Expressed conserved protein

Overview
NameExpressed conserved protein
Smed IDSMED30021825
Length (bp)973
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Expressed conserved protein (SMED30021825) t-SNE clustered cells

Violin plots show distribution of expression levels for Expressed conserved protein (SMED30021825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Expressed conserved protein (SMED30021825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Expressed conserved protein (SMED30021825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021825SMESG000021837.1 dd_Smed_v4_4104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021825SMESG000021837.1 dd_Smed_v4_4104_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30021825SMESG000021837.1 dd_Smed_v4_4104_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021825SMESG000021837.1 dd_Smed_v4_4104_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021825SMESG000021837.1 dd_Smed_v4_4104_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A5J4NE80 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006470 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.203e-46
Identity = 77/185 (41.62%), Postives = 118/185 (63.78%), Query Frame = 2
Query:  392 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTM 946
            A+ P++   Q+Q YP+I+     C P++GNY+   TYVCD D+LL VNQIN LN++++  R   N     CS   P P IAIALV K+ +  N   + L+S+ S+F+Y LF  WNL   C +  DK+IIFYSKDD ++Y F G  L+ +L +++L++I   ++  F+NG+Y+GLT +I + +  +
Sbjct:   24 ADYPLEFTAQVQSYPNIMRAKEDCLPLKGNYEHAQTYVCDVDRLLTVNQINRLNELLQEFRNLKNRDSSACSPANPNPVIAIALVNKLKV-GNENPDRLLSYASIFAYYLFNEWNLPSTCHTGSDKMIIFYSKDDGMIYTFAGNLLERKLPSSRLIDIAVQARLYFSNGIYEGLTYLIQKYRQVV 207          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A4S2LMN0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007772 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.022e-44
Identity = 74/185 (40.00%), Postives = 117/185 (63.24%), Query Frame = 2
Query:  392 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTM 946
            AE P +   Q+Q YP+I+ ++++C P++G Y    T+VCDPD+LL V+QIN LN M++  R   +  E  CS   P P IA+ALV K+ +  N   + L+S+ S+F+Y LF  WNL   C +  DK+IIFYSKDD V+Y F G  L+ +L + ++++   +++  F+NG+  GL  +I R ++ +
Sbjct:   26 AEYPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKV-GNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVEARIHFSNGIAAGLGFLIQRYREAV 209          
BLAST of Expressed conserved protein vs. TrEMBL
Match: G4VT07 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_011830 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 7.348e-43
Identity = 74/186 (39.78%), Postives = 111/186 (59.68%), Query Frame = 2
Query:  401 PIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRRS 958
            P + + Q++ YP II    KC P +GNY+   T VCDPD LL V QIN LN  +  +R  +N  +P C    P+P I +A+VKK+ + +N   + L+S+ ++FSY LF  WNLQ +C S+  KII+ YSKDD VLY   G  L+ +L T +++ I   S+  F+  +  G+  +I R ++ +  RS
Sbjct:   24 PEEYETQVKNYPDIIQSKEKCLPQQGNYEFASTLVCDPDGLLSVAQINMLNTKLHHIRTSVNFDKPSCDVNNPRPVIGVAIVKKIEV-DNMDKDRLLSYAAIFSYRLFDKWNLQSHCHSESGKIILLYSKDDGVLYTIAGNLLRRKLTTKQIINIAIRSREQFSTSISDGIAYIIERYREAVESRS 208          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A419QCC8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_23s PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 3.039e-42
Identity = 75/182 (41.21%), Postives = 115/182 (63.19%), Query Frame = 2
Query:  392 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLK 937
            AE P +   Q+Q YP+I+ ++++C P++G Y    T+VCDPD+LL V+QIN LN M++  R   +  E  CS   P P IA+ALV K+ +  N   + L+S+ S+F+Y LF  WNL   C +  DK+IIFYSKDD V+Y F G  L+ +L + ++++   +S+  F+NG+  GL  +I R +
Sbjct:   26 AEYPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKV-GNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVESRIHFSNGIAAGLGFLIQRYR 206          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A074ZXD3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02101 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.731e-42
Identity = 77/189 (40.74%), Postives = 119/189 (62.96%), Query Frame = 2
Query:  392 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRRS 958
            A+ P +   Q+Q YP+I+ ++++C P++G Y    T+VCDPD+LL V+QIN LN M++  R   +  E  CS   P P IA+ALV K+ +  N   + L+S+ S+F+Y LF  WNL   C +  DK+IIFYSKDD V+Y F G  L+ +L + ++++   +S+  F+NG+  GL  +I R +  M+ RS
Sbjct:   26 ADYPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKV-GNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVESRIHFSNGIAAGLGFLIQRYR--MLCRS 211          
BLAST of Expressed conserved protein vs. Ensembl Nematostella
Match: EDO30764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZU4])

HSP 1 Score: 56.225 bits (134), Expect = 8.015e-10
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 2
Query:  425 QGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDC-SAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKP 883
            + +P+ I  T  C       + + +++CDPD++L     N+L +M+ ++ +    G   C  + KP   IA+AL+KK+        EEL      F+  L  +W   V  +   D  +   S  D  +YI  G+  K  L ++++  I ++ KP
Sbjct:    8 ENFPNPIKDTEMC-----GRRGVSSWICDPDEVLSYADANTLEEMLRNIEQKTTSG---CEHSRKPGYQIAVALMKKIKHHYGISGEEL---ARDFAVHLHDSWG--VGHRGCGDGAVFLLSVTDRTMYISTGRVAKEVLTSDQIGIIFDEMKP 148          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000021837.1 (SMESG000021837.1)

HSP 1 Score: 387.111 bits (993), Expect = 5.366e-137
Identity = 189/190 (99.47%), Postives = 189/190 (99.47%), Query Frame = 2
Query:  392 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRRSN 961
            AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAE PKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRRSN
Sbjct:   17 AESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAENPKPTIAIALVKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRRSN 206          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000077296.1 (SMESG000077296.1)

HSP 1 Score: 133.265 bits (334), Expect = 2.358e-37
Identity = 71/184 (38.59%), Postives = 109/184 (59.24%), Query Frame = 2
Query:  407 DLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIALVKKMIIPENSKV-EELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRR 955
            +  +Q+Q YP+++T   KC P +GNY S +  VCDPD LL +  IN LN  I+ ++        +C  +KP+P+IAIALV +  I  N K  E++++  S+F+YSL+ +W +   C S  DK+IIFYSK D  LY + G  +  +L + K+++I   SKP F+ G  +GL  V+ R     + R
Sbjct:   28 EFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNE--IKSNKKTSEDILNLASVFTYSLYDDWKISSVCTS--DKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGR 206          
The following BLAST results are available for this feature:
BLAST of Expressed conserved protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NE801.203e-4641.62Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2LMN02.022e-4440.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4VT077.348e-4339.78Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A419QCC83.039e-4241.21Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A074ZXD33.731e-4240.74Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO307648.015e-1025.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000021837.15.366e-13799.47SMESG000021837.1[more]
SMESG000077296.12.358e-3738.59SMESG000077296.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021825 ID=SMED30021825|Name=Expressed conserved protein|organism=Schmidtea mediterranea sexual|type=transcript|length=973bp
AAAATGTGTAATTTAATTATTTTCTAGTTTCTTGAAAAAATATCAATATG
AAATAAAAGTTCGCCATTATACTTTTAATGTTGAAAAAAAATCAGTGAAT
CAGAGAGAATGATCATCATTGTTGTATTGAGTTCTACTAAATGTCTGCAA
TTAATGCCAACGATCAATTCTCAGCGTTTACTATAACAAAAGATGTTGGT
ATTTGACACTGAGCTTTACTGAAATTCTTACAAAAATTTGCTTAACACAC
TGACTAACACACGAAATTTGCTATTGTTGTAACGGAGCTTGTAACGAGTT
GGTATAAAAATTAAATTTTTCATTAAATTTTACTTGATTTGCAATGAATA
TTTTCAGTTTTTTAATATTTGGATTGTTTAGTTTAATAATTGCAGAATCT
CCAATTGATCTGGATGAACAAATTCAAGGTTATCCACATATCATTACTCA
GACATCGAAATGTAGACCAATAGAAGGAAATTATAAATCATTGATAACAT
ATGTTTGTGACCCTGATAAACTTCTGGATGTTAATCAAATCAATTCATTG
AATGACATGATAGAATCAGTGAGGAAAGATATCAATGTGGGGGAGCCAGA
TTGCAGTGCTGAAAAACCGAAACCAACTATTGCAATCGCACTTGTCAAAA
AGATGATTATTCCAGAAAATTCCAAAGTTGAAGAGTTGATGAGCTTCGGT
TCTCTGTTTTCCTATTCATTATTTACGAATTGGAACTTGCAAGTCAATTG
TAAAAGCGATCCAGATAAAATAATTATCTTTTATTCAAAAGACGACAGTG
TGTTGTATATTTTCGTTGGTAAAAAACTAAAGGCTAGACTAGATACAAAT
AAACTTATGGAAATTATAAACGATTCGAAGCCCGCCTTCACAAATGGTTT
GTATCAAGGCCTCACCGCTGTTATTGCCAGATTAAAAGATACAATGATCA
GACGAAGCAATTAAATTATGCAG
back to top

protein sequence of SMED30021825-orf-1

>SMED30021825-orf-1 ID=SMED30021825-orf-1|Name=SMED30021825-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MNIFSFLIFGLFSLIIAESPIDLDEQIQGYPHIITQTSKCRPIEGNYKSL
ITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAEKPKPTIAIAL
VKKMIIPENSKVEELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKD
DSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDT
MIRRSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033438MOLO1
Vocabulary: cellular component
TermDefinition
GO:0005892acetylcholine-gated channel complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033438Modulator of levamisole receptor-1PFAMPF17175MOLO1coord: 28..151
e-value: 1.7E-19
score: 70.1
NoneNo IPR availableGENE3DG3DSA:3.10.310.50coord: 46..205
e-value: 1.5E-11
score: 45.8
NoneNo IPR availablePANTHERPTHR33748FAMILY NOT NAMEDcoord: 28..196
NoneNo IPR availablePANTHERPTHR33748:SF5coord: 28..196
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.84