FERM domain-containing protein

Overview
NameFERM domain-containing protein
Smed IDSMED30021833
Length (bp)2206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FERM domain-containing protein (SMED30021833) t-SNE clustered cells

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30021833) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FERM domain-containing protein (SMED30021833) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30021833) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021833

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 SmedASXL_014905SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 dd_Smed_v4_9230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 dd_Smed_v4_9230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 dd_Smed_v4_9230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 dd_Smed_v6_9230_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021833SMESG000037988.1 SMESG000037987.1 SMESG000037405.1 dd_Smed_v4_9230_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 150.984 bits (380), Expect = 3.136e-38
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYS--SKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 151.369 bits (381), Expect = 5.554e-38
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYS--SKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 141.739 bits (356), Expect = 2.544e-35
Identity = 118/332 (35.54%), Postives = 173/332 (52.11%), Query Frame = 1
Query:  211 NDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    2 DAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYS--SKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 310          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: EPB41L1 (erythrocyte membrane protein band 4.1 like 1 [Source:HGNC Symbol;Acc:HGNC:3378])

HSP 1 Score: 142.124 bits (357), Expect = 1.439e-34
Identity = 118/368 (32.07%), Postives = 185/368 (50.27%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFN 1254
            +C + +LD ++  Y   +  +  G VL D VC  L  ++EKDYFGL F D   Q+ WL+ +K I KQI+  ++P N   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +QAE+G++D  +   N +  ++L+  P+  R+ E +I+ +H+T + +   EAE  FLE A KL  YGV+    KD +G ++ +GV  +G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  +A  LWK  ++   FF L     +      G L    K   +SG +Q + T+    L   P P   R+ S    MS   + + F+
Sbjct:   67 ICRVTLLDASE--YECEVEKHGRGQVLFDLVCEHLN-LLEKDYFGLTFCDADSQKNWLDPSKEIKKQIR--SSPWN---FAFTVKFYPPDPAQ-LTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYV--SELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFEST-----------IGFKLPNHRSAKRLWKVCIEHHTFFRL----VSPEPPPKGFLVMGSKFR-YSGRTQAQ-TRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFS 406          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD3 (FERM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24125])

HSP 1 Score: 140.584 bits (353), Expect = 1.510e-34
Identity = 136/388 (35.05%), Postives = 207/388 (53.35%), Query Frame = 1
Query:  115 RNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            R+ S  +  +++ C I +LD ++ +    I     G  L+D +C+    ++EKDYFG+R++D   QR WLE NK I KQ+K   +P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+ S ++   + A I+QAE+G++D  +  EN I  ++ +I P  ++K E KI+ IH+  L+      AE   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W ++ KL +  K F   V   Q E            +K +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V RA     +  SR+ S + N+ L+ N
Sbjct:   21 RSSSVKSLSQEMRCTIRLLDDSEIS--CHIQRETKGQFLIDHICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMK--THPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYI--SEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFY--VIGTQKE------------KKAMLAFHT-STPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFR-YSGKVAKEVVEASSKIQREP-PEVHRA----NITQSRS-SHSLNKQLIIN 376          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-4 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:H2KYZ6])

HSP 1 Score: 114.39 bits (285), Expect = 4.193e-26
Identity = 94/292 (32.19%), Postives = 147/292 (50.34%), Query Frame = 1
Query:  226 VLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGN-ELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHK---MFMFQVYMDQIEIV--EETFFWGH------------LKRKHILGFKCESTYAACALWKWALDRKCFF 1047
             +LD VC QL  I EKD+ GLR+ D H  R WL+L + I+  +  KN    +     RF++YP  P + L+    RY L++QL+RDL  GRL   ++   ++AALILQA++G+++      N   ++  K+L     K E +I   H+ LK   ++ AE +FLE+A++L TY  +P  +K+      +++G    GI  ++G  RTH   W  ++K+ YS K   + + + Y  QI           GH             K+   L + C S   A  LW   L ++ FF
Sbjct:   53 TILDYVC-QLKHIQEKDFLGLRYQDHHKHRYWLDLTRSINHVV--KNFKTESMTLHLRFRYYPSDPAR-LRDPNLRYQLFVQLQRDLLHGRLYCPTSSAAELAALILQAQLGDYNEEKHVGN--YVSGYKLLLKQTPKLEERIANNHKELKGKSSESAELEFLEKASQLDTYAFDPYTIKEPHDTLPVYIGASCKGILIYTGQSRTHNIDWSELVKVDYSGKEIRLTLSENYRGQITAAGTPTGTLNGHGPGSPSIMDKSLTKKPLTLKYTCPSGQFAKHLWIHILSQQAFF 338          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-4 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:H2KYZ6])

HSP 1 Score: 112.849 bits (281), Expect = 1.402e-25
Identity = 94/298 (31.54%), Postives = 148/298 (49.66%), Query Frame = 1
Query:  226 VLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKD------KNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGN-ELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHK---MFMFQVYMDQIEIV--EETFFWGH------------LKRKHILGFKCESTYAACALWKWALDRKCFF 1047
             +LD VC QL  I EKD+ GLR+ D H  R WL+L + I+  +K+      K     +     RF++YP  P + L+    RY L++QL+RDL  GRL   ++   ++AALILQA++G+++      N   ++  K+L     K E +I   H+ LK   ++ AE +FLE+A++L TY  +P  +K+      +++G    GI  ++G  RTH   W  ++K+ YS K   + + + Y  QI           GH             K+   L + C S   A  LW   L ++ FF
Sbjct:   53 TILDYVC-QLKHIQEKDFLGLRYQDHHKHRYWLDLTRSINHVVKNFKKEIKKVGKTESMTLHLRFRYYPSDPAR-LRDPNLRYQLFVQLQRDLLHGRLYCPTSSAAELAALILQAQLGDYNEEKHVGN--YVSGYKLLLKQTPKLEERIANNHKELKGKSSESAELEFLEKASQLDTYAFDPYTIKEPHDTLPVYIGASCKGILIYTGQSRTHNIDWSELVKVDYSGKEIRLTLSENYRGQITAAGTPTGTLNGHGPGSPSIMDKSLTKKPLTLKYTCPSGQFAKHLWIHILSQQAFF 346          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-4 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:H2KYZ6])

HSP 1 Score: 112.464 bits (280), Expect = 1.590e-25
Identity = 94/298 (31.54%), Postives = 148/298 (49.66%), Query Frame = 1
Query:  226 VLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKD------KNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGN-ELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHK---MFMFQVYMDQIEIV--EETFFWGH------------LKRKHILGFKCESTYAACALWKWALDRKCFF 1047
             +LD VC QL  I EKD+ GLR+ D H  R WL+L + I+  +K+      K     +     RF++YP  P + L+    RY L++QL+RDL  GRL   ++   ++AALILQA++G+++      N   ++  K+L     K E +I   H+ LK   ++ AE +FLE+A++L TY  +P  +K+      +++G    GI  ++G  RTH   W  ++K+ YS K   + + + Y  QI           GH             K+   L + C S   A  LW   L ++ FF
Sbjct:   53 TILDYVC-QLKHIQEKDFLGLRYQDHHKHRYWLDLTRSINHVVKNFKKEIKKVGKTESMTLHLRFRYYPSDPAR-LRDPNLRYQLFVQLQRDLLHGRLYCPTSSAAELAALILQAQLGDYNEEKHVGN--YVSGYKLLLKQTPKLEERIANNHKELKGKSSESAELEFLEKASQLDTYAFDPYTIKEPHDTLPVYIGASCKGILIYTGQSRTHNIDWSELVKVDYSGKEIRLTLSENYRGQITAAGTPTGTLNGHGPGSPSIMDKSLTKKPLTLKYTCPSGQFAKHLWIHILSQQAFF 346          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 104.375 bits (259), Expect = 6.291e-23
Identity = 96/307 (31.27%), Postives = 149/307 (48.53%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDK-HGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEF--DMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGV---EPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            + ++++ D  Q  +   +N N  G  L  +V   L  I E++YF L F DK  G R WL  +K I+KQIK          FSF  K YP  P   +  D +RY ++LQLRRDL  GRL  +++    + + + Q E G+   +M D  E  I  + L      N +   KI+ +H  ++     EAE QFL+    L  YG+   + I  KD+K  ++ +G    GI+ +   ++TH+F W+NI+K+ Y    F  ++    +E  E+T +           FK  +  AA   WK A++   FF L
Sbjct:   26 LAKVLLPDGVQKEF--EVNKNSEGEALFRQVTRDLS-IEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGL-----PWEFSFEVKFYPTTPTT-IVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAA--GINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLY-----------FKLPNHVAAKRTWKCAVEHHTFFRL 310          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 104.375 bits (259), Expect = 6.291e-23
Identity = 96/307 (31.27%), Postives = 149/307 (48.53%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDK-HGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEF--DMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGV---EPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            + ++++ D  Q  +   +N N  G  L  +V   L  I E++YF L F DK  G R WL  +K I+KQIK          FSF  K YP  P   +  D +RY ++LQLRRDL  GRL  +++    + + + Q E G+   +M D  E  I  + L      N +   KI+ +H  ++     EAE QFL+    L  YG+   + I  KD+K  ++ +G    GI+ +   ++TH+F W+NI+K+ Y    F  ++    +E  E+T +           FK  +  AA   WK A++   FF L
Sbjct:   26 LAKVLLPDGVQKEF--EVNKNSEGEALFRQVTRDLS-IEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGL-----PWEFSFEVKFYPTTPTT-IVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAA--GINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLY-----------FKLPNHVAAKRTWKCAVEHHTFFRL 310          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: CG5022 (gene:FBgn0032225 transcript:FBtr0079999)

HSP 1 Score: 139.428 bits (350), Expect = 2.182e-34
Identity = 98/290 (33.79%), Postives = 151/290 (52.07%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCK-----------DLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIE-AKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            GI LL+ +C +L  I EKDYFGLR++D   QR WL+L+K I KQ K+ +      +FS R K YP  P +            LK+DL    LY              S  E   + ALI+Q E+G+++  D+   S  ++ +++        E KI+ +H+  +  +    A  +FL  A  L+TYG++P PVKD +G++ +VG+   GISTF   KR+  F W  I K+++  KMF+   ++   +   E        +KH +GFKC +  A   LW+ A+++  FFTL
Sbjct:   35 GIYLLEYLCGELE-IKEKDYFGLRYVDSSKQRHWLDLSKSIIKQCKEMD----PLLFSLRVKFYPADPFRLTGNARIMLYQQLKRDLRHGRLYC-------------SLGEAAALGALIVQEELGDYN-EDVHVGSY-VSSIELALRQTECLEKKIIELHKKREPGQNLSLAMDEFLGIARGLETYGIDPHPVKDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEGKMFI--AHLSYTDASREP-------KKHTVGFKCPTGAACRYLWRCAIEQMLFFTL 295          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086506)

HSP 1 Score: 130.183 bits (326), Expect = 6.197e-31
Identity = 97/301 (32.23%), Postives = 156/301 (51.83%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            +  + +LD +  +  VSI+    G  +++ +C+ L  +IEKDYFGL +      R WL+L KP+SK  +    P      +F  K YP  P + LK+D++RY L LQ+R D+  GRL  +      + + ++Q+E+G++D  ++   +  + D KI P+   + E K++ +H+T K     EAE  +LE A KL  YGV+  P KD +G ++ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L
Sbjct:   33 LARVTLLDGSLLD--VSIDRKAIGRDVINSICAGLN-LIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWP-----LTFAVKFYPPEPSQ-LKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAY-LKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYEST-----------IGFKLANHRAAKKLWKSCVEHHTFFRL 312          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0301279)

HSP 1 Score: 130.183 bits (326), Expect = 6.319e-31
Identity = 97/301 (32.23%), Postives = 156/301 (51.83%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            +  + +LD +  +  VSI+    G  +++ +C+ L  +IEKDYFGL +      R WL+L KP+SK  +    P      +F  K YP  P + LK+D++RY L LQ+R D+  GRL  +      + + ++Q+E+G++D  ++   +  + D KI P+   + E K++ +H+T K     EAE  +LE A KL  YGV+  P KD +G ++ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L
Sbjct:   33 LARVTLLDGSLLD--VSIDRKAIGRDVINSICAGLN-LIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWP-----LTFAVKFYPPEPSQ-LKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAY-LKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYEST-----------IGFKLANHRAAKKLWKSCVEHHTFFRL 312          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086508)

HSP 1 Score: 129.028 bits (323), Expect = 2.187e-30
Identity = 97/301 (32.23%), Postives = 156/301 (51.83%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            +  + +LD +  +  VSI+    G  +++ +C+ L  +IEKDYFGL +      R WL+L KP+SK  +    P      +F  K YP  P + LK+D++RY L LQ+R D+  GRL  +      + + ++Q+E+G++D  ++   +  + D KI P+   + E K++ +H+T K     EAE  +LE A KL  YGV+  P KD +G ++ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L
Sbjct:   33 LARVTLLDGSLLD--VSIDRKAIGRDVINSICAGLN-LIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWP-----LTFAVKFYPPEPSQ-LKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAY-LKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYEST-----------IGFKLANHRAAKKLWKSCVEHHTFFRL 312          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340468)

HSP 1 Score: 127.872 bits (320), Expect = 8.719e-30
Identity = 95/286 (33.22%), Postives = 150/286 (52.45%), Query Frame = 1
Query:  196 VSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            VSI+    G  +++ +C+ L  +IEKDYFGL +      R WL+L KP+SK  +      +T   +F  K YP  P + LK+D++RY L LQ+R D+  GRL  +      + + ++Q+E+G++D  ++   +  + D KI P+   + E K++ +H+T K     EAE  +LE A KL  YGV+  P KD +G ++ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L
Sbjct:   46 VSIDRKAIGRDVINSICAGLN-LIEKDYFGLTYETPTDPRTWLDLEKPVSKFFR-----TDTWPLTFAVKFYPPEPSQ-LKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAY-LKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYEST-----------IGFKLANHRAAKKLWKSCVEHHTFFRL 312          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: FRMD5 (si:ch211-69m14.1 [Source:ZFIN;Acc:ZDB-GENE-050419-226])

HSP 1 Score: 150.984 bits (380), Expect = 3.859e-38
Identity = 128/367 (34.88%), Postives = 190/367 (51.77%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS      E + +C + +LD   T Y  +I  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K ISKQ+K  + P  T     R K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E +I  IH+T L     + +E +FL++A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K   F +Y +Q E            +K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:    4 SRLMSGSVRNLEREYMCTVRLLD--DTEYTCTIQRDAKGQYLFDLICHHLN-LLEKDYFGIRYVDPDKQRHWLEFTKSISKQMK--SQPPFT--MCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELKFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGK--TFHIYANQKE-----------DKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMEQSAKIKREP-PEIHRA 345          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd3 (FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070523-1])

HSP 1 Score: 143.665 bits (361), Expect = 6.514e-37
Identity = 130/393 (33.08%), Postives = 202/393 (51.40%), Query Frame = 1
Query:  100 KSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            K  + R+ S  +   +L C + +LD ++ +   SI  +  G  L+D VC+    ++EKDYFG+R++D   QR WL+ +KP+ KQ+K +          FR K YP+ P K +K++L+RYLLYLQL+RD+Y GRL+    +   + A I+QAE+G++D  +   + I  +D K+ P  + K E KI+ IH+  L+      AE   L+ A  L TYGV+P P KD  G+  F+G    G   F G+KR H   W ++ K  +  K F                    + +K +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V R Q       SR+ +S  ++ L+ N
Sbjct:    2 KMLRFRSPSLSSLALELQCTVRLLDDSEIS--CSIQRDTKGQFLVDHVCNHYS-LLEKDYFGIRYVDPDKQRHWLDPSKPVVKQMKCQQ----PYTMCFRVKFYPQEPIK-IKEELTRYLLYLQLKRDVYHGRLLCPFADAAYLGACIVQAELGDYDPEEHPADYI--SDFKLFPKQSLKLERKIMEIHQNELRGQCPSLAELNLLQRAHTLDTYGVDPHPCKDFTGSTAFLGFTARGFVVFQGNKRIHLLKWADVSKFKFEGKTFYV------------------IGKKLVLTFH-TSTPAACKHLWKCGVENQAFYKCAKSSQIKTVSSSSIFFKGSRFR-YSGRVAKEVIEASSKIQRDP-PVVHRCQ----FGQSRSFTSLSHKQLIMN 359          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 144.821 bits (364), Expect = 2.493e-36
Identity = 118/351 (33.62%), Postives = 181/351 (51.57%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            C + +LD   + Y  ++  +  G  L ++VC  L  ++EKDYFG+RF+D   QR WLE +KPI+KQ++ +  P  T     R K YP  P   LK++++RYLL+LQ++RDLY GRL+  S++   +AA ILQAEIG++D     E     +  +  P  + + E +I  IH++ L     + +E  FL +A  L+TYGV+P P KD  GN  F+     G     G++R H   W  + KL +  K   F +Y    E            +K IL +   +  A   LWK  ++ + F+  EK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:   19 CTVRLLD--DSEYTCTVQRDAKGHWLFEQVCQHLN-LLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ--PPYT--MCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYS--SKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAK--TFHIYATHQE-----------DQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSRFR-YSGKVAKEVMEQSAKIRREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 144.821 bits (364), Expect = 2.769e-36
Identity = 118/351 (33.62%), Postives = 181/351 (51.57%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            C + +LD   + Y  ++  +  G  L ++VC  L  ++EKDYFG+RF+D   QR WLE +KPI+KQ++ +  P  T     R K YP  P   LK++++RYLL+LQ++RDLY GRL+  S++   +AA ILQAEIG++D     E     +  +  P  + + E +I  IH++ L     + +E  FL +A  L+TYGV+P P KD  GN  F+     G     G++R H   W  + KL +  K   F +Y    E            +K IL +   +  A   LWK  ++ + F+  EK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:   19 CTVRLLD--DSEYTCTVQRDAKGHWLFEQVCQHLN-LLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ--PPYT--MCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYS--SKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAK--TFHIYATHQE-----------DQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSRFR-YSGKVAKEVMEQSAKIRREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 144.436 bits (363), Expect = 6.618e-36
Identity = 118/351 (33.62%), Postives = 181/351 (51.57%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            C + +LD   + Y  ++  +  G  L ++VC  L  ++EKDYFG+RF+D   QR WLE +KPI+KQ++ +  P  T     R K YP  P   LK++++RYLL+LQ++RDLY GRL+  S++   +AA ILQAEIG++D     E     +  +  P  + + E +I  IH++ L     + +E  FL +A  L+TYGV+P P KD  GN  F+     G     G++R H   W  + KL +  K   F +Y    E            +K IL +   +  A   LWK  ++ + F+  EK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:   19 CTVRLLD--DSEYTCTVQRDAKGHWLFEQVCQHLN-LLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ--PPYT--MCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYS--SKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAK--TFHIYATHQE-----------DQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSRFR-YSGKVAKEVMEQSAKIRREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 155.221 bits (391), Expect = 2.785e-39
Identity = 130/375 (34.67%), Postives = 200/375 (53.33%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            C I +LD T+ ++  +I  +  G  LLD +C+    ++EKDYFG+RF+D   QR WL+ +KP++KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+    +   + A I+QAEIG++D  +  +N I   D KI P  ++K E KI+ IH+  L+      +E   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W +I K+ +  K F   V   +              +K+IL +   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   + G   KE+ ++   +Q  P P V R     +L+     S + N+ L+ N
Sbjct:   33 CTIRLLDDTEISF--NIQRDTKGQFLLDYICNHYN-LLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYI--CDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKE--------------KKNILTYH-TSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTSSNIFFKGSRFR-YCGKVAKEVVEASSKIQRDP-PEVHR-----SLIPHSRSSYSLNKQLIIN 375          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 154.836 bits (390), Expect = 4.393e-39
Identity = 130/375 (34.67%), Postives = 200/375 (53.33%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            C I +LD T+ ++  +I  +  G  LLD +C+    ++EKDYFG+RF+D   QR WL+ +KP++KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+    +   + A I+QAEIG++D  +  +N I   D KI P  ++K E KI+ IH+  L+      +E   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W +I K+ +  K F   V   +              +K+IL +   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   + G   KE+ ++   +Q  P P V R     +L+     S + N+ L+ N
Sbjct:   33 CTIRLLDDTEISF--NIQRDTKGQFLLDYICNHYN-LLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYI--CDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKE--------------KKNILTYH-TSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTSSNIFFKGSRFR-YCGKVAKEVVEASSKIQRDP-PEVHR-----SLIPHSRSSYSLNKQLIIN 375          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 152.14 bits (383), Expect = 1.344e-38
Identity = 124/351 (35.33%), Postives = 189/351 (53.85%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVAR 1200
            C I +LD T+ ++  +I  +  G  LLD +C+    ++EKDYFG+RF+D   QR WL+ +KP++KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+    +   + A I+QAEIG++D  +  +N I   D KI P  ++K E KI+ IH+  L+      +E   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W +I K+ +  K F   V   +              +K+IL +   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   + G   KE+ ++   +Q  P   V R
Sbjct:    3 CTIRLLDDTEISF--NIQRDTKGQFLLDYICNHYN-LLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMK--SHPPYTM--CFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYI--CDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKE--------------KKNILTYH-TSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTSSNIFFKGSRFR-YCGKVAKEVVEASSKIQRDPPETVHR 327          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 151.754 bits (382), Expect = 1.823e-38
Identity = 126/361 (34.90%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSS 1230
            C I +LD T+ ++  +I  +  G  LLD +C+    ++EKDYFG+RF+D   QR WL+ +KP++KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+    +   + A I+QAEIG++D  +  +N I   D KI P  ++K E KI+ IH+  L+      +E   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W +I K+ +  K F   V   +              +K+IL +   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   + G   KE+ ++   +Q  P    + A S   L +S
Sbjct:    3 CTIRLLDDTEISF--NIQRDTKGQFLLDYICNHYN-LLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYI--CDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKE--------------KKNILTYH-TSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTSSNIFFKGSRFR-YCGKVAKEVVEASSKIQRDPPEVHSEASSAPVLGNS 337          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: mertk (MER proto-oncogene, tyrosine kinase [Source:Xenbase;Acc:XB-GENE-493221])

HSP 1 Score: 142.51 bits (358), Expect = 3.839e-35
Identity = 116/356 (32.58%), Postives = 184/356 (51.69%), Query Frame = 1
Query:  139 EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            E++ VC + MLD     Y  ++  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K I+KQ++ +       +  FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  + LP  + K E +I  IH   L  +    +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W +  K+ +  K   F +Y+ + E           +++ +L +   +  A   LWK  ++ + F+ LE  +Q R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:   14 EQQCVCPVRMLD--DWEYTCNVQKDAKGQQLFDFLCHHLN-LLEKDYFGIRYVDPEKQRHWLEFTKGIAKQMRARP----PYVMCFRVKFYPPDPAA-LKEEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEG--YSSKFQFLPKHSEKLERRIAEIHRNELSGLNPAASELCFLRKAQTLETYGVDPHPCKDASGNSAFLAFTPFGFIVLQGNKRVHFIKWGDATKMKFEGK--TFNLYVREKE-----------EKRLVLTYVAPNPEACKHLWKCGVENQSFYKLENSNQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAMIKRDP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 150.214 bits (378), Expect = 3.655e-38
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 150.984 bits (380), Expect = 4.685e-38
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd3 (FERM domain containing 3 [Source:MGI Symbol;Acc:MGI:2442466])

HSP 1 Score: 143.28 bits (360), Expect = 1.396e-35
Identity = 130/377 (34.48%), Postives = 197/377 (52.25%), Query Frame = 1
Query:   82 MDTFKRKSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKH-ILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            M  F+  S KS N       +++ C I +LD ++ +    I     G  L++ +C+    ++EKDYFG+R++D   QR WLE NK I KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+ S ++   + A I+QAE G++   +  EN I  ++ +I P  ++K E KI+ IH   L+      AE   L +A  L+TYGV+P P KD +G   F+G    G   F G+KR H   W ++ KL +  K F               +  G  K K+ +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V R 
Sbjct:   17 MIHFRSSSIKSLN-------QEMKCTIRLLDDSEVS--CHIQRETKGQFLIEYICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYI--SEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTF---------------YVIGSQKEKNAVLAFHT-STPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFR-YSGKVAKEVVEASSKIQRDP-PEVHRV 358          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd3 (FERM domain containing 3 [Source:MGI Symbol;Acc:MGI:2442466])

HSP 1 Score: 142.895 bits (359), Expect = 2.879e-35
Identity = 130/377 (34.48%), Postives = 197/377 (52.25%), Query Frame = 1
Query:   82 MDTFKRKSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKH-ILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            M  F+  S KS N       +++ C I +LD ++ +    I     G  L++ +C+    ++EKDYFG+R++D   QR WLE NK I KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+ S ++   + A I+QAE G++   +  EN I  ++ +I P  ++K E KI+ IH   L+      AE   L +A  L+TYGV+P P KD +G   F+G    G   F G+KR H   W ++ KL +  K F               +  G  K K+ +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V R 
Sbjct:   17 MIHFRSSSIKSLN-------QEMKCTIRLLDDSEVS--CHIQRETKGQFLIEYICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYI--SEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTF---------------YVIGSQKEKNAVLAFH-TSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFR-YSGKVAKEVVEASSKIQRDP-PEVHRV 358          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 140.584 bits (353), Expect = 6.320e-35
Identity = 118/332 (35.54%), Postives = 173/332 (52.11%), Query Frame = 1
Query:  211 NDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:   28 DAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 336          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0P4Q4|FRMD3_XENTR (FERM domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=frmd3 PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.327e-38
Identity = 130/375 (34.67%), Postives = 200/375 (53.33%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            C I +LD T+ ++  +I  +  G  LLD +C+    ++EKDYFG+RF+D   QR WL+ +KP++KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+    +   + A I+QAEIG++D  +  +N I   D KI P  ++K E KI+ IH+  L+      +E   L +A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W +I K+ +  K F   V   +              +K+IL +   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   + G   KE+ ++   +Q  P P V R     +L+     S + N+ L+ N
Sbjct:   33 CTIRLLDDTEISF--NIQRDTKGQFLLDYICNHYN-LLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYI--CDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKE--------------KKNILTYH-TSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTSSNIFFKGSRFR-YCGKVAKEVVEASSKIQRDP-PEVHR-----SLIPHSRSSYSLNKQLIIN 375          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P5H6|FRMD5_MOUSE (FERM domain-containing protein 5 OS=Mus musculus OX=10090 GN=Frmd5 PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 2.557e-37
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z6J6|FRMD5_HUMAN (FERM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FRMD5 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.667e-37
Identity = 128/367 (34.88%), Postives = 189/367 (51.50%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS  +   E +  C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+RF+D   QR WLE  K + KQ++  + P  T    FR K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E KI  IH+T L       +E  FL +A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K F   +Y+ Q E           ++K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +S   ++  P P + RA
Sbjct:    3 SRLMSGSSRSLEREYSCTVRLLD--DSEYTCTIQRDAKGQYLFDLLCHHLN-LLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR--SQPPFT--MCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYS--SKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFY--LYVSQKE-----------EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMESSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BHD4|FRMD3_MOUSE (FERM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Frmd3 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.014e-34
Identity = 130/377 (34.48%), Postives = 197/377 (52.25%), Query Frame = 1
Query:   82 MDTFKRKSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKH-ILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            M  F+  S KS N       +++ C I +LD ++ +    I     G  L++ +C+    ++EKDYFG+R++D   QR WLE NK I KQ+K  ++P  T    FR K YP  P K +K++L+RYLLYLQ++RD++ GRL+ S ++   + A I+QAE G++   +  EN I  ++ +I P  ++K E KI+ IH   L+      AE   L +A  L+TYGV+P P KD +G   F+G    G   F G+KR H   W ++ KL +  K F               +  G  K K+ +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V R 
Sbjct:   17 MIHFRSSSIKSLN-------QEMKCTIRLLDDSEVS--CHIQRETKGQFLIEYICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMK--SHPPYT--MCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYI--SEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTF---------------YVIGSQKEKNAVLAFH-TSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFR-YSGKVAKEVVEASSKIQRDP-PEVHRV 358          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H4G0|E41L1_HUMAN (Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 1.490e-33
Identity = 118/368 (32.07%), Postives = 185/368 (50.27%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFN 1254
            +C + +LD ++  Y   +  +  G VL D VC  L  ++EKDYFGL F D   Q+ WL+ +K I KQI+  ++P N   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +QAE+G++D  +   N +  ++L+  P+  R+ E +I+ +H+T + +   EAE  FLE A KL  YGV+    KD +G ++ +GV  +G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  +A  LWK  ++   FF L     +      G L    K   +SG +Q + T+    L   P P   R+ S    MS   + + F+
Sbjct:   98 ICRVTLLDASE--YECEVEKHGRGQVLFDLVCEHLN-LLEKDYFGLTFCDADSQKNWLDPSKEIKKQIR--SSPWN---FAFTVKFYPPDPAQ-LTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYV--SELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFEST-----------IGFKLPNHRSAKRLWKVCIEHHTFFRL----VSPEPPPKGFLVMGSKFR-YSGRTQAQ-TRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFS 437          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A068WUP1 (FERM domain containing protein 5 OS=Echinococcus granulosus OX=6210 GN=EgrG_000343200 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 8.421e-80
Identity = 171/414 (41.30%), Postives = 261/414 (63.04%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFD-MADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTL-----MSSRNESSNFNEHLLSNGINSTDKGYSTLPR---------CHEINSFYSET----NEEPEESNKRNNKNKLHKT 1404
            G  L D V +QLGG++E DYFGLR+LDK+ QRQWL+L+K + KQ+K    P++    +FR KHYP  P ++LKQ+ SRY LYLQLRRDL+ GRL+G +N+ + +AA ILQAEIG+ D + D    +  +ADLK+  ++  + E KI  +++TL+ +   EAE +FLE A+ ++TYGVEP+ V+D+KGN  +VG+  +G++ F G+++ H F W  I ++SY  K+F+ QV  +Q              R+H LGFKC++T AA ALWKWA+DR+CFFTL K ++A+ S++ G LFRK+++++F+G  QKE+ Q   ++  IPQP V+R++S++ +     +S +  S     H L    N      +T PR         C  +    SE+    N +P E+   NN  K++++
Sbjct:   43 GQWLFDEVINQLGGLLESDYFGLRYLDKNKQRQWLDLSKTVYKQLKHVI-PRS---LNFRVKHYPAKPLEELKQEKSRYCLYLQLRRDLHSGRLIGRNNDMHVLAAHILQAEIGDIDQLEDYLGTNGSLADLKMFENMTPRVEGKIRELYKTLRGLSVSEAEGKFLERASGMETYGVEPVFVQDRKGNHFYVGLSHEGVTAFRGNRKAHVFSWPKIYRISYDGKLFVIQVEWEQ--------------RRHTLGFKCQTTEAAEALWKWAVDRQCFFTLNKSTEAKTSKARGRLFRKRQLYSFTGRCQKEMLQITTSMPNIPQPSVSRSRSLLNIARSVSLSRQAMSHEQLNHSLEESTNQLTNETTTPPRLASIDVLSDCVRLAGVASESAEQLNRQPSEATNHNNHVKMYRS 438          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A068Y1N2 (FERM domain containing protein 5 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000343200 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 8.854e-79
Identity = 169/414 (40.82%), Postives = 261/414 (63.04%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFD-MADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEH------------LLSNGINSTDKGYS--TLPRCHEINSFYSET----NEEPEESNKRNNKNKLHKT 1404
            G  L D V +QLGG++E DYFGLR+LDK+ QRQWL+L+K + KQ+K    P++    +FR KHYP  P ++LKQ+ SRY LYLQLRRDL+ GRL+G +N+ + +AA ILQAEIG+ D + D    +  +ADLK+  ++  + E KI  +++TL+ +   EAE +FLE A+ ++TYGVEP+ V+D+KGN  +VG+  +G++ F G+++ H F W  I ++SY  K+F+ QV  +Q              R+H LGFKC++  AA ALWKWA+DR+CFFTL K ++A+ S++ G LFRK+++++F+G  QKE+ Q   ++  IPQP V+R++S++ +  S + S     H             L+N   +  +  S   LP   ++    SE+    N +P E+   NN  K++++
Sbjct:   43 GQWLFDEVINQLGGLLESDYFGLRYLDKNKQRQWLDLSKTVYKQLKHVI-PRS---LNFRVKHYPAKPLEELKQEKSRYCLYLQLRRDLHSGRLIGRNNDMHVLAAHILQAEIGDIDQLEDYLGTNGSLADLKMFENMTPRVEGKIRELYKTLRGLSVSEAEGKFLERASGMETYGVEPVFVRDRKGNHFYVGLSHEGVTAFRGNRKAHVFSWPKIYRISYDGKLFVIQVEWEQ--------------RRHTLGFKCQTAEAAEALWKWAVDRQCFFTLNKSTEAKTSKARGRLFRKRQLYSFTGRCQKEMLQITTSMPNIPQPSVSRSRSLLNIARSVSLSRQAMSHERLNHSLEESTSQLTNETTTAPRSASIDVLPGRVQLAGVASESAEQLNRQPSEATNHNNHVKMYRS 438          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A4S2MA58 (FERM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002849 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 3.038e-74
Identity = 150/338 (44.38%), Postives = 225/338 (66.57%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFD-MADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSS 1230
            G  L ++V  +L GI+ KDYFGLR+LD++ QRQWLE++K + KQ+K    P++    +FR KHYP  P  + +Q+ +RYLLYLQLRRDL+ GRL+G + E + +AA ILQAEIG++D + D   +   +ADLK+  ++  + E KI  +H+TLK    +EAE +FLE A+  +TYG+EP+ V+D+KGN  ++G+  +G+ TF GS++ H F W  I K+SY  K+F+ QV  +Q              R+H LGFKC +  +A ALWKWA+DR+CFFTL +   A+ S++ G +F++++ +TF+G  QKEL     +L  IPQP V+R++S++ L  S
Sbjct:  100 GRALFNQVIERLNGIVAKDYFGLRYLDRNKQRQWLEMSKTVYKQLKHVT-PRS---LNFRVKHYPSDPLAEFRQEKTRYLLYLQLRRDLHSGRLIGRNTEMHMLAACILQAEIGDYDVLVDYLGSEGTLADLKMFANVTPRTEAKICELHKTLKGPSMEEAENKFLEHASHFETYGIEPLYVQDRKGNHFYMGLSHEGVVTFRGSRKAHVFTWHKINKISYEGKLFIIQVEWEQ--------------RRHTLGFKCPTAESAEALWKWAVDRQCFFTLSRSVDAKESKANGGIFKRRQFYTFTGRCQKELMLLNSSLPTIPQPSVSRSRSLLNLAKS 419          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A4S2MAC4 (FERM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002849 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 4.883e-74
Identity = 150/338 (44.38%), Postives = 225/338 (66.57%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFD-MADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSS 1230
            G  L ++V  +L GI+ KDYFGLR+LD++ QRQWLE++K + KQ+K    P++    +FR KHYP  P  + +Q+ +RYLLYLQLRRDL+ GRL+G + E + +AA ILQAEIG++D + D   +   +ADLK+  ++  + E KI  +H+TLK    +EAE +FLE A+  +TYG+EP+ V+D+KGN  ++G+  +G+ TF GS++ H F W  I K+SY  K+F+ QV  +Q              R+H LGFKC +  +A ALWKWA+DR+CFFTL +   A+ S++ G +F++++ +TF+G  QKEL     +L  IPQP V+R++S++ L  S
Sbjct:  100 GRALFNQVIERLNGIVAKDYFGLRYLDRNKQRQWLEMSKTVYKQLKHVT-PRS---LNFRVKHYPSDPLAEFRQEKTRYLLYLQLRRDLHSGRLIGRNTEMHMLAACILQAEIGDYDVLVDYLGSEGTLADLKMFANVTPRTEAKICELHKTLKGPSMEEAENKFLEHASHFETYGIEPLYVQDRKGNHFYMGLSHEGVVTFRGSRKAHVFTWHKINKISYEGKLFIIQVEWEQ--------------RRHTLGFKCPTAESAEALWKWAVDRQCFFTLSRSVDAKESKANGGIFKRRQFYTFTGRCQKELMLLNSSLPTIPQPSVSRSRSLLNLAKS 419          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A3Q0KKT7 (Putative 4.1 G protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 4.955e-73
Identity = 152/324 (46.91%), Postives = 221/324 (68.21%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFD-MADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQP 1188
            G VL ++V  +LGGIIEKDYFGLR+LD+  QRQWLE++K + KQ+K  + P++    +FR KHYP  P  + +Q+ SRYLLYLQLRRDL+ GRL+G + E + +AA ILQAEIG++D + D       +ADLK+  +I  K E KI+ I+++LK +   +AE +FLE AAK +TYG+EP+ V+D+KGN  ++G+  +G+ T+ GS++ H F W+ I K+SY  K+F+ QV  +Q              R+H LGFKC +  +A ALWKWA+DR+CFFTL +   A+ S++ G LF++++ +TF+G  QKEL Q   ++  IPQP
Sbjct:   97 GRVLFNQVIERLGGIIEKDYFGLRYLDRSKQRQWLEMSKTVYKQLKYVS-PRS---LNFRVKHYPSDPVNEFRQEKSRYLLYLQLRRDLHSGRLIGRNLEMHVLAACILQAEIGDYDVLLDYLGPEGTLADLKMFANITPKTESKIVEIYKSLKGMSMNDAENKFLENAAKFETYGIEPLYVQDRKGNHFYMGLNHEGVITYRGSRKAHVFSWQKINKISYEGKLFIIQVEWEQ--------------RRHTLGFKCPTPESAEALWKWAVDRQCFFTLNRSVDAKESKANGGLFKRRQFYTFTGRCQKELMQLNSSMPAIPQP 402          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 150.599 bits (379), Expect = 3.697e-38
Identity = 138/408 (33.82%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQ----PHVARAQSMMTLMSSRNESSNFNEHLLSNGINSTDKGYSTLPR 1314
            SR MS      E +  C + +LD   T Y  +I  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K ISKQ+K  + P  T     R K YP  P   LK++++RYL++LQL+RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E +I  IH+T L     + +E  FL++A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K   F VY +Q E            +K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +    +G+     ++SC ++   P+    P   R    +++M    ES   + H  S  + S   G S +PR
Sbjct:    3 SRLMSGSVRSLEREFSCTVRLLD--DTEYTCTIQRDAKGQYLFDLICHHLN-LLEKDYFGIRYVDPDKQRHWLEFTKSISKQMK--SQPPFT--MCLRVKFYPPDPAA-LKEEITRYLVFLQLKRDLYHGRLLCKTSDAAILAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGK--TFHVYANQKE-----------DKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYRAGLVP---SRSCPSITHGPRLSSVPRTRRRAVHISIMEGL-ESLRDSAH--STPVRSVSHGESFIPR 381          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:103038726])

HSP 1 Score: 150.984 bits (380), Expect = 5.175e-38
Identity = 140/395 (35.44%), Postives = 208/395 (52.66%), Query Frame = 1
Query:   94 KRKSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSN 1272
            K K  + R+ S  + E +L C + +LD ++ +   SI  +  G  LLD VC+    ++EKDYFG+R++D   QR WL+  KP++KQ+K +          FR K YP+ P K +K++L+RYLLYLQL+RDLY GRL+    +   + A I+QAE+G++D AD    S  I+D K+ P  + K E KI+ IH+  L+      AE   L+ A  L TYGV+P P KD  G   F+G    G   F G+KR H   W ++ K  +  K F        I +  E        +K +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q  P P V R+Q    L  SR+ +S  ++ L+ N
Sbjct:    2 KMKMLRLRSPSVSSLEPELHCTVRLLDDSELS--CSIQRDTKGQFLLDHVCNHYS-LLEKDYFGIRYVDPEKQRHWLDPTKPVAKQMKCQQ----PYTMCFRVKFYPQEPIK-IKEELTRYLLYLQLKRDLYHGRLLCPFADAAYLGACIVQAELGDYD-AD-EHPSDYISDFKLFPKQSLKLERKIMEIHQNELRGQCPALAELNLLQRAHTLDTYGVDPHPCKDFTGTTAFLGFTARGFMVFQGNKRIHLLKWADVSKYKFEGKTFYV------IGVQRE--------KKLVLTFH-TSTPAACKHLWKCGVENQAFYKCAKSSQIKTVSSSNIFFKGTRFR-YSGRVAKEVIEASSKIQRDP-PVVHRSQ----LGQSRSYNSLSHKQLIMN 365          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 149.058 bits (375), Expect = 1.469e-37
Identity = 130/367 (35.42%), Postives = 188/367 (51.23%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            SR MS      E +  C + +LD   T Y  +I  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K ISKQ+K  + P  T     R K YP  P   LK++++RYL++LQL+RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E +I  IH+T L     + +E  FL++A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K   F VY +Q E            +K IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:    3 SRLMSGSVRSLEREFSCTVRLLD--DTEYTCTIQRDAKGQYLFDLICHHLN-LLEKDYFGIRYVDPDKQRHWLEFTKSISKQMK--SQPPFT--MCLRVKFYPPDPAA-LKEEITRYLVFLQLKRDLYHGRLLCKTSDAAILAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGK--TFHVYANQKE-----------DKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGRVAKEVMEQSAKIKREP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039790.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632957:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000039790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 3.013e-34
Identity = 125/392 (31.89%), Postives = 193/392 (49.23%), Query Frame = 1
Query:  100 KSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNG 1275
            KS KS N  P    +    ++ ++D   ++Y  +I  +  G  L+D VC  L  ++EKDYFGL F D   Q+ WL+ +K I KQ++      +   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +QAE+G++D  +    S  I+DL+  P+  R+ E +++ +H T + +   EAE  FLE A KL  YGV+    KD +G ++ +GV  +G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L     +      G L    K   +SG +Q + T+    L   P PH  R+ S   L+ SR+    F+  L + G
Sbjct:   61 KSPKSPN-KPSKRSKTAPFKVTLMD--SSDYEANIEKHCKGQALVDLVCEHLN-LLEKDYFGLTFRDSDTQKNWLDPSKEIKKQMR-----TSPWHFAFAVKFYPPDPSQ-LMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDE--HGSDYISDLRFAPNQTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFEST-----------IGFKLPNHRAAKRLWKVCIEHHTFFRL----VSPEPPPKGFLVMGSKFR-YSGRTQAQ-TRQASALIDRPAPHFERSTSKRHLL-SRSLDGEFSRPLSTMG 422          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046054.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632974:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000046054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 4.187e-34
Identity = 125/392 (31.89%), Postives = 193/392 (49.23%), Query Frame = 1
Query:  100 KSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNG 1275
            KS KS N  P    +    ++ ++D   ++Y  +I  +  G  L+D VC  L  ++EKDYFGL F D   Q+ WL+ +K I KQ++      +   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +QAE+G++D  +    S  I+DL+  P+  R+ E +++ +H T + +   EAE  FLE A KL  YGV+    KD +G ++ +GV  +G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L     +      G L    K   +SG +Q + T+    L   P PH  R+ S   L+ SR+    F+  L + G
Sbjct:   61 KSPKSPN-KPSKRSKTAPFKVTLMD--SSDYEANIEKHCKGQALVDLVCEHLN-LLEKDYFGLTFRDSDTQKNWLDPSKEIKKQMR-----TSPWHFAFAVKFYPPDPSQ-LMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDE--HGSDYISDLRFAPNQTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFEST-----------IGFKLPNHRAAKRLWKVCIEHHTFFRL----VSPEPPPKGFLVMGSKFR-YSGRTQAQ-TRQASALIDRPAPHFERSTSKRHLL-SRSLDGEFSRPLSTMG 422          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: frmd3 (FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070523-1])

HSP 1 Score: 131.724 bits (330), Expect = 1.150e-32
Identity = 101/319 (31.66%), Postives = 167/319 (52.35%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHE-TLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQ 1173
            G  L+D VC+ L  ++E+DYFG+RF+D   QR WL+  K I +Q+K    P  T    FR K YP+ P K ++++++RY LYLQ++RD+  GRL+  ++E   + A ILQAE+G+++  D   +   ++ +++ P +++K E ++  IH   L+      AE  FL  A  L TY V+P P KD  G  +F+G    G   F G+KR     W ++ KL Y  K F    Y+  ++           ++K +L +   +  A   LWK  ++ + F+  EK  + +   S    FR  +   + G   KE+ ++   +Q
Sbjct:    9 GRFLMDHVCNHLD-LLERDYFGIRFVDPDKQRHWLDPKKSIVRQMK--CQPPFT--MCFRVKFYPQEPSK-VREEITRYQLYLQIKRDVVHGRLLCPTSEAAWLGACILQAELGDYNPLD--HHDGYVSAMQLFPRLSQKLEARVAEIHRHELRGQTPAVAEINFLIRAQGLDTYTVDPHPCKDPSGATVFLGFTPAGFVGFQGNKRVQLLKWMDVGKLKYEGKSF----YIHGVQN----------RKKTVLTYHAPTPSACKHLWKCGVENQAFYKFEKSCEIKTVLSSNLFFRGSRFR-YRGRVAKEVIEASARIQ 304          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 1.034e-26
Identity = 100/337 (29.67%), Postives = 166/337 (49.26%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQR-QWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAAC-ALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQ 1155
            +C I +LD   T   +  N ++ G  LLD V + L  + E DYFGL+F D   +  +WL+  KP+ KQIK +++P    +F+FR K +   P K L+++ +RY  +LQLR D+   RL    N    +A+ I+Q+E+G  D ++       ++DL+ LP      E ++  +H+    +   +AE  +L  A  ++ YGVE    +DQ   E+ VGV   G++ ++   R   FPW  I+K+ +  K F  Q+  +Q E            R++I+GF     Y AC  LWK  ++   FF + + +           F       +SG ++ +  Q
Sbjct:   30 LCHINLLD--NTAITLRANKSEAGKALLDAVFAHLD-LAETDYFGLQFADDSTETPRWLDPTKPLRKQIK-RSSP---YIFNFRVKFFVTDPSK-LQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELG--DYSETEHLPGYLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQNET-----------RENIIGFNL-GNYRACKTLWKACVEHHTFFRMARPASPPHLGFLAQYFSLGSKFRYSGRTEMQTVQ 344          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: farp2 (FERM, RhoGEF and pleckstrin domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2993])

HSP 1 Score: 92.8189 bits (229), Expect = 1.063e-19
Identity = 89/281 (31.67%), Postives = 139/281 (49.47%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRF--LDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLE 1056
            GI LL  V   L  ++E DYFGL      K G   WL+  KPI+KQ+K   N KN  +F    K +P+   +  ++  SRY   LQ+R+DL  GRLV S      MAA +LQA++ +++      +S ++ +++ LP+    A  +IL  H     +   EA+ Q LE A +  TYG+      D++G  + + V   G+S F  + + +TF W  I KLS+  K F+ + + D    +E  +       +  L F  +   A  A WK  ++   FF L+
Sbjct:    4 GIALLTTVYKYLN-LVESDYFGLELEPYPKCGFTVWLDSQKPIAKQVK---NTKNV-VFKLGVKFFPEDSSQLQEEITSRYQFALQVRQDLLAGRLVASEMSSSLMAACLLQADVSDYEE---QRSSQQLREVQYLPNQEVLAN-RILDYHRQFAGLSPAEADVQLLEIARRQDTYGLRLHQAYDKEGASINLAVGYSGVSVFQNTTKINTFNWAKIRKLSFKRKYFLVKFHPD----IEGNY-------QDTLEFSMKGRDACKAFWKGCVESHAFFRLQ 264          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 89.7373 bits (221), Expect = 2.055e-19
Identity = 84/278 (30.22%), Postives = 130/278 (46.76%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            G  L D+V   L  I+E DYFGL+F+D      WL+  K I KQ+K          F  R K Y   P  +L ++L+RYL  LQL++D+  G+L        Q+A   LQAE+G+ D   +  N   +++ + +P  + + E  IL   +  +     +AE  +L +A  L+ YGV+   VK + GNE  +G+   G+  F G  +   F W  I +L +        V  D  +  E+         +H   F+ +   A   LWK A++   FF L
Sbjct:    5 GQDLFDQVMYHLD-ILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGP----PYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCD--PVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQ---------EHTFVFRLDHPKACKHLWKCAVEHHAFFRL 265          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 89.3521 bits (220), Expect = 2.174e-19
Identity = 84/278 (30.22%), Postives = 130/278 (46.76%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            G  L D+V   L  I+E DYFGL+F+D      WL+  K I KQ+K          F  R K Y   P  +L ++L+RYL  LQL++D+  G+L        Q+A   LQAE+G+ D   +  N   +++ + +P  + + E  IL   +  +     +AE  +L +A  L+ YGV+   VK + GNE  +G+   G+  F G  +   F W  I +L +        V  D  +  E+         +H   F+ +   A   LWK A++   FF L
Sbjct:    5 GQDLFDQVMYHLD-ILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGP----PYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCD--PVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQ---------EHTFVFRLDHPKACKHLWKCAVEHHAFFRL 265          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 142.51 bits (358), Expect = 7.085e-38
Identity = 104/303 (34.32%), Postives = 162/303 (53.47%), Query Frame = 1
Query:  139 EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFF 1047
            + + V +I +LD T+         +  G  + D VC  L  ++EKDYFGLR++D   QR WL+L+K + KQ+K    P   ++F FR K Y   P   + ++++RY  +LQ++RD+  GRL+ S NE  ++ A I+QAE+G++D  D  +N +  ++ +I+P  + K E KI  IH +L       AE+ FL++   L  YGV+P P KDQ   +L++G+   GI+     K+   F W  I+K SY  K+F  QV+ D               RK   GF+     A   LWK A++   F+
Sbjct:   11 DAEFVVKISLLDDTELT--CEFRRDAKGQTVFDTVCKALD-LVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLKPP--FKLF-FRVKFYALDPGL-IHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQEDNYV--SEFRIVPKQSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQVHKDD--------------RKANYGFRLPDPLACKHLWKCAVEHHAFY 290          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO36130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ3])

HSP 1 Score: 106.686 bits (265), Expect = 2.421e-25
Identity = 89/278 (32.01%), Postives = 141/278 (50.72%), Query Frame = 1
Query:  220 GIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL 1053
            GI L+  V   L  + EK+YFGL + D  G++ WL+  K I KQ+K      N   F    K Y  YP K LK D++RY++ LQ+R D+   RL  S   Q  + + ++Q+E G++D  +   N +  A L   P+ + +   +I  +H+  + +  +EA+ Q+LE A KL  YGV+  P +D  G+E+ VGV   G+  F    R + FPW  ++ LSY  + F  +    ++E +  T           + FK  +  AA  L+K  ++   FF L
Sbjct:    7 GIDLMVAVAEHLN-LDEKEYFGLLY-DHKGEKYWLDPQKEIKKQLKG-----NLPHFELAVKFYEPYPSK-LKHDMTRYMMVLQVRDDIICERLPCSFGAQALLGSYVVQSEFGDYDPHEHKGNYL--AGLVFSPNQSHELVERIKELHKEHRGLTPEEADTQYLEAARKLTMYGVDAHPARDGNGDEVLVGVSYAGVLVFKDDLRQNKFPWPKVVYLSYKGRDFSVKSRPGELEELTTT-----------MTFKLPTEKAAKRLYKSCVEHHTFFRL 263          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 108.997 bits (271), Expect = 2.429e-24
Identity = 96/356 (26.97%), Postives = 167/356 (46.91%), Query Frame = 1
Query:  151 VCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMT 1218
              ++ MLD +   + +   +   G +L  +V   L  + E++YFGL + DK     WL+  KPI KQ+K+        +F F  K Y   P   L+++ +RYL  LQ+++DL  G L  S +    +A+ ++Q E+G+FD   ++     +AD +  P     +E +I   H+  + +   + +   L+ A +L+ YGV   P KD+   +L +     GI  F    + +T  W  I KLS+  K F+ +++ +          +GH   K ++ F+  S  A  + WK A+    FF   +       R    +F +   + FSG +QK++  S ++     QP   R QS+ T
Sbjct:   24 TVKVCMLDDSVVKFDIEPKVK--GDILYKQVYEYLN-LDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGK----VLFRFCVKFYTADPAM-LQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDFDT--LSCRPGYLADFQFFPEQTVDSEARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLIKLHPE---------IFGHY--KDVVEFQMASRNACKSFWKVAISTHAFF--RQSESQSPPRHRPRVFSRGSSYRFSGRTQKQIIDSMQD-SFRSQPSFQRTQSLKT 355          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 101.679 bits (252), Expect = 7.545e-24
Identity = 87/306 (28.43%), Postives = 151/306 (49.35%), Query Frame = 1
Query:  130 GTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFF 1047
            G    +  C I++LD  ++ + + I  +  G  +L++V   L  ++E+DYFGLRF++K+ Q +WL+  K ++KQ+K    P     F  +F  Y   P K L ++L+RYL +LQ++RD+++G      +    +++ IL AE+G+FD    T   +  ++ + +P      E KI   H+ L  +    AE  +L++A  L+ YGV+   VK + G E FV +   G+  +       T+ W+ I K+ +  K F   V              G   R+++  F   +  A   LWK  ++   FF
Sbjct:    5 GRTPTEFFCHIVLLD--ESEFPIEITKSTKGFEVLEKVFDHLN-LLERDYFGLRFIEKNTQSRWLDPMKSVTKQLK--AGPPYLMYFCVKF--YAADPNK-LHEELTRYLFFLQVKRDIFQGSAPCEIHADTLISSFILLAELGDFDYQSYTPGYV--SEFRFVPKQTEDLEEKISDCHKRLIGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTYLWQKITKIDFKGKKFSLNVQ-------------GKEDREYVYVFYLPNKSACKHLWKCCVEHHAFF 287          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 103.219 bits (256), Expect = 1.753e-23
Identity = 95/343 (27.70%), Postives = 162/343 (47.23%), Query Frame = 1
Query:  184 TNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLD-KHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQS 1209
            ++Y   I+    G  L D+VC  +G + EK+YFGLR++D K GQ  WLE ++ I +Q+      K    F F  K YP+ P   L++D++RY   LQLR DL +GR+  S+     +A+ ++QAE+G  D+         ++DLK  P    +   KI   H     +   +AE Q+L+   KL  YG +       +G  + + +   G+  F  +++ H F W  I+ + +  K F   +        E+ ++     +   + FKC S  AA  +WK  ++   FF L++           + F+      +SG +Q +  ++ E++ +  QP   R  S
Sbjct:   18 SDYECPIDKTTKGDHLFDQVCDHIG-LAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMG-----KAPLHFYFAVKFYPENPTT-LREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELG--DLHPEEHEVAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPS----EDDYY-----KSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLKE---PVPLPKNTNFFKIGSKFRYSGRTQHQ-ARNNESVGVREQPSFDRVSS 338          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:101171252])

HSP 1 Score: 157.532 bits (397), Expect = 4.005e-40
Identity = 144/413 (34.87%), Postives = 213/413 (51.57%), Query Frame = 1
Query:  115 RNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACA-LWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSET 1347
            R+ S  + +++++C I +LD ++ +   SI  +  G  LLD VC+    ++EKDYFG+R++D   QR WLE NKP+ +Q+K         M  FR K YP  P K +K++L+RYLLYLQL+RD+Y GRL+    E   + A I+QAE+G++D  +   + I+  D K+ P  + K E KI+ IH+  L+   A  AE   L+ A  L+TYGV+P P KD  G   F+G    G   F G+KR H   W ++ KL +  K F        I I +E        +K +L F   ST AAC  LWK  ++ + F+   K SQ +   S    F+  +   +SG   KE+ ++   +Q    P V RAQ          +S +FN     N I + +     LP  +E    Y ET
Sbjct:    7 RSPSIRSLDQEILCTIRLLDDSELS--CSIQKDTKGQFLLDHVCNHYN-LLEKDYFGIRYVDPEKQRHWLEPNKPVVRQMKSHQ----PYMMCFRVKFYPHEPMK-IKEELTRYLLYLQLKRDIYHGRLLCPFVEAAYLGACIVQAELGDYDAEEHPCDYIR--DFKLFPKQSLKLERKIMEIHKNELRGQSAALAELNMLQRAHSLETYGVDPHPCKDFTGATAFLGFTATGFVVFQGNKRIHLLKWMDVSKLKFEGKTFYV------IGIQKE--------KKLVLTFH-TSTPAACKHLWKCGVENQAFYKCAKSSQIKTVSSSNIFFKGSRFR-YSGRVAKEVIEASSKIQ-RDAPEVRRAQF--------GQSRSFNSLSHKNLIMNMEPLVPALPSTNE----YEET 380          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:101158442])

HSP 1 Score: 151.369 bits (381), Expect = 2.431e-38
Identity = 134/427 (31.38%), Postives = 205/427 (48.01%), Query Frame = 1
Query:  112 SRNMSPGTN--EEKLVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKE-AEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQ----------IIPQ---PHVARAQSMMTLMSSRNES---------SNFNEHLLSNGINSTDKGYSTLPRC 1317
            SR MS      E +  C + +LD   T Y  +I  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K I+KQ+K  + P  T     R K YP  P   LK++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E +I  IH+T    +  E +E+ FL++A  L+TYGV+P P KD  GN  F+     G     G+KR H   W  + KL +  K   F +Y +Q EI              IL +   +  A   LWK  ++ + F+ LEK SQ R   S    FR  +   +SG   KE+ +    ++          ++P    P +     + ++  +R  +          +  +   S  + S   G S +PRC
Sbjct:    3 SRFMSGSIRNLEREYNCTVRLLD--DTEYTCTIQRDAKGQYLFDLICHNLN-LLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMK--SQPPFT--MCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKQSEKLERRIADIHKTEMIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGK--TFHIYANQKEI--------------ILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFRGSRFR-YSGRVAKEVMERSAKIKREPPEIHRAGLVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGESFMPRC 402          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: frmd5 (FERM domain-containing protein 5 [Source:NCBI gene;Acc:101175227])

HSP 1 Score: 151.369 bits (381), Expect = 2.880e-38
Identity = 122/351 (34.76%), Postives = 184/351 (52.42%), Query Frame = 1
Query:  154 CEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHET-LKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARA 1203
            C + +LD   + Y  +I  +  G  L D +C  L  ++EKDYFG+R++D   QR WLE  K I+KQIK  + P  T     R K YP  P   L+++++RYL++LQ++RDLY GRL+  +++   +AA ILQAEIG++D     E     +  +  P  + K E +I  IH+T L     + +E  FL++A  L+TYGV+P P KD  GN  F+     G +   G++R H   WE + KL +  K   F +Y +Q E            RK IL +   +  A   LWK  ++ + F+ LEK SQ R   S    F+  +   +SG   KE+ +    ++  P P + RA
Sbjct:   19 CTVRLLD--DSEYTCTIQRDSKGQYLFDLICHHLN-LLEKDYFGIRYVDPDKQRHWLEFTKSIAKQIK--SQPPFT--MCLRVKFYPPDPAA-LREEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYS--SKFQFFPKHSEKLERRIAEIHKTELIGQSPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFTVLQGNRRVHFLTWEEVTKLKFEAK--TFHIYANQKE-----------DRKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFR-YSGKVAKEVMEQSAKIKRDP-PEIHRA 344          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 146.747 bits (369), Expect = 2.604e-36
Identity = 126/427 (29.51%), Postives = 211/427 (49.41%), Query Frame = 1
Query:  148 LVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL-EKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEH---LLSNGINSTDKGYSTLPRCHEINSFYSETNEEPEESNKRNNKNKLHKTKPTS 1416
            + C++ +LD   ++Y V +     G +L  ++C  L  ++EKDYFG+ + D   Q+ WL+ +K + KQI+  N P N   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +Q+E+G++D  ++   S  +++L++ P+  ++ E K++ +H+T K +   EAE  FLE A KL  YGV+    KD +G E+ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L    +  ++  S GS FR      +SG +Q +  ++   + I P P   R  S    MS   + +   E+   L+ +     D   + +     I +  +E  E+ E+ + + N    H+   TS
Sbjct:   82 MQCKVALLD--GSDYTVDVEKRAKGQILFSKICEHLN-LLEKDYFGITYRDIENQKNWLDPSKELKKQIR--NGPWN---FAFNVKFYPPDPSQ-LSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPEEMA--SDYVSELRLAPNQTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFEST-----------IGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR------YSGRTQAQTRRASSQI-IRPAPFFERTSSKRYNMSRSLDGATIAENHDTLMKDSTAGGDTKAAAI-----ITTVTTEREEKTEQEDAQKNSTDTHEAGATS 474          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 146.747 bits (369), Expect = 2.888e-36
Identity = 126/427 (29.51%), Postives = 211/427 (49.41%), Query Frame = 1
Query:  148 LVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTL-EKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEH---LLSNGINSTDKGYSTLPRCHEINSFYSETNEEPEESNKRNNKNKLHKTKPTS 1416
            + C++ +LD   ++Y V +     G +L  ++C  L  ++EKDYFG+ + D   Q+ WL+ +K + KQI+  N P N   F+F  K YP  P + L +D++RY L LQLR D+  GRL  S      + +  +Q+E+G++D  ++   S  +++L++ P+  ++ E K++ +H+T K +   EAE  FLE A KL  YGV+    KD +G E+ +GV   G+  +    R + F W  ILK+SY    F  ++   + E  E T           +GFK  +  AA  LWK  ++   FF L    +  ++  S GS FR      +SG +Q +  ++   + I P P   R  S    MS   + +   E+   L+ +     D   + +     I +  +E  E+ E+ + + N    H+   TS
Sbjct:   82 MQCKVALLD--GSDYTVDVEKRAKGQILFSKICEHLN-LLEKDYFGITYRDIENQKNWLDPSKELKKQIR--NGPWN---FAFNVKFYPPDPSQ-LSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPEEMA--SDYVSELRLAPNQTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFEST-----------IGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLGSKFR------YSGRTQAQTRRASSQI-IRPAPFFERTSSKRYNMSRSLDGATIAENHDTLMKDSTAGGDTKAAAI-----ITTVTTEREEKTEQEDAQKNSTDTHEAGATS 474          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000037988.1 (SMESG000037988.1)

HSP 1 Score: 442.195 bits (1136), Expect = 9.171e-152
Identity = 253/269 (94.05%), Postives = 255/269 (94.80%), Query Frame = 1
Query: 1132 MSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNE--------EPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTXXXXXXXXXXXXXXLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNXXXXXXXXXXXXXXVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 1914
            MSQKELTQSCENLQIIPQPHVAR+      +SSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNE        EPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE
Sbjct:    1 MSQKELTQSCENLQIIPQPHVARS------ISSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNETVKIEFLEEPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 263          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000037405.1 (SMESG000037405.1)

HSP 1 Score: 319.701 bits (818), Expect = 1.384e-104
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 1
Query: 1351 EEPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTXXXXXXXXXXXXXXLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNXXXXXXXXXXXXXXVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 1914
            EEPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE
Sbjct:   44 EEPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 231          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000062741.1 (SMESG000062741.1)

HSP 1 Score: 283.878 bits (725), Expect = 7.792e-86
Identity = 161/343 (46.94%), Postives = 234/343 (68.22%), Query Frame = 1
Query:  148 LVCEIIMLDPTQTNYIVSININDNGIVLLDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNTQMFSFRFKHYPKYPCKDLKQDXXXXXXXXXXXXXXXXXXXVGSSNEQYQMAALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKDIEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGSKRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGFKCESTYAACALWKWALDRKCFFTLEKXXXXXXXXXXXXLFRKKKIHTFSGMSQKELTQSCENLQI 1176
              C +  L+  +    + ++  ++G  LLD VC +LG I EKDYFGLR+ DK  QRQW++L++ +  Q+KD   P  + + SFR KHYP  P +DL+QD + Y LYLQLR+DLY GRL+G SN+ YQ+AA  +Q+EIG++D    +E+   +++LK+LP++N K E KI  IH+ L  +   E EQ+FLE+A++L TYGVEP  VKDQKGN L+VG+  +G+STF GS+R H F W +I K+ +  K+F+  V++D+I   +++      K+KH+LGFKCE+  AA ALWKWA DR CFF+L + S+A+R +SGG +F+K+K   F+G  QKE+ QS   L +
Sbjct:   12 FTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD--TP--SFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYD--STSEDMRSLSNLKLLPNLNSKTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQS------KKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSM 342          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000037405.1 (SMESG000037405.1)

HSP 1 Score: 256.529 bits (654), Expect = 1.814e-81
Identity = 157/157 (100.00%), Postives = 157/157 (100.00%), Query Frame = 1
Query: 1444 MQALKDTXXXXXXXXXXXXXXLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNXXXXXXXXXXXXXXVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 1914
            MQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE
Sbjct:    1 MQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 157          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000037988.1 (SMESG000037988.1)

HSP 1 Score: 233.032 bits (593), Expect = 7.989e-70
Identity = 136/152 (89.47%), Postives = 138/152 (90.79%), Query Frame = 1
Query: 1132 MSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNE--------EPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTXXXXXXXXXXXXXXLLNNNDDQVVVEHSVSIDK 1563
            MSQKELTQSCENLQIIPQPHVAR+      +SSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNE        EPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDK
Sbjct:    1 MSQKELTQSCENLQIIPQPHVARS------ISSRNESSNFNEHLLSNGINSTDKGYSTLPRCHEINSFYSETNETVKIEFLEEPEESNKRNNKNKLHKTKPTSAAVGAVLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDK 146          

HSP 2 Score: 215.698 bits (548), Expect = 2.135e-63
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
Query: 1561 KDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNXXXXXXXXXXXXXXVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 1914
            KDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE
Sbjct:  237 KDDNDEKIVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFIIISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTRFYFESEPNKNE 354          
The following BLAST results are available for this feature:
BLAST of FERM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FRMD53.136e-3834.88FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD55.554e-3834.88FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD52.544e-3535.54FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
EPB41L11.439e-3432.07erythrocyte membrane protein band 4.1 like 1 [Sour... [more]
FRMD31.510e-3435.05FERM domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-44.193e-2632.19FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-41.402e-2531.54FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-41.590e-2531.54FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-16.291e-2331.27FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-16.291e-2331.27FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG50222.182e-3433.79gene:FBgn0032225 transcript:FBtr0079999[more]
cora6.197e-3132.23gene:FBgn0010434 transcript:FBtr0086506[more]
cora6.319e-3132.23gene:FBgn0010434 transcript:FBtr0301279[more]
cora2.187e-3032.23gene:FBgn0010434 transcript:FBtr0086508[more]
cora8.719e-3033.22gene:FBgn0010434 transcript:FBtr0340468[more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FRMD53.859e-3834.88si:ch211-69m14.1 [Source:ZFIN;Acc:ZDB-GENE-050419-... [more]
frmd36.514e-3733.08FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
frmd52.493e-3633.62FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
frmd52.769e-3633.62FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
frmd56.618e-3633.62FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frmd32.785e-3934.67FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
frmd34.393e-3934.67FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
frmd31.344e-3835.33FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
frmd31.823e-3834.90FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
mertk3.839e-3532.58MER proto-oncogene, tyrosine kinase [Source:Xenbas... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Frmd53.655e-3834.88FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd54.685e-3834.88FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd31.396e-3534.48FERM domain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Frmd32.879e-3534.48FERM domain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Frmd56.320e-3535.54FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P4Q4|FRMD3_XENTR2.327e-3834.67FERM domain-containing protein 3 OS=Xenopus tropic... [more]
sp|Q6P5H6|FRMD5_MOUSE2.557e-3734.88FERM domain-containing protein 5 OS=Mus musculus O... [more]
sp|Q7Z6J6|FRMD5_HUMAN2.667e-3734.88FERM domain-containing protein 5 OS=Homo sapiens O... [more]
sp|Q8BHD4|FRMD3_MOUSE2.014e-3434.48FERM domain-containing protein 3 OS=Mus musculus O... [more]
sp|Q9H4G0|E41L1_HUMAN1.490e-3332.07Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of FERM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WUP18.421e-8041.30FERM domain containing protein 5 OS=Echinococcus g... [more]
A0A068Y1N28.854e-7940.82FERM domain containing protein 5 OS=Echinococcus m... [more]
A0A4S2MA583.038e-7444.38FERM domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2MAC44.883e-7444.38FERM domain-containing protein OS=Opisthorchis fel... [more]
A0A3Q0KKT74.955e-7346.91Putative 4.1 G protein OS=Schistosoma mansoni OX=6... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-69m14.13.697e-3833.82FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
frmd35.175e-3835.44FERM domain containing 3 [Source:NCBI gene;Acc:103... [more]
si:ch211-69m14.11.469e-3735.42FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000039790.13.013e-3431.89pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
ENSAMXT00000046054.14.187e-3431.89pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frmd31.150e-3231.66FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001312.11.034e-2629.67pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
farp21.063e-1931.67FERM, RhoGEF and pleckstrin domain protein 2 [Sour... [more]
epb41l52.055e-1930.22erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.174e-1930.22erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343917.085e-3834.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361302.421e-2532.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336262.429e-2426.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320457.545e-2428.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302241.753e-2327.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frmd34.005e-4034.87FERM domain containing 3 [Source:NCBI gene;Acc:101... [more]
si:ch211-69m14.12.431e-3831.38FERM domain containing 5 [Source:NCBI gene;Acc:101... [more]
frmd52.880e-3834.76FERM domain-containing protein 5 [Source:NCBI gene... [more]
epb41l3b2.604e-3629.51erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b2.888e-3629.51erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of FERM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037988.19.171e-15294.05SMESG000037988.1[more]
SMESG000037405.11.384e-104100.00SMESG000037405.1[more]
SMESG000062741.17.792e-8646.94SMESG000062741.1[more]
SMESG000037405.11.814e-81100.00SMESG000037405.1[more]
SMESG000037988.17.989e-7089.47SMESG000037988.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021833 ID=SMED30021833|Name=FERM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2206bp
TAAAAATTTGAGTTCAAGAAAAATTGCTATTAAAAATTATACAACTTTTA
AATAAATTAAGTTTAATGAAGTATTACATAAATGGATACATTTAAAAGAA
AATCATCTAAATCCAGAAATATGAGTCCTGGCACCAATGAAGAGAAACTC
GTATGTGAAATCATTATGCTTGATCCCACTCAAACAAACTACATTGTTTC
GATAAATATAAATGACAATGGGATTGTTCTGTTAGACAGAGTTTGCTCCC
AACTGGGAGGAATTATAGAGAAGGATTATTTCGGGTTAAGATTCCTAGAT
AAACACGGACAACGGCAATGGCTAGAGCTTAATAAACCAATTTCTAAGCA
AATTAAAGACAAAAATAATCCAAAAAATACTCAAATGTTCAGTTTCCGAT
TCAAACATTATCCGAAATATCCCTGTAAGGATTTAAAGCAGGATTTATCA
AGATATTTGTTGTACTTGCAATTAAGACGAGATCTTTACCGAGGCAGACT
TGTTGGGAGTTCTAATGAACAATATCAAATGGCTGCTTTGATTTTGCAAG
CGGAAATCGGCGAATTTGACATGGCTGACATAACTGAGAATTCTATTAAA
ATCGCCGATTTAAAAATTCTTCCTCACATCAATCGGAAGGCTGAAATGAA
AATTTTGGGTATTCATGAAACACTCAAAGATATAGAAGCGAAAGAAGCTG
AACAGCAGTTTTTAGAAGAAGCTGCGAAGTTACAAACGTATGGTGTTGAA
CCTATTCCTGTTAAAGATCAAAAGGGAAATGAACTGTTTGTGGGTGTTGT
AGAAGATGGAATTTCCACATTCAGTGGCAGCAAAAGAACTCATACATTTC
CCTGGGAAAACATACTAAAATTATCATATTCCCACAAAATGTTTATGTTT
CAAGTTTATATGGATCAGATCGAGATTGTAGAAGAAACTTTTTTTTGGGG
ACACCTTAAACGTAAACACATTTTGGGGTTCAAATGTGAGTCAACTTATG
CAGCCTGTGCGTTATGGAAATGGGCTCTCGATCGCAAATGTTTTTTTACA
TTGGAAAAAGGTAGTCAAGCTCGTCGCAGTCGGTCTGGAGGAAGTTTATT
TAGAAAGAAAAAAATTCACACTTTTAGTGGGATGTCTCAGAAGGAGCTTA
CTCAAAGCTGTGAAAATCTTCAAATTATACCTCAACCACACGTCGCTAGG
GCCCAAAGTATGATGACTTTGATGAGTTCTAGAAATGAATCCTCGAACTT
CAACGAACACCTTCTTTCAAATGGCATCAATTCAACAGATAAAGGCTATT
CGACTCTGCCTAGATGTCATGAAATAAACTCGTTTTACTCCGAAACAAAT
GAGGAACCAGAAGAGTCGAATAAAAGAAATAATAAAAATAAATTGCATAA
AACAAAACCTACATCTGCTGCAGTTGGAGCCGTTCTGGATTTCATGCAAG
CTCTTAAAGACACTCCAATCATTTCGAGGTCTTTTGAAAGCAGCCCATCA
GAGTCTTTACTAAATAACAATGATGATCAAGTTGTAGTTGAACATTCAGT
ATCAATTGACAAAGACGATAATGATGAAAAGATTGTATCAGAAATGATAG
AAATGGTCAGTAGGGAAGAGACTAGTATGAATCAAAGTGAACCAGGTCTT
CCACCTGGAAGCAATAAGGTTTCCACTACGAAACCTGACTTCATTGACAA
AAAACCGTCTAATTTCCAGTTCTCATTCATTATTATATCTCTAATCATGT
TATTTGTGACAATGACCTGCGGGTTTGTAATTATTTTTCATGTTCATACG
ACAGACCATCATAATGATAATCTTAGTGCAAACGGTCCAATAAGCAGCTT
CATTCGTTGGGTTTCGAACCTGCTGACTCGATTCTATTTCGAAAGTGAAC
CCAATAAAAATGAATAGTTGATAAACTCTTACTTGATCCAGTTTTATTTT
CCAAATGAATTTAGCATAATCTGTGGGGGACATTTTATTGAAAGATACCG
CGCGTTGCGGAACCTTTATATTAGCACTGTTGATGTTAATTTGCAGGCAC
CCAAATCTGATTTTGGAATTTCATTTTTTTATTTCGATATTCGTTTCGAA
AGCCTCTCAAGATGTCTTAATTTGAACTCTATTTAATTTTTTCAATTTTT
CGTTGAATTGGTTGTTATTATTGTTCCTTTGAATATTATTATATGGTTTA
CTGAAA
back to top

protein sequence of SMED30021833-orf-1

>SMED30021833-orf-1 ID=SMED30021833-orf-1|Name=SMED30021833-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=612bp
MDTFKRKSSKSRNMSPGTNEEKLVCEIIMLDPTQTNYIVSININDNGIVL
LDRVCSQLGGIIEKDYFGLRFLDKHGQRQWLELNKPISKQIKDKNNPKNT
QMFSFRFKHYPKYPCKDLKQDLSRYLLYLQLRRDLYRGRLVGSSNEQYQM
AALILQAEIGEFDMADITENSIKIADLKILPHINRKAEMKILGIHETLKD
IEAKEAEQQFLEEAAKLQTYGVEPIPVKDQKGNELFVGVVEDGISTFSGS
KRTHTFPWENILKLSYSHKMFMFQVYMDQIEIVEETFFWGHLKRKHILGF
KCESTYAACALWKWALDRKCFFTLEKGSQARRSRSGGSLFRKKKIHTFSG
MSQKELTQSCENLQIIPQPHVARAQSMMTLMSSRNESSNFNEHLLSNGIN
STDKGYSTLPRCHEINSFYSETNEEPEESNKRNNKNKLHKTKPTSAAVGA
VLDFMQALKDTPIISRSFESSPSESLLNNNDDQVVVEHSVSIDKDDNDEK
IVSEMIEMVSREETSMNQSEPGLPPGSNKVSTTKPDFIDKKPSNFQFSFI
IISLIMLFVTMTCGFVIIFHVHTTDHHNDNLSANGPISSFIRWVSNLLTR
FYFESEPNKNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035963FERM_2
IPR019749Band_41_domain
IPR018980FERM_PH-like_C
IPR011993PH-like_dom_sf
IPR018979FERM_N
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 194..214
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 21..108
e-value: 4.6E-21
score: 76.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 419..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 419..442
NoneNo IPR availablePANTHERPTHR23280:SF32FERM DOMAIN (PROTEIN4.1-EZRIN-RADIXIN-MOESIN) FAMILYcoord: 11..521
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 11..521
NoneNo IPR availableCDDcd01765FERM_F0_F1coord: 23..109
e-value: 6.9063E-21
score: 84.9467
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 219..358
NoneNo IPR availableTMHMMTMhelixcoord: 547..569
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 59..71
score: 42.15
coord: 129..142
score: 33.18
coord: 142..162
score: 23.61
coord: 205..221
score: 40.56
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 19..225
e-value: 3.2E-32
score: 123.1
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 229..330
e-value: 3.9E-7
score: 39.7
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 229..327
e-value: 9.3E-11
score: 42.0
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 220..324
e-value: 1.3E-20
score: 75.5
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 118..223
e-value: 5.3E-14
score: 52.6
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 123..217
e-value: 1.19264E-16
score: 73.4346
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 109..218
e-value: 6.2E-23
score: 83.4
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 28..93
e-value: 6.1E-12
score: 45.3
IPR000299FERM domainPROSITEPS50057FERM_3coord: 23..326
score: 55.935
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 21..111
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 117..220