more]
C10orf675.523e-625.00chromosome 10 open reading frame 67 [Source:HGNC S... [more]
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QQN27.270e-2030.92Uncharacterized protein C10orf67 OS=Mizuhopecten y... [more]
K1PW161.103e-1735.98Uncharacterized protein C10orf67 OS=Crassostrea gi... [more]
R7UFL92.125e-1735.71DUF4709 domain-containing protein OS=Capitella tel... [more]
V4AV502.536e-1535.97DUF4709 domain-containing protein OS=Lottia gigant... [more]
A0A1S3K1T02.190e-1333.56uncharacterized protein C10orf67, mitochondrial is... [more]
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4709 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029222.10.000e+099.79SMESG000029222.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021838 ID=SMED30021838|Name=DUF4709 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1545bp
GTAATAAACATCTAAAATTATTTAAATAGTTTTGAAAATTTTATTACAAT
TTCAAGTTATTATTTATATATTCATATTATTTCACTGGAAAAATAATATG
AATGGGAGCTCTAAAACAAGTGATTCGTCTTCAGAAAATAAAGTTGGGGA
TCTCTATAAATTGACTTTTCCTAATGGGTATAATTTTAATGATTACTATA
AGTCCCTAACTCAAGATATTGAATCTCAGACTGAGGAAACGGATATAATC
CAAATCACAGAGTTGACTGAAGCTATTGCTAGAATAACAACAGAAAATGC
AAACCTGTGTAGAGAACAAAACTTAATGAGATCATCTTTGCAATCTGATT
TTCATCGGCACTTGGCCGACGCAGCGAATCAATTGTACTGCAGAGTCAAT
CAAAAATTAGCCGAAATAGAACGGTTTCAAAGAGATCGAGTCGAAGTTGT
TAGACGGGCTTTCAAATCGCAATTATCTGACGCTTTAAGCCATATGCGGT
CATTATATAATGAGAAATTAAGAAAAAAATCGATGGATGATAAAACATTT
ATGGAATCAGAAGAATCTCTAAAATACACTAAAAAAATAGCTGATTTAAC
AGCTAAATTAAGAAAATCAGAAGCCAAAATAAAAGAACTGAATATGCAAA
TTAATGAATATCAAGAATTCGATTCCCAGCCGACAATGATAATGGAAACT
GAAAGTGAAGTCAGTGAAAACCCGCTAATTGAAATTGAAGAAGAAGAGAA
CAACACAGAATTTATCGAAGAAAACATCAAAATGAAAACCCTAATAAATG
ATCTCAATCAAAAAATTGAAGAATTGGAAAAGGAAAATAGTTCCTTCGAA
AAAATCATCGAAAAATTAAATTCAACTGTTCAAAGTGTAAAAGACGAGCT
CATTTCAAAGTCAAATTTCGCTGAGGAATTAAAATTAGAAAAACATCACT
TGGAGGAAAAAATTCAGAATTTATGTCAACAAAATCAAAAGTTTCAACTG
GAAATTAATGCATTTAAAACTACGGAACCACCAAAGTTACCCACACCTAG
AAAAGAAGTCAAAGTTGAGAAACCTCCTACGAAATCAACTGATATCCAAA
AGAATTTTAAAGAATTCCCTGATTTGAGCAAAGAAGTTTCGGAGCTGAAA
GACAAAATTCAAAAGTTACAAATTAATGAATTAGAAAGAGAAAATGAATT
AAATCAAATGAAAAATAGCCTACTCTCAGATAATAGAAAGTATCTGGAGG
AAATAAAAATTCTCCAGTCAATCAATATAAAGCTAAAAGAAGAAATGTTC
AAAAGAAATGAACTTCAAAACAATTTTAAAACTTTACACAGCGCATCTGT
CGCTTATGCCATGAACAAACAGCCAATAGGAATTCTTCCAAATCAATCAA
TAACGGAATCCAAAATAAATACAATCAATATGGAAAACATTCCGAATTTC
AAAAATAAATTACAATTCACCGAAAATGATAAAATTTTATTGGAAAATTT
CATTGAAATAAAATAATTCTAAGAGAAATAAAAACAAAATTTGCC
back to top

protein sequence of SMED30021838-orf-1

>SMED30021838-orf-1 ID=SMED30021838-orf-1|Name=SMED30021838-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MNGSSKTSDSSSENKVGDLYKLTFPNGYNFNDYYKSLTQDIESQTEETDI
IQITELTEAIARITTENANLCREQNLMRSSLQSDFHRHLADAANQLYCRV
NQKLAEIERFQRDRVEVVRRAFKSQLSDALSHMRSLYNEKLRKKSMDDKT
FMESEESLKYTKKIADLTAKLRKSEAKIKELNMQINEYQEFDSQPTMIME
TESEVSENPLIEIEEEENNTEFIEENIKMKTLINDLNQKIEELEKENSSF
EKIIEKLNSTVQSVKDELISKSNFAEELKLEKHHLEEKIQNLCQQNQKFQ
LEINAFKTTEPPKLPTPRKEVKVEKPPTKSTDIQKNFKEFPDLSKEVSEL
KDKIQKLQINELERENELNQMKNSLLSDNRKYLEEIKILQSINIKLKEEM
FKRNELQNNFKTLHSASVAYAMNKQPIGILPNQSITESKINTINMENIPN
FKNKLQFTENDKILLENFIEIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040119C10orf67-like
IPR031651DUF4709
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 226..267
NoneNo IPR availableCOILSCoilCoilcoord: 340..409
NoneNo IPR availableCOILSCoilCoilcoord: 53..73
NoneNo IPR availableCOILSCoilCoilcoord: 164..191
NoneNo IPR availableCOILSCoilCoilcoord: 275..302
IPR031651Domain of unknown function DUF4709PFAMPF15821DUF4709coord: 38..133
e-value: 1.3E-20
score: 73.7
IPR040119Uncharacterized protein C10orf67-likePANTHERPTHR22382FAMILY NOT NAMEDcoord: 38..439