piggyBac transposable element-derived protein 4-like

Overview
NamepiggyBac transposable element-derived protein 4-like
Smed IDSMED30021837
Length (bp)2730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of piggyBac transposable element-derived protein 4-like (SMED30021837) t-SNE clustered cells

Violin plots show distribution of expression levels for piggyBac transposable element-derived protein 4-like (SMED30021837) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of piggyBac transposable element-derived protein 4-like (SMED30021837) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for piggyBac transposable element-derived protein 4-like (SMED30021837) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30021837SMESG000038294.1 Contig33398uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000038294.1 Contig33398newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000080622.1 SMESG000038294.1 SMESG000032747.1 SMESG000038602.1 Contig18287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000080622.1 SMESG000038294.1 SMESG000032747.1 SMESG000038602.1 Contig18287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000048275.1 SMESG000038294.1 SMESG000032747.1 Contig12966uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021837SMESG000048275.1 SMESG000038294.1 SMESG000032747.1 Contig12966newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30021837SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 123.635 bits (309), Expect = 1.239e-28
Identity = 101/356 (28.37%), Postives = 164/356 (46.07%), Query Frame = 1
Query: 1282 NELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGR-LLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGK----EDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKH-----KPDVLLFYNATKGGVDAMDERVVTYTTKFKCRR-WHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRR-RLFLIE 2304
            +EL  FF +++L+G+ +     ++  WS          R  M+  RF L+ R L F +N     G+   +  L  ++ + D  V      Y P  ++ +DE L  ++G     QY+P+   ++G+K +V+C+SQ+ Y WN   + G     +D  D   S    I + ++  L G G  V  DNF  S  L + L QN    VGT R +R+ IP  L +            I   T   R    L++      K V +LST HN     V +++     +P V++ YN   G VD+ D+ + +Y ++ K  + W+  FF ++L I+  N++ L     P+     SH   RL LIE
Sbjct:  153 DELKVFFAVMLLQGIVQKP--ELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKS--SRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKR-----------IAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTM--SHINFRLALIE 491          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: PGBD2 (piggyBac transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:19399])

HSP 1 Score: 80.4925 bits (197), Expect = 6.348e-15
Identity = 93/367 (25.34%), Postives = 146/367 (39.78%), Query Frame = 1
Query: 1201 ATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCW--NLRFYMGKEDDRDMQVSYGEYIT-MDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-----IPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTA-----------HNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
             T+  I+ ETNR   +   N   +L+  EL    GILIL G        +    S +    +  + +  +RF+LI   L F DN +        D+ A VR LI     N QK     E  +  E +  Y G     Q     P + G K W    S+ Y  W    +  +  + DR + +     I  +D LQ       ++  D  FTS+ L   L + G+   GT+R  R +      PK L + + R  F           D  ++ ++  +    + VVNI S A           H+         H+P ++  Y    GGV  MD+ +  Y  K +  +W+ +F   ++D +  NA+ LH
Sbjct:  152 GTINFIVNETNRYAWQ--KNVNLSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDAS----DRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSRGYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMK-RGSFDY-------KVDESEEIIVCRW--HDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLH 502          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 74.7146 bits (182), Expect = 4.117e-13
Identity = 94/427 (22.01%), Postives = 163/427 (38.17%), Query Frame = 1
Query: 1270 ALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGES-VTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDD-RDMQVSYGEYITMDMLQGL---YGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-IPKH---LTRYQGREVF----------------STIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRL---FLIELGNSLISAY---VEDRRRTAAADSLSSTPCKRGDCYMCID-RKRCTVTCVKCN 2451
             L+ +E   F GI+ L G        +      +    +    M  +RF+ I   L   DN +        DK + +R LI    E   K ++P E+  + DE + PY GR    Q++   P ++G KFW       Y CW  + Y GK  + +  +   G  + +   + L   +    +   +NFFTS+ L  +L   G    GT+R    D +P       + + R  F                +++  + +S A      L+  Y  K  K + +                +P+++  YN   GGVD  DE +  Y    + ++W+ +      ++   NA+ LH   + +       RRR+   +L   G+          + R   +  D ++    K+G    C +  K  T  C KC+
Sbjct:  174 GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDP----VDKFSKLRPLISKLNERCMK-FVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICW-FQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQV---------------QQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCD 579          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: PGBD1 (piggyBac transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:19398])

HSP 1 Score: 71.2478 bits (173), Expect = 7.138e-12
Identity = 84/386 (21.76%), Postives = 154/386 (39.90%), Query Frame = 1
Query: 1204 TMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWS-AEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRL-LRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPY-RGRCKFV---QYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKED-----DRDMQVSYGEYITMDMLQGLYGSGR---NVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVV-------NILSTAHNKI--------------TGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP 2256
            T   I+ ETN   S+   N    +++ E+   FG+L+L G  R     +   W  ++  + + R+ +  +RF+LI   L F +     G L  +DK   +R LI    +N    Y P E      + Y + +  C+     Q++   P + G K W    +Q Y  W   F   +E+     D D  +  G  + M+    L   G+   ++  D+FFTS+ L   L + G+   GTIR +R +                  L+      +  +      + + N+++        I+S   N +                 +    +P ++  Y+  K GV  MD+ +  Y  + + ++W+      ++D++  NA+ LH    P
Sbjct:  431 TFNLIVNETNNYASQ--KNVSLEVTVQEMRCVFGVLLLSGFMRHPRREM--YWEVSDTDQNLVRDAIRRDRFELIFSNLHFAD----NGHLDQKDKFTKLRPLIKQMNKNFL-LYAPLE------EYYCFDKSMCECFDSDQFLNGKPIRIGYKIWCGTTTQGYLVW---FEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTE---------------KCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHRACNP 783          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 70.8626 bits (172), Expect = 1.090e-11
Identity = 94/427 (22.01%), Postives = 163/427 (38.17%), Query Frame = 1
Query: 1270 ALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGES-VTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDD-RDMQVSYGEYITMDMLQGL---YGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-IPKH---LTRYQGREVF----------------STIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRL---FLIELGNSLISAY---VEDRRRTAAADSLSSTPCKRGDCYMCID-RKRCTVTCVKCN 2451
             L+ +E   F GI+ L G        +      +    +    M  +RF+ I   L   DN +        DK + +R LI    E   K ++P E+  + DE + PY GR    Q++   P ++G KFW       Y CW  + Y GK  + +  +   G  + +   + L   +    +   +NFFTS+ L  +L   G    GT+R    D +P       + + R  F                +++  + +S A      L+  Y  K  K + +                +P+++  YN   GGVD  DE +  Y    + ++W+ +      ++   NA+ LH   + +       RRR+   +L   G+          + R   +  D ++    K+G    C +  K  T  C KC+
Sbjct:  642 GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDP----VDKFSKLRPLISKLNERCMK-FVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICW-FQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQV---------------QQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCD 1047          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Fly
Match: CG13151 (gene:FBgn0033750 transcript:FBtr0087939)

HSP 1 Score: 54.299 bits (129), Expect = 5.125e-7
Identity = 56/214 (26.17%), Postives = 92/214 (42.99%), Query Frame = 1
Query: 1273 LSLNELNAFFGILILRGVYRAA--GESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKE-DDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKH 1905
            L + EL AF G+  L GV+R A     +DELW+ E G  IFR +MSL RF+ I   L   N    +G+ L  +L          + N +  Y     +T+DE        C   +           +  + CD++  Y  N      +   D+D++    ++ T         +GRNVT  + + +L   ++L Q  I+ +G + A+    P+ 
Sbjct:  184 LDVVELRAFLGLSYLCGVFRNARHNGPLDELWTLELGNAIFRASMSLARFESISECL-AGNCGWSEGQKLWQRL----------IINCRSYYGCSSWLTVDETF------CAVAKS----------RMTLCCDARTLYMANAVVSRNQRCPDKDVEQLICDFKT---------TGRNVTLGSRYLNLTQCEQLAQRQISSLGKLEANSPHWPRQ 361          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 301.212 bits (770), Expect = 7.193e-91
Identity = 169/459 (36.82%), Postives = 244/459 (53.16%), Query Frame = 1
Query: 1210 ETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRRRTA----AADSLSSTPCKRGDCYMCID------RKRCT-----------------VTCVKCNRFICKEH--LHNICKNCS 2499
            E ++  +N EG ++Y   +  L   +L AF GILIL GVYR+  ES+D LW    GR IFR TM+L  FK   R++ F   D   G+   DKLA +  + D +VE     Y PG+++T+D+ L P+RGRC F  YM   P+KYG++ W VCDS++ Y WN++ + GK  D   +      + +DM   L   G N+TCD  FTS  L + L +  ITM+GT R S  ++P  L   +GR + S+    T       D   LVSY  +KNK V ++ST H         + KP ++L YN+T+GGVD  D+   TYT + K   W +  F N+LD+SA+NAF L   + P W A K++RRR+FL +LG +L++ +++ R R      + + +        D   CI       RKRC                  +TC KCN +ICK H  +  +C  C+
Sbjct:  139 EMLMQISNLEGKRVYGAAWKDLDWTDLQAFIGILILIGVYRSKHESVDSLWDGVLGRPIFRATMALYTFKSWSRVICFRKRDPEPGQKSGDKLAPILNVWDKWVERLPLMYNPGQNLTVDKCLVPFRGRCPFKIYMQCKPAKYGIQIWAVCDSKSSYAWNMQIHTGKPADGKAEEDQAMRVVLDMTSAL--EGHNITCDQSFTSYALGEELLRRNITMIGTTRLSNPELPPALLSVKGRAINSSKFAFT-------DTHTLVSYHPRKNKNVLVMSTLHRDDAENSDEQSKPQMILDYNSTRGGVDNFDKLTSTYTCQRKTLHWPMVIFFNMLDVSAYNAFVLWMDLNPSWEAQKTNRRRIFLQDLGRALVTPHLQRRERLPRLPNSINMIVEAQSAPEDIQRCIPPVTDPKRKRCEPCNRSTNGGKRRDTKTRLTCDKCNMYICKAHAVITTLCYRCT 588          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 128.257 bits (321), Expect = 5.713e-30
Identity = 118/467 (25.27%), Postives = 202/467 (43.25%), Query Frame = 1
Query: 1171 IKVIIFF*LLATMETILIETNREGSKL---YNNQFTALSLNELNAFFGILILRGVYRAAGESIDELW--SAEHGRFIFRNTMSLNRFKLIRRILRFDNP------DTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVF-STIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHK--------------PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLV----EPQWNANKSHRRRLFL----IELGNSLI--SAYVEDRRRTAAADSLSSTPCKRGDCYMCIDRKRCTVTCVKCNRFIC 2463
            +++   F   + ++TI+  +N   +K     +  +  +S+ +L ++  ++I  G+ +    ++ + W  S  +   +    MS  +F  I   L   +P      + RKG    D+L  ++ L DN  +  +  Y PG++++IDE++   + R    QYM + P+K+G K +V+ DSQ  Y      Y GK       +SY E +   + +   G+G  +  DNF+TS  L + L    I   GTIR +R   PK  T    ++    ++  I      R D  L V +  K  + V + ST H    G +  +                P  +L YN   GGVD  D  +  Y    K R+W+  FF + +DI+  NAF LH  +    + +    K+ R  L +    +E G S I   + +    +  + DS S     R  C +C   ++  V C  C   +C
Sbjct:  222 LQLFQLFFTPSVLQTIMQHSNAYATKQRQGTDKSWKNISVEDLKSYLALVIFMGLLKVC--ALTDYWRRSDVYSVPLPTRIMSCRKFLNIANALHLSDPVDDEANEGRKGTAAYDRLGKIKPLYDNIRDACRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSY-ESVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMATNKLPQDAPRGSMRWI------REDDLLFVEW--KDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLARAKKERPLTQKAFRETLVMELAGLESGASPIPTPSTICHNPKYISGDSTSG----RRKCRVC--HQKTPVMCATCEVPLC 671          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: si:ch211-130m23.5 (si:ch211-130m23.5 [Source:ZFIN;Acc:ZDB-GENE-131121-298])

HSP 1 Score: 127.487 bits (319), Expect = 7.357e-30
Identity = 151/594 (25.42%), Postives = 238/594 (40.07%), Query Frame = 1
Query:  862 IKSNDEEQLSY-------DDTESEDADNLQVEINPADLHEQD-------DINRFTDSNGNVWVTPNEGMSGRVNAANILRPSPGITRWATQRIGENS-VLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRFDNPDTR--KGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHL-TRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVG-SKHKPDV-------------------LLFYNATKGGVDAMDERVVTYTTKFKCRRW---HVAFFCNILDISAFNAFALHYLVEPQWNAN-KSHRRRLFLIELGNSLISAYVEDR-RRTAAADSLSSTPCKRGD-----------CYMCID---RKRCTVTCVKCNRFICK 2466
            IK  D E+ SY        +T S D+D     I+ +DL E++       D+     ++ + W  P++ +S     A+               +G+++  LD F LLF      + V             T    L    R G    +  +    + E+ A+ G+ IL G+ +     +   W+++   G   F+ TM+  RF+ + + L   + ++   KG L  D L  +R L+D         Y+P   +TIDE     +GR    QYMPS P + G+K W++CDS++ YC   R Y+GK  D     + G  +   +++GL G   ++  D+FFTS+ L + L   G    G    SR+  P  L  R  G+   +  E       +      LV+ V +  K+V+ LS+  N   G VG S  K DV                   LL Y     GVD  D+    Y     C++W    + F+ N+  ++A+  F       P    N K   +R F I L   LI  Y   R    AA    + +P + G            C  C +   R      C  CN  +C+
Sbjct:  109 IKHEDYEEDSYYATSNNCSETSSTDSD-----IDFSDLEEEEHPLFSTYDVLDDECTSPDFWGEPDQVISIEPFTAD---------SGPQHSLGDDADTLDYFRLLFPDSLFKHMVE-----------QTNNYALYRQRRSGRS--DAHWHPTDIREMRAYVGLNILMGINQLPDYGM--YWASDIFIGNAGFKKTMTARRFEKLNQHLHLCDRESEPSKGELGYDGLYKIRPLLDMVGNTMWDAYLPNRCLTIDECSVASKGRFSPTQYMPSKPFRKGLKVWMMCDSRSGYCHRTRIYVGKPSDDLATAALGHKVVSSLVRGLEGRHHHIFIDSFFTSVPLLQHLLHQGFYACGPTNPSRQGYPDALKPRNVGK--LAPGEFYQCQHGN------LVATVTRDAKIVSCLSS--NSAPGIVGISPGKRDVDASDGDCGLVGLGLPRPLPLLLYQENMRGVDLCDQLRECYQVGRPCKKWWRYFLWFYVNLCIVNAYVVFRESRGGSPPAGFNGKQFTQRHFRIRLAQQLIGDYQGARGMERAARKRHADSPLEYGHRLERMSERSRRCRNCTNKGLRHESVFGCKICNVHLCR 663          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 116.316 bits (290), Expect = 2.375e-26
Identity = 113/447 (25.28%), Postives = 200/447 (44.74%), Query Frame = 1
Query: 1207 METILIETNREGSKLYN---NQFTALSLNELNAFFGILILRGVYRAAGESIDELW--SAEHGRFIFRNTMSLNRFKLIRRILRFDNP------DTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGK-EDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASR-----RDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGY-VGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSL--ISAYVEDRRRTAAADSLSSTPCK-RGD-------CYMCIDRKRCTVTCVKCNRFIC 2463
            M+ I+  +N  G+  +     ++  +++ +L +F  ++I  G+ +    ++ + W  S  +        MS  +F  I   L   +P      D ++G    D L  ++ L  +  +  +  + P ++++IDE++   + R   +QY+ S P+K+G K +V+ DS   Y W+   Y GK + ++   +SY   + + + + + G+G  +  DNF+TS  L + L    I   GTIR +R      + P+   R+     F    L+     D+RD  L+ S   K      I      K + + V     P  +L YN   GGVD  D  +  YT   K ++W+ +FF + +DI+  NAF LH  +    N  K+  +++F   L   L  I A     R  A A + +  P   +GD       C +C    +  +TCV C   +C
Sbjct:  167 MQKIVDHSNIFGAMRHEARKRKWKDITVADLKSFIAMVIYMGIVKCF--NLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMAL-IDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNRINHTETEAPRGNIRW-----FREDGLLFVEWKDKRD-VLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMAKSKN-QKAMTQKVFRETLVAELAGIRAGYPPAREAAIASTDNHLPKYIKGDSTFGRRKCKLCT--HKTPITCVTCQVHLC 600          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 104.76 bits (260), Expect = 9.146e-23
Identity = 88/364 (24.18%), Postives = 158/364 (43.41%), Query Frame = 1
Query: 1222 IETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAE-HGRFIFR-NTMSLNRFKLIRRILRFDNPDT------RKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPK-HLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKH---------------KPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
            I   +E SK     +  L+ +    + G+LI   + +     + + W  + H    F  + M+ +RF  I R +   NPD       +KG    D L  ++ L     +  +  + P + + IDE++   + +    QYM + P K+GVK +V+ DS N Y  +   Y GK      Q    + ++  +     G G ++  DNF+TS  L + L+ +G    GT + SR+++ +        R    +I  I      R++K L V ++  +   V++ ST H    G   +++                P  ++ YN   GGVD  D+ +  Y+   +  RW+     + +DI+A N++ LH
Sbjct:  149 INAEKELSKGKKLAWEKLTSDTFLKYIGLLIYMALLKLP--RVRDYWRRDSHLSVHFPVSVMTRDRFMAISRTVHLSNPDDDIENDRKKGTPDYDPLYRLKPLYITIKDTCKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKSRFTSSQGLPYDVVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDLYASGFVACGTFKDSRKNVRETKQNALTSRSPRGSIRWI------RQNKLLFVKWMDTRE--VSVCSTIHKAFDGDTVTRNVHDKETGSWQIKNIASPRCVVDYNKYMGGVDLSDQLLQYYSVHKRSNRWYRTLLYHFIDIAATNSYILH 502          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: npffr2 (neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-GENE-994428])

HSP 1 Score: 233.417 bits (594), Expect = 5.234e-68
Identity = 143/410 (34.88%), Postives = 212/410 (51.71%), Query Frame = 1
Query: 1294 AFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDR----RRTAAADSLSSTPCKRGDCYM--CIDRKRCTVTCVKCNRFI---CKEHLHNICKNC 2496
            AF  IL ++ +    G  +D  WS      + + TM  +RF  I + LRFD+ DTR  R+  DK AA+  +   F +N  + + PGE +TIDEQL+P + RC F QY+ + P K+G+KFW+  D +  Y  N   Y+GK+  R       E + M++++     GRNVT DNFFTS  LS RL Q+  T++GT+   RR++P+       REVFST  L + S +       L  Y  KKN  V +L++ H  +T     K KP+ +  YN  K GVD +D+    Y+ +   RRW VA + N+LD++A NA+ L Y     W      +RRLFL  L   L   +++ +    RR AA  ++  T  +   C +    +R      C  C +F    C++  H +CK C
Sbjct:    2 AFISILFVKAIMCPVGAIVD-CWSENFLVPVIKETMPRDRFISIMQHLRFDDKDTRAERVKTDKFAAISDIRTRFNKNCAESFTPGEHMTIDEQLFPTKVRCPFTQYVATKPDKFGIKFWMARDLETKYVCNASPYLGKDPSRQKGERLAENVVMNLMEPFLDEGRNVTTDNFFTS--LSHRLLQHKTTLLGTVNKVRRELPQLAKDTAQREVFSTSVLRSGSVS-------LTIYAPKKNLTVCVLNSMHQDVTIGDNRKRKPNTITDYNHMKCGVDVLDQMARMYSVRAATRRWPVAVYYNMLDLAAVNAYIL-YKACTGWTG----KRRLFLSLLAKELRCRFMQHKEILARRQAAEAAVPGT-VQTTQCQVQESCNRNHSRFICTTCQKFTCAKCRDDGHWVCKRC 395          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: dnah8 (dynein, axonemal, heavy chain 8 [Source:Xenbase;Acc:XB-GENE-6032736])

HSP 1 Score: 115.161 bits (287), Expect = 3.837e-27
Identity = 84/306 (27.45%), Postives = 147/306 (48.04%), Query Frame = 1
Query: 1384 IFRNTMSLNRFKLIRRILRFDNPDTR--KGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRD-----MQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHL--TRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKI------TGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP 2256
            +F   M+ NR++++ R L F++  T         D+L  +R LID+  +   + Y P ++V +DE L  ++GR KF QY+PS  S+YG+KF+ +C+S   Y      Y GK+ + D       ++    I  +++  L G G ++  DNF+T + L + L        GT+  +R+ +P+ L   + +  EV           A R ++ L + Y     KVV +L+T H++       +G   SK KP     Y+   GGVD  D+    Y    K R W+      ++ ++ +N++ ++    P
Sbjct:   23 LFSAVMARNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVH----------ALRSNELLAIKY--SDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVP 316          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000039631.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:68190968:68192372:-1 gene:ENSXETG00000012484.1 transcript:ENSXETT00000039631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 7.210e-27
Identity = 80/275 (29.09%), Postives = 137/275 (49.82%), Query Frame = 1
Query: 1174 KVIIFF*LLAT---METILIETNREGSKLYNNQFTA---------------LSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRFDN-----PDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRD-----MQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHL 1908
            ++I FF L  T   ++ +++ TN     LY  QF A                 + E+  F G+ +  G+ +A   S++  W         IF  TMS NR++L+ R L F+N     P    G    D+L  +R LI++  E   + Y P +++++DE L  ++GR KF QY+PS  ++YG+KF+ +C+S + Y  +   Y GK+   D     + ++    I  +++  L G G ++  DNF++S+ L + L+       GTI  +R+ +PK L
Sbjct:  110 ELIDFFHLFVTEAILQDMVLYTN-----LYAEQFLAQNPLPRFARAQAWHPTDIMEMKRFVGLTLAMGLVKA--NSLESYWDTTTVLSMPIFSVTMSRNRYQLLLRFLHFNNNATAVPPNEPGH---DRLHKLRPLINSLSERFAEMYTPSQNISVDESLLLFKGRLKFRQYIPSKRARYGIKFYKLCESSSGYTSHFLIYEGKDSQLDPPGCPIDLTASGKIVWELISPLLGRGYHLYVDNFYSSIPLFRALYSLDTPACGTINRNRKGLPKDL 374          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000022905.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:63138140:63139328:-1 gene:ENSXETG00000016674.1 transcript:ENSXETT00000022905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 7.483e-27
Identity = 84/306 (27.45%), Postives = 147/306 (48.04%), Query Frame = 1
Query: 1384 IFRNTMSLNRFKLIRRILRFDNPDTR--KGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRD-----MQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHL--TRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKI------TGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP 2256
            +F   M+ NR++++ R L F++  T         D+L  +R LID+  +   + Y P ++V +DE L  ++GR KF QY+PS  S+YG+KF+ +C+S   Y      Y GK+ + D       ++    I  +++  L G G ++  DNF+T + L + L        GT+  +R+ +P+ L   + +  EV           A R ++ L + Y     KVV +L+T H++       +G   SK KP     Y+   GGVD  D+    Y    K R W+      ++ ++ +N++ ++    P
Sbjct:   23 LFSAVMARNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVH----------ALRSNELLAIKY--SDTKVVLMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVP 316          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000019443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:30938263:30940062:1 gene:ENSXETG00000007374.1 transcript:ENSXETT00000019443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 8.173e-27
Identity = 105/393 (26.72%), Postives = 178/393 (45.29%), Query Frame = 1
Query: 1174 KVIIFF*LLATMETILIETNREGSKLYNNQFTA---------------LSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFI--FRNTMSLNRFKLIRRILRFDNPDTR--KGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRD-----MQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHL--TRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKI------TGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP 2256
            ++I FF L  T E IL +  R  + LY  Q+ A                ++NE+  F  + +  G+      S+   W       I  F   M  NR++++ R L F++  T         D+L  +R LID+  +   + Y P ++V +DE L  ++GR KF QY+PS  S+YG+KF+ +C+S   Y      Y GK+ + D       ++    I  +++  L G G ++  DNF+TS+ L + L        GT+  +R+ +P+ L   + +  EV           A R ++ L + Y     KVV +L+T H++       +G   SK KP     Y+   GGVD  D+    Y    K R W+      ++ ++ +N++ ++    P
Sbjct:  119 EIIDFFNLYIT-EAILQDMVRY-TNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVER--NSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVH----------ALRSNELLAIKY--SDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVP 495          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 5.952e-28
Identity = 101/356 (28.37%), Postives = 164/356 (46.07%), Query Frame = 1
Query: 1282 NELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGR-LLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGK----EDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKH-----KPDVLLFYNATKGGVDAMDERVVTYTTKFKCRR-WHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRR-RLFLIE 2304
            +EL  FF +++L+G+ +     ++  WS          R  M+  RF L+ R L F +N     G+   +  L  ++ + D  V      Y P  ++ +DE L  ++G     QY+P+   ++G+K +V+C+SQ+ Y WN   + G     +D  D   S    I + ++  L G G  V  DNF  S  L + L QN    VGT R +R+ IP  L +            I   T   R    L++      K V +LST HN     V +++     +P V++ YN   G VD+ D+ + +Y ++ K  + W+  FF ++L I+  N++ L     P+     SH   RL LIE
Sbjct:  153 DELKVFFAVMLLQGIVQKP--ELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKS--SRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKR-----------IAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTM--SHINFRLALIE 491          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q6P3X8|PGBD2_HUMAN (PiggyBac transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=PGBD2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.048e-14
Identity = 93/367 (25.34%), Postives = 146/367 (39.78%), Query Frame = 1
Query: 1201 ATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCW--NLRFYMGKEDDRDMQVSYGEYIT-MDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-----IPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTA-----------HNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
             T+  I+ ETNR   +   N   +L+  EL    GILIL G        +    S +    +  + +  +RF+LI   L F DN +        D+ A VR LI     N QK     E  +  E +  Y G     Q     P + G K W    S+ Y  W    +  +  + DR + +     I  +D LQ       ++  D  FTS+ L   L + G+   GT+R  R +      PK L + + R  F           D  ++ ++  +    + VVNI S A           H+         H+P ++  Y    GGV  MD+ +  Y  K +  +W+ +F   ++D +  NA+ LH
Sbjct:  152 GTINFIVNETNRYAWQ--KNVNLSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDAS----DRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSRGYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMK-RGSFDY-------KVDESEEIIVCRW--HDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLH 502          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q8N328|PGBD3_HUMAN (PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 1.977e-12
Identity = 94/427 (22.01%), Postives = 163/427 (38.17%), Query Frame = 1
Query: 1270 ALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGES-VTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDD-RDMQVSYGEYITMDMLQGL---YGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-IPKH---LTRYQGREVF----------------STIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRL---FLIELGNSLISAY---VEDRRRTAAADSLSSTPCKRGDCYMCID-RKRCTVTCVKCN 2451
             L+ +E   F GI+ L G        +      +    +    M  +RF+ I   L   DN +        DK + +R LI    E   K ++P E+  + DE + PY GR    Q++   P ++G KFW       Y CW  + Y GK  + +  +   G  + +   + L   +    +   +NFFTS+ L  +L   G    GT+R    D +P       + + R  F                +++  + +S A      L+  Y  K  K + +                +P+++  YN   GGVD  DE +  Y    + ++W+ +      ++   NA+ LH   + +       RRR+   +L   G+          + R   +  D ++    K+G    C +  K  T  C KC+
Sbjct:  174 GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDP----VDKFSKLRPLISKLNERCMK-FVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICW-FQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQV---------------QQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCD 579          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.428e-11
Identity = 84/386 (21.76%), Postives = 154/386 (39.90%), Query Frame = 1
Query: 1204 TMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWS-AEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRL-LRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPY-RGRCKFV---QYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKED-----DRDMQVSYGEYITMDMLQGLYGSGR---NVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVV-------NILSTAHNKI--------------TGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP 2256
            T   I+ ETN   S+   N    +++ E+   FG+L+L G  R     +   W  ++  + + R+ +  +RF+LI   L F +     G L  +DK   +R LI    +N    Y P E      + Y + +  C+     Q++   P + G K W    +Q Y  W   F   +E+     D D  +  G  + M+    L   G+   ++  D+FFTS+ L   L + G+   GTIR +R +                  L+      +  +      + + N+++        I+S   N +                 +    +P ++  Y+  K GV  MD+ +  Y  + + ++W+      ++D++  NA+ LH    P
Sbjct:  431 TFNLIVNETNNYASQ--KNVSLEVTVQEMRCVFGVLLLSGFMRHPRREM--YWEVSDTDQNLVRDAIRRDRFELIFSNLHFAD----NGHLDQKDKFTKLRPLIKQMNKNFL-LYAPLE------EYYCFDKSMCECFDSDQFLNGKPIRIGYKIWCGTTTQGYLVW---FEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTE---------------KCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHRACNP 783          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|P0DP91|ERPG3_HUMAN (Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.233e-11
Identity = 94/427 (22.01%), Postives = 163/427 (38.17%), Query Frame = 1
Query: 1270 ALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF-DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGES-VTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDD-RDMQVSYGEYITMDMLQGL---YGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRD-IPKH---LTRYQGREVF----------------STIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRL---FLIELGNSLISAY---VEDRRRTAAADSLSSTPCKRGDCYMCID-RKRCTVTCVKCN 2451
             L+ +E   F GI+ L G        +      +    +    M  +RF+ I   L   DN +        DK + +R LI    E   K ++P E+  + DE + PY GR    Q++   P ++G KFW       Y CW  + Y GK  + +  +   G  + +   + L   +    +   +NFFTS+ L  +L   G    GT+R    D +P       + + R  F                +++  + +S A      L+  Y  K  K + +                +P+++  YN   GGVD  DE +  Y    + ++W+ +      ++   NA+ LH   + +       RRR+   +L   G+          + R   +  D ++    K+G    C +  K  T  C KC+
Sbjct:  642 GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDP----VDKFSKLRPLISKLNERCMK-FVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICW-FQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQV---------------QQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCD 1047          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A267DYR7 (DDE_Tnp_1_7 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004292g1 PE=4 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.896e-141
Identity = 246/594 (41.41%), Postives = 349/594 (58.75%), Query Frame = 1
Query:  748 MSSHPRAAKAFALRAILGEXXXXXXDNEVVLEADDVHEIKSNDEE---QLSYDDTESEDADNLQVEINPADLHEQDDI-NRFTDSNGNVWVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAY---VEDRRRTAAADSLSSTPCKRGDCYMC---IDRKRCTVTCVKCNRFICKEHLHNICKNCS 2499
            M+   R AK+ AL  ILG   +   D ++ LE  D  E  S+ EE   +++  D     + +     +P    + + + +R+   +G  W T      G+  A NILR  PGIT++AT R+ +      F LLF                       ++TI++ETNRE +++    +   +  E+  + G+  LRGV++   ESI+ELWSA+ GR IF  TMSL+RFK + R LRFDN +TR  RL RDKLAAVRLL+D  V NSQ+ Y+P  +VT+DEQL+PYRGRC+++QYMP  P+KYG+KFW + D+ N YCWNL+ Y+G+E+DR+  VS GE++ + + +GL GSG  +T DNFF SL+L++RL +  +T++G++R+ RR++P  +   + R++ ST E + T      DK  L +Y AK NK+V ILS+ H+          KP V+L YNATKGG D MD+    Y+TK+K RRWHV  FCN+L+I+  N+F LH  V P   AN  HRRRL+L+ LG +L       VE  R   A   +     +RG C+MC    DRK  T  C  C+RF C EHL  IC  C+
Sbjct:    1 MARSTREAKSCALERILGREMNMP-DAQIDLEESDKEEHLSDIEEAELEVALSDASDGSSSSCSRPESPEPAAQAEAVGHRYVSPSGQAWSTNPPARCGQRPAGNILRLRPGITQFATARLHDEE--SAFKLLFDA-------------------DMVDTIVVETNREATRVLGQAWLPTTRVEMYGYIGLCFLRGVFKGNMESIEELWSADCGRKIFAETMSLSRFKSLLRFLRFDNRETRAARLQRDKLAAVRLLLDGLVSNSQRSYVPSGAVTVDEQLFPYRGRCRYIQYMPMKPAKYGLKFWCLNDAANAYCWNLQMYVGREEDRE--VSLGEHVVLRLAEGLRGSGMGITVDNFFCSLSLARRLQRWNLTLLGSMRSHRREVPLQMRSCRNRQLHST-EFVYTE----EDKIQLAAYKAKPNKLVLILSSQHSSPAVSAHPAQKPQVILDYNATKGGTDLMDQMTSCYSTKYKSRRWHVPVFCNLLNIAGLNSFLLHQTVFPNRFANAPHRRRLYLVALGRALTQPLRYQVEAGRNPPATVPVHGV--QRGRCHMCGRSKDRKTRT-RCTHCDRFCCAEHLQEICLACT 562          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A3B3INT3 (DDE_Tnp_1_7 domain-containing protein OS=Oryzias latipes OX=8090 GN=LOC101160710 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 2.572e-117
Identity = 202/530 (38.11%), Postives = 306/530 (57.74%), Query Frame = 1
Query:  979 FTDSNGNV-WVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVED-----------------RRRTA---AADSLSSTPCKRGDCYMCIDR--KRCTVTCVKCNRFICKEHLHNICKNC 2496
            +   +GN+ W T      GR++++NI++ +PG TR+A  R+  + +   F L   +                     +E I+++ TN EG +++  ++ +L   +LNA+ GILIL GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR   DKLAA+R + D +VE     Y PG  VT+DE+L P+RGRC F QYMP+ P+KYG+K W  CD+++ Y W ++ Y GK      + + G  + ++M +GL   G N+TCDNFFTS  L + L +  +TM+GT+R ++ ++P  + + QGR + S+I   T       +KA +VSY  K+NK V ++ST H   +       KP ++L YN+TKGGVD +D+   TY+ + K  RW +A F NI+D+SA+NA+ L   +  +WNA K +RRRLFL ELG +LI+  ++                  + RT+   A D + +   KR  C +C  R   + + +CVKC  FIC++H    C +C
Sbjct:   78 WASKDGNIKWSTSPHQSRGRLSSSNIIKMTPGPTRFAVTRV--DDIQSAFQLFISQ--------------------PIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGKSPGGAPEKNQGMRVVLEMSEGL--QGHNITCDNFFTSYRLGEELQKRKLTMLGTVRRNKPELPSEILKIQGRPMHSSIFAFT-------EKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKLYRRRLFLEELGKALITPKIQRRARPARSPAAAAVIEKIKFRTSNQFAMDPVDTDVKKRKRCQVCPSRDDSKTSTSCVKCKNFICRKHTVTFCPSC 576          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A146PBZ2 (PiggyBac transposable element-derived protein 3 OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 2.781e-117
Identity = 210/576 (36.46%), Postives = 324/576 (56.25%), Query Frame = 1
Query:  841 EADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHE--QDDINR---FTDSNGNV-WVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVE---------------DRRRTAAADSLSSTPCKRGDCYMCIDR--KRCTVTCVKCNRFICKEHLHNICKNC 2496
            E++D   + +ND  Q SYD+ +SED   +   + P D +   Q   +R   +T  +GN+ W T      GR+++AN+++ +PG TR+A  RI E  +   F L                     +   +E I++E TN EG +++  ++  L   +LNA+ G+L+L GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR  RDKLAA+R + D +VE     Y PG  V++DE+L P+RGRC F Q+MP+ P+KYG+K W  CD+++ Y W +R   GK      + + G    ++M +GL   G N+TCD+ FTS  L + L +  +TM+G +R ++ ++P  + R +GR   S++   T       +KA +VSY  KKNK V ++ST H   +       KP ++L +N+TKGGVD +D+   TY+ + +  RW +  F NI+D+SA+NA+ L   +  QWNA K HRRRLFL ELG +L++  ++               ++ R+     + +   KR  C +C  R   + + TCVKC  +IC++H    C +C
Sbjct:   35 ESEDNVIVDAND--QSSYDEEDSEDESAI---VPPTDENTGMQQSSSREVTWTSKDGNIKWSTSPHQSRGRLSSANVIKMTPGPTRFAITRIDE--IHSAFQLF--------------------ISPPIERIILEMTNLEGRRVFQEKWKPLDRTDLNAYIGVLLLAGVYRSKGEATASLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRAGRRERDKLAAIRDVWDKWVETLPLLYNPGPYVSVDERLVPFRGRCPFRQHMPNKPAKYGIKIWAACDARSSYAWKMRVNTGKLAGGKAEKNQGMRAVLEMSEGL--QGHNITCDDLFTSYRLGEELQKRKLTMLGAVRRNKPELPSEMLRMRGRPQHSSVFAFT-------EKATVVSYCPKKNKNVLVMSTMHADASLSTREDLKPQMILDFNSTKGGVDNLDKVTATYSCQRRTARWPLVIFYNIVDVSAYNAYVLWTEINQQWNAGKLHRRRLFLEELGKALVTPRMQTRARPARSPAAAAVIEKLRSPNQHQVETGEKKRKRCQVCPSRDDSKTSTTCVKCMNYICRKHTVTFCPSC 574          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A3Q2ZEU4 (DDE_Tnp_1_7 domain-containing protein OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 3.518e-117
Identity = 211/586 (36.01%), Postives = 323/586 (55.12%), Query Frame = 1
Query:  829 EVVLEADDVHEIKSN---DEE-QLSYDDTESED--ADNLQVEINPADLHEQDDINRFTDSNGNV-WVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVED---------------RRRTAAADSLSSTPC-----KRGDCYMCIDR--KRCTVTCVKCNRFICKEHLHNICKNC 2496
            E + E +D  E + N   D + Q S+D+ +SED  A     + N            +T  +G + W T      GR+++ N+++ +PG TR+A  R+  + +   F L                     +   +E I++  TN EG +++  ++  L   +L+A+ GIL+L GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR  R  RDKLAA+R + D +VE     Y PG  VT+DE L P+RGRC F QYMP+ P+KYG+K W  CD+++ Y WNL+ Y GK      + + G  + ++M +GL   G N+TCDNFFTS  L   L +  +TM+GT+R ++ ++P  + + QGR + S+    T       +K  LVSY  K+NK V ++ST H   +       KP ++L YN+TKGGVD +D+   TY+ + K   W +  F NILD+SA+NA+ L   +  QWNA+K +RRRLFL ELG +L++  +++               + +  A+D  +  P      KR  C +C  R   + + +CV+C ++ICK+H+   C +C
Sbjct:   24 EEISETEDPSEPEDNAIDDPDCQFSHDEEDSEDESAGVPSSDENQETQQSSSTEGTWTSKDGKIKWSTSPHQSQGRLSSCNVIKMTPGPTRFAVTRV--DDIESAFQLF--------------------ISPPIEKIILNMTNLEGRRVFQEKWKPLDPTDLHAYIGILVLAGVYRSKGEATASLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRADRRERDKLAAIRDVWDKWVEILPLLYNPGPHVTVDEHLVPFRGRCPFRQYMPNKPAKYGIKMWAACDAKSSYVWNLQVYTGKPPGGRPEKNQGMRVVLEMTEGL--QGHNITCDNFFTSYRLGDELQKRKLTMLGTVRKNKPELPSEILKMQGRPLHSSKFAFT-------EKTTLVSYCPKRNKNVLVMSTMHKDASLSTREDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTAHWPLVVFYNILDVSAYNAYVLWIEINQQWNASKLYRRRLFLEELGKALVTPKIKNRARPARSPAAAAVIAKVQGRASDQPTMDPLDTGAKKRKRCQICPSRDDSKTSTSCVRCKKYICKKHIVTFCPSC 578          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A0V0RHU9 (PiggyBac transposable element-derived protein 4 OS=Trichinella nelsoni OX=6336 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 1.208e-115
Identity = 203/532 (38.16%), Postives = 304/532 (57.14%), Query Frame = 1
Query:  979 FTDSNGNV-WVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRR---RTAAADSL-------SSTPC------------KRGDCYMCIDR-KRCTVTCVKCNRFICKEHLHNICKNCS 2499
            +   NG V W      ++GR++A N+++  PG TR+A  RI +  +   F L                     +  ++E +++E TN +G       +  L + +L A+ G+LIL GVYR+ GE+   LW+AE+GR IF   MSL +F LI R++RFD+  +R  R  +DKLAAVR++ D +V+N  K Y P E+VT+DE+LYP++GRC+F QYMP  P+KYG+KFWV C S++ Y WN++ Y GK      + + G  + +DM++GL   G NVTCDNFFTS  L   L +  +T+VGT++ ++ ++P+ L   QGR+++S       ST    +   ++SY+ KKNK V +LST HN      G   KP+++L YN TKGGVD +D+   TY+ +    RW +  F NI+D+SA+NA+ L     P WN  + H+RRLFL ELG +L+   +  R+   RTAAA S        +  P             KR  C +C+    + +V C KC ++ICK+H  + C  C+
Sbjct:   71 WVSKNGKVKWQPTPLKITGRLSACNVIKMIPGPTRYALNRITD--IASSFALF--------------------VPTSIENLILEMTNLKGRSCCPETWKPLDVTDLRAYIGLLILAGVYRSRGEATKSLWNAENGRAIFPAVMSLKKFHLISRMIRFDDHSSRASRRSKDKLAAVRVIWDTWVKNLPKMYNPSENVTVDERLYPFKGRCQFRQYMPKKPAKYGIKFWVACCSKSSYAWNMQIYTGKPSSGTREKNQGMRVVLDMVKGL--KGHNVTCDNFFTSYALGLELKKKNLTLVGTVKKNKPELPRELLELQGRKLYS-------STFAFSENCTIISYLPKKNKNVLVLSTMHNDNQVCDGKGSKPEIILHYNNTKGGVDNLDKMTSTYSCQRMTARWPLVIFYNIIDVSAYNAYVLWTEKHPAWNVGRLHKRRLFLEELGKALVQPEMMRRKTLPRTAAAKSAVKRLRKDTEHPSTSGITDTDTGGKKRARCQLCVQSDNKTSVRCKKCQKYICKDHTQSYCNLCA 571          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000039501.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:21564630:21575712:1 gene:ENSAMXG00000031759.1 transcript:ENSAMXT00000039501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.935 bits (559), Expect = 4.821e-59
Identity = 165/502 (32.87%), Postives = 240/502 (47.81%), Query Frame = 1
Query:  991 NGNVWVTPNEGMS--GRVNAA-NILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRRRTAAA-------DSLSSTPCKRGDCYMCIDRKRCTVT-CVKCNRFIC 2463
            +G VWV  + G    G  N    +LR +PG T++A  +I   S L     L  +                      E I   T  E  +   + F  L+  EL AF  +  +RG+       +D+ WS++ G  IF  T++  RF+ I R LRFD+ +TR  R   DK A +  L   FV+NS   Y+PGE++T+ EQL+P + RC+F QY+ +   K+G+KFWV  D+   Y  N+  Y+GK++ +       + +   +++     GRN+T   FF SL L+  L  N  T+VGTIR S+++ P   T+ Q  E+F+T  L T +T        L  Y AK  + V +LST H  ++     +  P+ +  Y  TK  VD +D     YT K   RRW VA F NILD++A NA   H L +    A  S  RR F+IEL   L        ++ A A         + + P KR  C +    K  T   C KC RF+C
Sbjct:  525 DGTVWVEQSAGEPWVGAWNVEFGVLRETPGPTKYAMDKI--TSPLSSLMCLIDE-------------------EMWEMIQKHTQAEIDRSDTDGF-KLTAAELKAFVALTYMRGITGGKTMKLDDYWSSDLGNPIFLKTLTRQRFRDIMRHLRFDDKNTRAARHETDKFAMISELFYKFVQNSIASYVPGENITVGEQLFPTKARCRFAQYVLNK-DKFGLKFWVAADADTKYVLNIFPYLGKDEGKLSGQRVKDSVVTRLVEPFLDKGRNITTSGFFPSLALASHLLVNKTTVVGTIRKSKQETP-QCTQTQS-EIFNTKVLRTGNTT-------LTIYQAKPKENVCVLSTMHQTVSVDNSEQKLPNSISHYYNTKFTVDVLDRMAHLYTVKNGTRRWPVAVFYNILDLAAINA---HILYKRCTKAKIS--RRKFIIELVKELCKV-----QQIAKAGWGLRVLPEVLTLPVKRKQCQIGKCSKNKTFNMCEKCRRFVC 984          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:ZFIN;Acc:ZDB-GENE-050324-2])

HSP 1 Score: 212.231 bits (539), Expect = 1.040e-58
Identity = 128/345 (37.10%), Postives = 188/345 (54.49%), Query Frame = 1
Query:  889 SYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNEGMSGRVNAANILRPS---PGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTR 1914
            S  D  SE  ++++   +PA L+ +     +T  NG VW +P+   + R     I  PS    G TR+A  RI  + V   F+L F                       ++ IL  TN  G +  +  ++ +   E+ A+ G+LIL GVYR+ GES   LW  ++GR +FR TMS  RF+LI   LRFD+  TR  R   DKL+A   + D +V+     + PGE++ +DEQL P+RGRCKF QYMPS P+KYG+K WV  D    Y W  + Y GK     +++  G+ + +DM +GL   G  VTCDNFFTS +L++ L +  + +VGTIRA++ ++P  L +
Sbjct:  263 SASDPSSESEEDIE---DPAHLNSE-----WTAKNGQVW-SPSHSKTLRY----IQAPSGMIAGPTRYAITRI--HDVASSFDLFFTP-------------------DMIQLILQMTNLHGRRSVSG-WSDVDETEIRAYMGLLILAGVYRSKGESTRSLWDDQNGRPVFRATMSHKRFQLISASLRFDDRLTRPCRHKEDKLSAFCNMWDKWVQRLPLLFNPGENICVDEQLVPFRGRCKFGQYMPSKPAKYGLKIWVTTDVATSYAWRCQVYTGKPAGGALEMGQGKRVILDMTEGL--KGVTVTCDNFFTSYSLAQELLRKKVALVGTIRANKPELPPRLKQ 570          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: si:ch211-130m23.5 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:103027433])

HSP 1 Score: 136.732 bits (343), Expect = 8.253e-33
Identity = 146/579 (25.22%), Postives = 231/579 (39.90%), Query Frame = 1
Query:  898 DTESEDADNLQVEINPADLHEQDDINRFTD--------SNGNVWVTPNEGMSGRVNAANILRPSPGITRWATQRIGENS-VLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRIL----RFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYV----GSKHKPDV------------------LLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFAL----HYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDR-RRTAAADSLSSTPCKRGD-----------CYMCID---RKRCTVTCVKCNRFICK 2466
            DT S D+D     I+ +DL E++    F          ++ + W  P++ +S     A+               +G+++  LD F LLF       + H ++         T    L    R G    +  +    + E+ A+ G+ IL G+ +     +   W+++   G   F+ TM+  RF+ + + L    R   P   KG L  D L  +R L+D         Y+P   +T+DE     +GR    QYMPS P + G+K W++CDS++ YC   R ++GK  D     + G  + M +++GL G   ++  D+FFTS+ L +RL Q+GI   G     RR  P  L           +  +      +  +  LV+ V +  KVV+ LS+  N   G V    GSK   DV                  LL Y     GVD  D+    Y     C++W   F    +++   NA+ +       V P     K   +R F + L   LI  Y   R    AA    + +P + G            C  C +   R      C  CN  +C+
Sbjct:  135 DTTSTDSD-----IDFSDLEEEEHAGLFAPYDVLDDECTSPDFWGEPDQVISIEPFTADC---------GPQHSLGDDADTLDYFRLLF---PDSLFEHMVE--------QTNNYALYRQRRSGRS--DPHWHPTDVREMRAYVGLNILMGINQLPDYGM--YWASDIFIGNAGFKKTMTARRFEKLNQNLHLCDRLSEPS--KGELGYDGLYKIRPLLDMVGNTMWDSYLPNRCLTVDECAIATKGRFSPTQYMPSKPLRKGLKVWMLCDSRSGYCHRTRLHVGKPSDDVSTAALGHRMVMSLVRGLEGRYHHLFMDSFFTSVPLLQRLLQDGIYSCGPTNPYRRGYPDALKP-------RNVGKLDPGEFYQCQRGNLVATVTRDAKVVSCLSS--NSAPGIVGIGPGSKRDGDVGDGDASSLSALGIPRPLPLLLYQENMRGVDLCDQLRECYQVGRPCKKWWRYFLWFYVNLCIVNAYIILRESRGGVPPAGFNGKEFTQRHFRVRLAQQLIGDYQGARGMERAARKRHADSPLEYGHRLERMSERSRRCRNCTNKGLRHESVFGCKICNVHLCR 673          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 8.451e-29
Identity = 119/474 (25.11%), Postives = 211/474 (44.51%), Query Frame = 1
Query: 1171 IKVIIFF*LLATMETILIETNREGSKLYNN----QFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRFDNPDT------RKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKED-DRDMQVSYGEYITMDMLQ-GLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPK-HLTRYQGREVFSTIELITTSTADRRDKALLVSYVA-KKNKVVNILSTAHNKITGYV---------GSKHK-----PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH-YLVEPQWNANKSHRRRLFLIELGNSLI---------SAYVEDRRRTAAADSLSSTPCKRGD-----CYMCIDRKRCTVTCVKCNRF 2457
            +++   F    T++T+   TN++ +K  +     ++T L + +   + G+++   + +   +SI + W  +H     +    MS +R++ I   L   +PD       +KG    DKL  ++ L+D      +  Y P +++ +DE++   + +    QYM + P K+G K +V+ DS+N Y  +   Y GK D      +SY   + M ++Q G  G+G ++  DNF++S  L + L +   +  GT R +R+  P+  +     R    +I  I       RD  ++  YV     + V++ ST H   +G +         GS  K     P  +  YN   GGVD  D+ +  Y+ + K  RW+   F + LDI+  N+F LH  L   Q    +   +R FL +L + L          +    D    A ++  S+TP  +       C  C  + R   T  KC++F
Sbjct:   79 LELFKLFFPFETVQTMCQNTNKQAAKNQSMGKKYKWTDLDVEDFYKYCGLVLYMSLVKV--DSISDYWRQDHLFSLSLPAQIMSRDRYRTISWNLHLSDPDEVVKNNRKKGTAEHDKLFQLKPLMDTIKNACKSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSYD--VVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRDNRKGCPQTDVNALTKRSERGSIRWI-------RDGPIV--YVKWMDTREVSVCSTIHPAHSGEIAQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHKELCLAQ--EKQPLTQRAFLEKLTSELCGRPLLTKSSAKSPADHVPVAISNLQSATPSDKATTGRRRCEHCQSQGRRKDTPWKCSKF 537          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 3.175e-28
Identity = 99/383 (25.85%), Postives = 178/383 (46.48%), Query Frame = 1
Query: 1183 IFF*LLATMETILIETNREGSKLYNN----QFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRFDNPD------TRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKED-DRDMQVSYGEYITMDMLQ-GLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPK-HLTRYQGREVFSTIELITTSTADRRDKALLVSYVA-KKNKVVNILSTAHNKITGYV---------GSKHK-----PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
            +FF  + T++T+   TN++ +K  +     ++T L   E   + G+++   + +   +S+ + W  +H     +    MS +R++ +   +   +PD       +KG    DKL  ++ L++      +  Y P + + +DE++   + +    QYM S P+K+G K +V+ DS+N Y  +   Y GK D      +SY   + M ++Q G  G+G ++  DNF++S  L + L +   +  GT R +R+  P+  +     R    +I  I       RD  ++  YV     + V++ ST H   +G           GS  K     P  +  YN   GGVD  D+ +  Y+ + K  RW+   F + LDI+  N+F LH
Sbjct:  192 LFF-PVQTVQTLCQNTNKQAAKNLSEGKKYKWTDLDAEEFYKYCGLVLYMALIKV--DSVSDYWRQDHLFSLSLPSQIMSRDRYRTVSWNIHLSDPDEDVHNDQKKGTAQHDKLFRLKPLMETIKNACKAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSYD--VVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRENRKGCPQTDVNALTKRSERGSIRWI-------RDGPIV--YVKWMDTRAVSMCSTIHPAHSGETVQRRVKREDGSWTKTSVPCPTPVAEYNKHMGGVDLSDQLIQCYSAQHKTMRWYRKLFYHFLDIATTNSFILH 560          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 5.670e-25
Identity = 87/344 (25.29%), Postives = 147/344 (42.73%), Query Frame = 1
Query: 1264 FTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFR-----NTMSLNRFKLIRRILRFDNPDTRKGRLLR--DKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEY---ITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQN-GITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRD-----KALLVSYVAKKNKVVNILSTAHNK--ITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
            ++  +  E+ AFF + I+ G+     + +  +W    G    R      TM+  R+  + + L   N      R  R  D +  VR +++    N  + Y P   +++DE + P++GR  F Q+MP+ P+K+GVK W +C++Q  YC N   Y G+        +       + M + +  +    ++  D +F+S  L + L    G    GT+  SRR +P        REV S +         R D     K  LV  V +  +VV  LST  +   +        KP  ++ YN   GGVD  D+    Y      ++W       +L++S  N + L+
Sbjct:    1 WSPTTSREMKAFFAVAIMMGI-----KDLPRVWCYWSGNPALRCEWVSGTMTHTRYSKVSQYLHARNNVGTPARGQRGYDPIYKVRNVVEEVRANFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSSPALLEDLRSRCGTYACGTVSLSRRGLPP-----PAREVASLLR-------HRGDFAFFQKGGLVLSVWRDKRVVATLSTNQDPRMVRPVDEGPIKPAPVVHYNRFMGGVDRSDQYRSYYAVGRASKKWWRYIVWFLLNLSIVNGWLLY 327          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.388e-22
Identity = 85/346 (24.57%), Postives = 147/346 (42.49%), Query Frame = 1
Query: 1264 FTALSLNELNAFFGILILRGVYRAAGESIDELWSA--EHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDD-RDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHK-----------------PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALH 2241
            +  ++L ++  + G+ +  GV  A+   I   WS    +    FR TMS  RFK I R     N      R   D+L  VR +++ F    +  Y P   +++DE    ++GR  F  Y P  P KYG+KF+++ ++Q  Y +N   Y+G E   R+        I   ++  L   G  +  DN++ S+ L++ L+++G+   GT+R S R  PK L      +  + +++   S   RR     V       ++V +++  HN  T     + K                 P+ +  Y     GV   D+ +  Y    K  +W        L ++  NA+ L+
Sbjct:   55 WEGVNLMDIANYLGLTMAMGV--ASLPEIPMYWSTGKPYSMPAFRETMSCKRFKSIGRFFNCHN-SCAVPRDNTDRLLQVRTVMEYFQSKFKALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKSIRN--------IVFGLMGPLLDKGYQLYMDNYYNSVKLTEELYEHGVHTCGTLRLS-RGAPKDL------QALAKMKIPRDSIHFRRKGNTFV-ICWMNTRLVTLITNIHNADTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVLYFLQMALHNAYVLY 381          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 5.801e-16
Identity = 83/384 (21.61%), Postives = 151/384 (39.32%), Query Frame = 1
Query: 1207 METILIETNREGSKLYNN-------------QFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEH--GRFIFRNTMSLNRFKLIRRILRF--DNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKED---------DRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHN----------KITGY-VGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYL 2247
            ++ I+ ETNR  ++   N             +   ++ + L+ F G++++ G+      ++   W+ +   G    R ++S  RF  ++R L    D     +GR+  D L  +R L+D+ +    + ++P   + +DE L  ++ R   +  +P+ P + GVK ++   +   Y  +L  + G  D          R+     G    M + + L+G   +V     F S  L     Q G    G +R + R  PK L   +          +       R    LV+ + K N   N+   A N          +   Y V    KP  LL YN   G VD   +    +    + R+W    F  +L+ +  N++ L+ L
Sbjct:   34 LDRIVTETNRHAARCGANMHLTGPGPGSVSGEGRPVTRSSLSTFLGVVLIMGINMLP--ALPYHWADDDSLGNQFIRRSISHKRFSFLQRYLHISDDEKAPSRGRIGYDPLHKIRPLLDHLLGAFSRHFVPFRDMRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAGGHDIVVAGGLWRRRNKSFPLGYRAAMRLTERLHGVHHHVYFGKLFGSARLLSDFLQRGTYGCGLVRPNSRGFPKELRDSR----------LQPGDTKFRQSGQLVACIHKAN-TENMAIIASNSRPESERMQRRFHNYDVEGSQKPHPLLNYNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILYRL 404          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 379.407 bits (973), Expect = 9.682e-121
Identity = 202/530 (38.11%), Postives = 306/530 (57.74%), Query Frame = 1
Query:  979 FTDSNGNV-WVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVED-----------------RRRTA---AADSLSSTPCKRGDCYMCIDR--KRCTVTCVKCNRFICKEHLHNICKNC 2496
            +   +GN+ W T      GR++++NI++ +PG TR+A  R+  + +   F L   +                     +E I+++ TN EG +++  ++ +L   +LNA+ GILIL GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR   DKLAA+R + D +VE     Y PG  VT+DE+L P+RGRC F QYMP+ P+KYG+K W  CD+++ Y W ++ Y GK      + + G  + ++M +GL   G N+TCDNFFTS  L + L +  +TM+GT+R ++ ++P  + + QGR + S+I   T       +KA +VSY  K+NK V ++ST H   +       KP ++L YN+TKGGVD +D+   TY+ + K  RW +A F NI+D+SA+NA+ L   +  +WNA K +RRRLFL ELG +LI+  ++                  + RT+   A D + +   KR  C +C  R   + + +CVKC  FIC++H    C +C
Sbjct:   78 WASKDGNIKWSTSPHQSRGRLSSSNIIKMTPGPTRFAVTRV--DDIQSAFQLFISQ--------------------PIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGKSPGGAPEKNQGMRVVLEMSEGL--QGHNITCDNFFTSYRLGEELQKRKLTMLGTVRRNKPELPSEILKIQGRPMHSSIFAFT-------EKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKLYRRRLFLEELGKALITPKIQRRARPARSPAAAAVIEKIKFRTSNQFAMDPVDTDVKKRKRCQVCPSRDDSKTSTSCVKCKNFICRKHTVTFCPSC 576          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 299.671 bits (766), Expect = 5.275e-88
Identity = 167/447 (37.36%), Postives = 249/447 (55.70%), Query Frame = 1
Query: 1216 ILIETNREGSKLYNNQFTALSLNE--LNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKIT-GYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRRRTA--------------AADSLSSTPCKRGDCYMCIDRK--RCTVTCVKCNRFICKEHLHNICKNCS 2499
            ILI TNR  +   +   T   ++E  L A+ G+LIL GVYR+ GE++  LW  E GR IF  TMSL  F      LRFD+  TR  R   D+LAAVR + + + +   + Y  G  VT+DE++ P++GRC F QY+PS P+KYG+K WV CD++  Y W ++ YMGK      + +    +  D+ +GL    RNVTCDNFFTS  L+  L +  IT++GTI++++ ++P  L   +GRE  S+    T       D A  +SYV KKNK V +LST H+++   +     KP+++L YN TKGGVD +D+ + TY+ +   +RW +A F N++D+SA+NA+ +   + P W     +RRR+FL +LG  L+   V  R+R                A  + + +  KR  C +C   K  +  ++C  C + IC+      C  CS
Sbjct:  386 ILIATNRHSADKAHALKTPKPMDEIELRAYVGLLILAGVYRSRGEALVSLWEPECGRPIFGATMSLRSFYQRSATLRFDDRSTRASRSASDRLAAVREVWEEWCDRLPRLYDIGPEVTVDERMVPFKGRCSFRQYIPSKPTKYGLKLWVACDARTSYAWRVQPYMGKLASGARETNLASRVVSDLTRGL--EHRNVTCDNFFTSYALATELLKRNITLLGTIKSNKPELPPELASARGREALSSRFAFT-------DCAAALSYVPKKNKNVLLLSTKHSRVEICHERRDKKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWREMHPDWMPWNRNRRRIFLEQLGKDLVRPLVLRRKRVPRARPAYDLMVSMQEAGGTSARSEGKRKRCQICPRSKDTKTLISCKSCGKSICRGCTVPFCPLCS 823          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 3.355e-87
Identity = 149/380 (39.21%), Postives = 220/380 (57.89%), Query Frame = 1
Query: 1399 MSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRR--------------------RTAAADSLSSTPCKRGDCYMCIDR--KRCTVTCVKCNRFICKEH 2472
            MSL  F +I R++RFDN DTR GR   DKLAA+R L D +VE     Y PG  VT+DE+L P+RGRC F QYMP+ P+KYG+K W  CD+++ Y W ++ Y GK      + + G  + ++M +GL   G N+TCDNFFTS  L + L +  + M+GT+R ++ ++P  +   QGR + S+I   T       +KA +VSY  K+NK V ++ST H   +       KP ++L YN+TKGGVD +D+   TY+ + K  RW +A F NI+D+SA+NA+ L   +  +WNA K +RR+LFL EL  +LI+  ++ R                       +A D + +   KR  C +C  R   + + +C KC  +IC++H
Sbjct:    1 MSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDLWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFQQYMPNKPAKYGIKIWAACDAKSNYAWKMQVYTGKLPGGAPEKNQGMRVVLEMSEGL--QGHNITCDNFFTSYRLGEELQKRKLIMLGTVRRNKPELPSEILNIQGRPMHSSIFAFT-------EKATVVSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKLYRRQLFLEELSKALITPKIQRRARPARSPAAAAVVKNIKFRPSNQSAMDPVDTDVKKRKRCQVCPSRDDSKTSTSCAKCKNYICRKH 371          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000038522.1 (pep primary_assembly:ASM223467v1:10:9345195:9347118:-1 gene:ENSORLG00000027882.1 transcript:ENSORLT00000038522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 4.228e-29
Identity = 117/455 (25.71%), Postives = 199/455 (43.74%), Query Frame = 1
Query: 1207 METILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGK--EDDRDMQVSYGEYITMDMLQGLYGSGRN-VTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVS----YVAK--KNKVVNILST---AH--NKITGYVGSKHK------PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIE--LGNSLISAYVEDRRRTAAADSLSSTPCKRGDC---YMCIDRK--RCTVT---------CVKCNRFIC 2463
            +E ++ ++N    +   N+   L+  EL  F G  +   ++   G  +   W+         +TMSLNR++ I++ L F+N + R+G  + D L  +R L+ +     Q   M GE + +DEQ+ P++GR +  QY+P+ P K+G K  V+  S      N   Y G+  +      V     + + + Q +    ++ +  DN+FTS+ L   L Q GI   GT+R++         R  G  +    EL  T       K  +V     +  K   N+ V++LS    AH    +  + G + K      P V+  YN   GGVD +D  +  Y TK +  +W+     + +D++   A+ L+         +K  + RL+  +  +G SL     + +RR   A  +   P  R D    +M +D K  RC V          C KC+  +C
Sbjct:  115 LEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRM--FWNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENV-DHLHKIRPLVTHLTSKLQTIPM-GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSDGVPH-NFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSN---------RLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSNKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLYTFKSYIGESL----CKKKRRRGPATPI-PVPEVRLDATAHWMVMDEKKGRCKVPGCKGTPKAKCQKCDVRLC 550          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000047092.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111948922])

HSP 1 Score: 122.865 bits (307), Expect = 1.134e-28
Identity = 118/462 (25.54%), Postives = 202/462 (43.72%), Query Frame = 1
Query: 1207 METILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGK--EDDRDMQVSYGEYITMDMLQGLYGSGRN-VTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVS----YVAK--KNKVVNILST---AH--NKITGYVGSKHK------PDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLF---------LIELGNSLISAYVEDRRRTAAADSLSSTPCKRGDC---YMCIDRK--RCTVT---------CVKCNRFIC 2463
            +E ++ ++N    +   N+   L+  EL  F G  +   ++   G  +   W+         +TMSLNR++ I++ L F+N + R+G  + D L  +R L+ +     Q   M GE + +DEQ+ P++GR +  QY+P+ P K+G K  V+  S      N   Y G+  +      V     + + + Q +    ++ +  DN++TS+ L   L Q GI   GT+R++R  +P       G  +    EL  T       K  +V     +  K   N+ V++LS    AH    +  + G + K      P V+  YN   GGVD +D  +  Y TK + ++W+     + +D++   A+ L+         +K  + RL+         L + G +L     + RRR  A  +    P  R D    +M +D K  RC V          C KC+  +C
Sbjct:  115 LEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRM--FWNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENV-DPLHKIRPLVTHLTSKLQTIPM-GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSDGVQH-NFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWYTSVPLILTLAQQGIHCAGTVRSNR--LP-------GVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSKKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLYTFKSYIGESLCKSGKNLEHKRGQKRRRGPA--TPIPVPDVRLDATAHWMVMDEKKGRCKVPGCKGTPKAKCQKCDVRLC 560          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000080622.1 (SMESG000080622.1)

HSP 1 Score: 381.719 bits (979), Expect = 1.567e-124
Identity = 178/188 (94.68%), Postives = 181/188 (96.28%), Query Frame = 1
Query: 1312 ILR---GVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMV 1866
            ILR   G+YRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDK AAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPS PSKYG+KFW VCDSQNYYCWNLRFYMGKEDDRDMQVS GEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITM+
Sbjct:  102 ILRPSPGIYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKFAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSKPSKYGLKFWAVCDSQNYYCWNLRFYMGKEDDRDMQVSCGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITML 289          

HSP 2 Score: 212.231 bits (539), Expect = 5.348e-61
Identity = 116/148 (78.38%), Postives = 123/148 (83.11%), Query Frame = 1
Query:  748 MSSHPRAAKAFALRAILGEXXXXXXDNEVVLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNEGMSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF 1191
            MSSHPRAAKAFALRAILGESSSSSSDNEVVLE DDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPN+GMSGRVNAANILRPSPGI R A + I E    +    +F    S+     I+ I+ F
Sbjct:    1 MSSHPRAAKAFALRAILGESSSSSSDNEVVLEVDDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNKGMSGRVNAANILRPSPGIYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRF 148          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000068757.1 (SMESG000068757.1)

HSP 1 Score: 360.533 bits (924), Expect = 3.607e-113
Identity = 183/201 (91.04%), Postives = 187/201 (93.03%), Query Frame = 1
Query:  517 QVSSNNARDTYN*QLILEPMNVSHNNILSRSFSPGFVHAFVCTLSYSHYKCVSVVLEYNIYTSRVEGLLLHKHITIDMSSHPRAAKAFALRAILGEXXXXXXDNEVVLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNEGMSGRVNAANILRPSPG---------ITRWATQ 1092
            QVSSNNARDTYN QLILEPMNVSHNNILSR FSPGFVHAFVCTLSYSHYKCVSVVLEYNIYTSRVEGLLLHKHITIDMSSHPRAAKAFALRAILGESSSSSSDNEVVLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVT NEGMSGRV+AANILRPSPG         +T+W  +
Sbjct:  216 QVSSNNARDTYNGQLILEPMNVSHNNILSRFFSPGFVHAFVCTLSYSHYKCVSVVLEYNIYTSRVEGLLLHKHITIDMSSHPRAAKAFALRAILGESSSSSSDNEVVLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTLNEGMSGRVSAANILRPSPGSFIMLQKVELTQWTKE 416          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000038294.1 (SMESG000038294.1)

HSP 1 Score: 288.115 bits (736), Expect = 5.718e-89
Identity = 135/166 (81.33%), Postives = 145/166 (87.35%), Query Frame = 1
Query: 1438 RFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITM---VGTIRASRRDIPKHLTRYQGR 1926
            RFDNPDTRKG LLRDKL  VRLLIDNFVENSQKCY+PGESVTIDEQLYPYRGRCKFVQYM S PSKYG+KFW VCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYG+G+NVTCD FFTSLNLSKRLFQNGITM    G + A    +  + T+++ R
Sbjct:   96 RFDNPDTRKGMLLRDKLPDVRLLIDNFVENSQKCYLPGESVTIDEQLYPYRGRCKFVQYMTSKPSKYGLKFWAVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGNGKNVTCDKFFTSLNLSKRLFQNGITMNATKGGVDAMDERVATYTTKFKCR 261          

HSP 2 Score: 273.092 bits (697), Expect = 2.108e-83
Identity = 126/132 (95.45%), Postives = 128/132 (96.97%), Query Frame = 1
Query: 2104 NATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISAYVEDRRRTAAADSLSSTPCKRGDCYMCIDRKRCTVTCVKCNRFICKEHLHNICKNCS 2499
            NATKGGVDAMDERV TYTTKFKCRRWHVAFFCNILDIS FNAFALHYLVEPQWNANKSHRRRLFLIELGN+LISAYVEDRRRTAAA+SLSSTPC RGDCYMCIDRKRCTVTCVKCNRFICKEHLHNIC NCS
Sbjct:  238 NATKGGVDAMDERVATYTTKFKCRRWHVAFFCNILDISEFNAFALHYLVEPQWNANKSHRRRLFLIELGNNLISAYVEDRRRTAAANSLSSTPCNRGDCYMCIDRKRCTVTCVKCNRFICKEHLHNICMNCS 369          

HSP 3 Score: 171.4 bits (433), Expect = 1.333e-46
Identity = 90/98 (91.84%), Postives = 92/98 (93.88%), Query Frame = 1
Query:  748 MSSHPRAAKAFALRAILGEXXXXXXDNEVVLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNEGMSGRVN 1041
            MSSHPRAAKAFALRA LGESSSSSSDNEV+LEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINP  LHEQDDINRF DS GNVWVTPNEGMSGR +
Sbjct:    1 MSSHPRAAKAFALRATLGESSSSSSDNEVLLEADDVHEIKSNDEEQLSYDDTESEDADNLQVEINPTALHEQDDINRFNDSIGNVWVTPNEGMSGRFD 98          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000032747.1 (SMESG000032747.1)

HSP 1 Score: 286.574 bits (732), Expect = 7.357e-86
Identity = 140/150 (93.33%), Postives = 141/150 (94.00%), Query Frame = 1
Query: 1879 ASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISA 2328
            A RRDI KHLT YQ RE FSTIELITTSTADRRDK LLVSYVAKK+KV NILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERV TYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLIS 
Sbjct:   10 ALRRDIRKHLTMYQEREGFSTIELITTSTADRRDKTLLVSYVAKKSKVANILSTAHNKITGYVGSKHKPDVLLFYNATKGGVDAMDERVATYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFLIELGNSLISV 159          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 268.47 bits (685), Expect = 2.558e-80
Identity = 162/443 (36.57%), Postives = 232/443 (52.37%), Query Frame = 1
Query: 1225 ETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWVVCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCDNFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELITTSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGY-VGSKHKPDVLLFYNATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHR----RRLFLIELGNSLISAYVEDR------------RRTAAADSLSSTPC--------KRGDCYMCIDRKRCTVT--CVKCNRFICKEH 2472
            ++  E    Y + FT +   E+ A  GI+IL GV  +  ES+++LW   +GR + R T+ LNRF++     RFD+  TR  R   DK AA+R L D+FV+N Q+ Y P   + +DE    +RG C F  Y+PS P +YG+K W +CD+  +Y  NL+ Y+GK+  +  +   G  +   ++  LY SGRNVT DNFFTS +L + L    IT++GT+R SR +IP      + RE F +    T  TA       LVSY   KN+ V +LST HN+   +  G   KP ++L YN TKG VDA D+ V  Y+   K R+W +  F  I+D S  NAF L  +  P W  ++  R    RRLFL +  +SL+   +  R             R   A  +  TP         KRG C  C  ++   V   C KC++F+C +H
Sbjct:   19 QSTAEKDPKYLDDFTIV---EMKAAVGIMILVGVMCSKKESLNQLWFEVYGRPLLRTTIPLNRFRIFLSSARFDDKTTRNDRQKTDKFAAIRELFDHFVDNRQELYTPSPYLCVDETQVEFRGGCPFRVYIPSKPDRYGIKVWSLCDNGTHYVTNLQVYLGKK-GQSPKHQQGTRVVKQLMLPLYNSGRNVTTDNFFTSYDLGQFLLSQNITLLGTMRKSRTEIPPEFLS-KSREEFESKFAFTKDTA-------LVSYAPPKNRTVVLLSTMHNRPVVFDDGRGRKPYMVLDYNMTKGAVDAFDQEVSFYSFAHKTRQWPMRLFYFIIDASCLNAFVLLNMNNPTWKDHEGSRRLDKRRLFLTKAAHSLMKPMIIARADNKSISHKPSVARAILAVGVKPTPSTLPGQVAKKRGRCQSCSRKQEQKVKHRCTKCSQFVCGKH 449          
The following BLAST results are available for this feature:
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGBD41.239e-2828.37piggyBac transposable element derived 4 [Source:HG... [more]
PGBD26.348e-1525.34piggyBac transposable element derived 2 [Source:HG... [more]
ERCC64.117e-1322.01ERCC excision repair 6, chromatin remodeling facto... [more]
PGBD17.138e-1221.76piggyBac transposable element derived 1 [Source:HG... [more]
ERCC61.090e-1122.01ERCC excision repair 6, chromatin remodeling facto... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG131515.125e-726.17gene:FBgn0033750 transcript:FBtr0087939[more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01072083.27.193e-9136.82dual specificity phosphatase 26 [Source:NCBI gene;... [more]
CABZ01069162.15.713e-3025.27pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
si:ch211-130m23.57.357e-3025.42si:ch211-130m23.5 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
pgbd42.375e-2625.28piggyBac transposable element derived 4 [Source:ZF... [more]
si:dkey-19f4.29.146e-2324.18si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr25.234e-6834.88neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-... [more]
dnah83.837e-2727.45dynein, axonemal, heavy chain 8 [Source:Xenbase;Ac... [more]
ENSXETT00000039631.17.210e-2729.09pep primary_assembly:Xenopus_tropicalis_v9.1:1:681... [more]
ENSXETT00000022905.17.483e-2727.45pep primary_assembly:Xenopus_tropicalis_v9.1:4:631... [more]
ENSXETT00000019443.18.173e-2726.72pep primary_assembly:Xenopus_tropicalis_v9.1:2:309... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN5.952e-2828.37PiggyBac transposable element-derived protein 4 OS... [more]
sp|Q6P3X8|PGBD2_HUMAN3.048e-1425.34PiggyBac transposable element-derived protein 2 OS... [more]
sp|Q8N328|PGBD3_HUMAN1.977e-1222.01PiggyBac transposable element-derived protein 3 OS... [more]
sp|Q96JS3|PGBD1_HUMAN3.428e-1121.76PiggyBac transposable element-derived protein 1 OS... [more]
sp|P0DP91|ERPG3_HUMAN5.233e-1122.01Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=96... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DYR71.896e-14141.41DDE_Tnp_1_7 domain-containing protein OS=Macrostom... [more]
A0A3B3INT32.572e-11738.11DDE_Tnp_1_7 domain-containing protein OS=Oryzias l... [more]
A0A146PBZ22.781e-11736.46PiggyBac transposable element-derived protein 3 OS... [more]
A0A3Q2ZEU43.518e-11736.01DDE_Tnp_1_7 domain-containing protein OS=Kryptoleb... [more]
A0A0V0RHU91.208e-11538.16PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039501.14.821e-5932.87pep primary_assembly:Astyanax_mexicanus-2.0:19:215... [more]
nsd31.040e-5837.10nuclear receptor binding SET domain protein 3 [Sou... [more]
si:ch211-130m23.58.253e-3325.22piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000025849.28.451e-2925.11pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000030524.13.175e-2825.85pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007705.15.670e-2525.29pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000002004.11.388e-2224.57pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000001816.15.801e-1621.61pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037833.19.682e-12138.11piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000029842.15.275e-8837.36piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000027888.13.355e-8739.21pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
ENSORLT00000038522.14.228e-2925.71pep primary_assembly:ASM223467v1:10:9345195:934711... [more]
ENSORLT00000047092.11.134e-2825.54piggyBac transposable element-derived protein 2-li... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080622.11.567e-12494.68SMESG000080622.1[more]
SMESG000068757.13.607e-11391.04SMESG000068757.1[more]
SMESG000038294.15.718e-8981.33SMESG000038294.1[more]
SMESG000032747.17.357e-8693.33SMESG000032747.1[more]
SMESG000081807.12.558e-8036.57SMESG000081807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021837 ID=SMED30021837|Name=piggyBac transposable element-derived protein 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2730bp
GTTATTCTGTTTTGAGAAAAAATGAACATTTTTGTCCAAAATTCATTGTG
TATTAGTTTTTAGCTTTTTCAGTTGACAATTCATGTCATATTTTCTGGCA
TAGGCGTTAACTCATTTCAACAAATACTGGCGTTAAAATGAAGCTGATCA
GACTTTTTTAAACAATTATTGTGACTGGCTGACACTATGATATGTTTATC
ACATGATGGCGGATGGAGTTCTTACAATAGAGTTCATTGATTACATATCT
CTCCATCTCTGCTTTGGCAGGAATGGTCTTCCATTAACCACTCTCTGACC
ATAAGTTGCTTTAGCCTACACACAAGAGAAATTTAATGTAGTATCCGTCT
CACCAACATCTTCAAAAAAGTTCTGCATTCATATTAGTTAGCTTATTCGC
TCTCGTCTATTTTGTGAAGTAGGCAGACTATACCATTTTACACTCATGAC
ATTGGTACTCTGTCTGTCTCTCTCTACTCATCCCCCACACACAGACGCAC
TTAGAATACCTCATTTCAGGTATCAAGTAATAATGCACGTGACACTTACA
ATTGACAATTGATATTGGAACCAATGAATGTCTCACATAATAATATTCTC
TCACGATCTTTCTCACCTGGATTTGTTCATGCGTTTGTCTGCACTTTGTC
ATACTCTCATTATAAGTGTGTGAGTGTCGTGTTAGAATACAACATTTATA
CTAGTAGGGTAGAGGGTTTGCTACTACATAAACATATCACAATTGACATG
AGTTCTCATCCACGAGCGGCAAAAGCATTTGCTCTACGTGCTATCCTAGG
AGAAAGTTCTAGTAGCAGTAGTGATAATGAAGTTGTGCTGGAAGCTGACG
ATGTACATGAAATCAAAAGTAATGACGAAGAACAGCTGTCTTATGACGAT
ACTGAAAGTGAGGATGCTGACAATCTACAAGTTGAAATCAATCCAGCTGA
TCTTCATGAACAAGATGATATCAATAGATTCACCGATTCTAATGGAAATG
TATGGGTTACACCTAATGAAGGCATGTCAGGTCGAGTAAACGCAGCAAAC
ATTCTCCGCCCATCCCCTGGTATAACCCGTTGGGCTACTCAAAGGATTGG
GGAAAATTCCGTGTTAGACTGCTTTAATCTTCTATTCATAAAATGTAAGT
CAATTTATTATGTACACTAAATAAAAGTTATAATATTCTTTTGACTTTTA
GCAACAATGGAAACAATTTTGATTGAGACAAATCGAGAAGGATCAAAGTT
GTATAACAACCAATTTACAGCGCTCTCGTTAAATGAGTTGAATGCCTTTT
TTGGCATTCTCATTCTTCGAGGAGTATATCGTGCTGCTGGAGAAAGTATA
GATGAATTGTGGTCAGCTGAACATGGACGTTTTATCTTCCGGAATACTAT
GTCTCTCAATCGATTTAAACTTATCCGACGTATTCTGCGGTTTGATAATC
CCGACACAAGAAAAGGAAGGCTGTTACGTGATAAATTGGCGGCTGTTAGA
TTGCTGATCGATAATTTTGTTGAAAATAGCCAAAAGTGTTATATGCCCGG
TGAATCTGTCACTATAGACGAGCAACTTTATCCATACCGTGGACGTTGCA
AATTTGTTCAATATATGCCCTCTATACCATCCAAATACGGCGTAAAATTT
TGGGTTGTTTGTGACTCACAAAACTATTATTGCTGGAATCTACGTTTTTA
TATGGGAAAAGAAGATGATCGGGATATGCAAGTGTCGTACGGTGAGTATA
TAACAATGGATATGTTGCAGGGACTATATGGTAGTGGAAGAAATGTAACG
TGTGACAACTTTTTCACATCATTGAATTTATCAAAGCGATTGTTCCAAAA
TGGTATCACCATGGTAGGCACCATTCGTGCATCGAGGCGTGACATACCAA
AGCATTTGACGAGGTACCAGGGGCGTGAAGTTTTTTCAACTATTGAATTG
ATAACAACAAGTACAGCAGATCGTAGAGATAAAGCCTTGTTGGTTAGTTA
TGTTGCTAAAAAGAACAAAGTTGTCAATATCTTATCTACTGCCCATAACA
AAATAACTGGATATGTCGGTTCAAAGCATAAACCGGACGTACTTCTCTTT
TATAATGCTACAAAAGGTGGAGTTGACGCAATGGACGAAAGAGTTGTAAC
ATATACTACAAAGTTTAAATGTCGAAGATGGCATGTGGCATTCTTTTGTA
ATATATTAGACATCTCAGCATTCAATGCATTTGCCTTGCACTATCTTGTG
GAGCCTCAATGGAATGCGAACAAGTCACATAGACGAAGGCTATTCCTGAT
TGAACTTGGTAACAGTTTAATAAGTGCGTATGTAGAAGACAGAAGAAGGA
CTGCTGCCGCCGACTCTCTATCGTCGACTCCATGTAAGCGTGGTGACTGC
TACATGTGTATTGATCGAAAACGGTGCACTGTCACATGTGTTAAATGTAA
CAGATTTATATGCAAAGAACATTTACACAACATTTGTAAGAATTGCTCAT
AAATTATAGCTTTATTTCTTGGTATTCTGTCATTTTTGTGTACTTGGACA
TTTTTGTCCAAAATGAACAAAATCGTTGATTTTTATTTCCATCGTTTGCG
GGTTAAATTACAGAAGAAAGAGGAACGCTCTATGAAATCACCGTTCGCAT
CAAATATTTTCCGGAATTAGAGCATACTTACTTCACCTCTAGCCAAAATT
CAACTTCTTCAAGTTCAAATAAAGATTTAA
back to top

protein sequence of SMED30021837-orf-1

>SMED30021837-orf-1 ID=SMED30021837-orf-1|Name=SMED30021837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MNVSHNNILSRSFSPGFVHAFVCTLSYSHYKCVSVVLEYNIYTSRVEGLL
LHKHITIDMSSHPRAAKAFALRAILGESSSSSSDNEVVLEADDVHEIKSN
DEEQLSYDDTESEDADNLQVEINPADLHEQDDINRFTDSNGNVWVTPNEG
MSGRVNAANILRPSPGITRWATQRIGENSVLDCFNLLFIKCKSIYYVH*
back to top

protein sequence of SMED30021837-orf-2

>SMED30021837-orf-2 ID=SMED30021837-orf-2|Name=SMED30021837-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
METILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDE
LWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLL
IDNFVENSQKCYMPGESVTIDEQLYPYRGRCKFVQYMPSIPSKYGVKFWV
VCDSQNYYCWNLRFYMGKEDDRDMQVSYGEYITMDMLQGLYGSGRNVTCD
NFFTSLNLSKRLFQNGITMVGTIRASRRDIPKHLTRYQGREVFSTIELIT
TSTADRRDKALLVSYVAKKNKVVNILSTAHNKITGYVGSKHKPDVLLFYN
ATKGGVDAMDERVVTYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEP
QWNANKSHRRRLFLIELGNSLISAYVEDRRRTAAADSLSSTPCKRGDCYM
CIDRKRCTVTCVKCNRFICKEHLHNICKNCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane