centromere protein J

Overview
Namecentromere protein J
Smed IDSMED30021824
Length (bp)3576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of centromere protein J (SMED30021824) t-SNE clustered cells

Violin plots show distribution of expression levels for centromere protein J (SMED30021824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of centromere protein J (SMED30021824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for centromere protein J (SMED30021824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021824SMESG000028453.1 SmedASXL_016966SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021824SMESG000028453.1 dd_Smed_v4_13670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021824SMESG000028453.1 dd_Smed_v4_13670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021824SMESG000028453.1 dd_Smed_v6_13670_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30021824SMESG000028453.1 dd_Smed_v4_13670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021824SMESG000028453.1 dd_Smed_v4_13670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of centromere protein J vs. Ensembl Human
Match: CENPJ (centromere protein J [Source:HGNC Symbol;Acc:HGNC:17272])

HSP 1 Score: 216.083 bits (549), Expect = 2.777e-56
Identity = 97/187 (51.87%), Postives = 133/187 (71.12%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE++Y NG   +++PNG+ K++S D K+I V  +NGDVKQ+ PD RVIY+YA  ++T TTY  G E + + +G  E  +P G +EI FPD++VK L PD  EE+ FP+G ++R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK GN+++D
Sbjct: 1149 IQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQEESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEGNVLMD 1335          

HSP 2 Score: 85.8853 bits (211), Expect = 4.132e-16
Identity = 64/166 (38.55%), Postives = 111/166 (66.87%), Query Frame = 3
Query: 1716 KVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            K+++ Q Q  P DN   +S  L++ +  LE+E+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ ++  L  EN++L   I  +E+ RL
Sbjct:  888 KLNISQDQP-PGDN--ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL 1050          
BLAST of centromere protein J vs. Ensembl Human
Match: CENPJ (centromere protein J [Source:HGNC Symbol;Acc:HGNC:17272])

HSP 1 Score: 85.5001 bits (210), Expect = 4.361e-16
Identity = 64/166 (38.55%), Postives = 111/166 (66.87%), Query Frame = 3
Query: 1716 KVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            K+++ Q Q  P DN   +S  L++ +  LE+E+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ ++  L  EN++L   I  +E+ RL
Sbjct:  888 KLNISQDQP-PGDN--ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL 1050          
BLAST of centromere protein J vs. Ensembl Human
Match: CENPJ (centromere protein J [Source:HGNC Symbol;Acc:HGNC:17272])

HSP 1 Score: 85.5001 bits (210), Expect = 4.852e-16
Identity = 64/166 (38.55%), Postives = 111/166 (66.87%), Query Frame = 3
Query: 1716 KVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            K+++ Q Q  P DN   +S  L++ +  LE+E+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ ++  L  EN++L   I  +E+ RL
Sbjct:  888 KLNISQDQP-PGDN--ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL 1050          
BLAST of centromere protein J vs. Ensembl Human
Match: CENPJ (centromere protein J [Source:HGNC Symbol;Acc:HGNC:17272])

HSP 1 Score: 71.633 bits (174), Expect = 2.056e-13
Identity = 42/103 (40.78%), Postives = 71/103 (68.93%), Query Frame = 3
Query: 1905 FQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ ++  L  EN++L   I  +E+ RL
Sbjct:   30 FEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL 132          
BLAST of centromere protein J vs. Ensembl Fly
Match: Sas-4 (gene:FBgn0011020 transcript:FBtr0081569)

HSP 1 Score: 151.369 bits (381), Expect = 7.952e-37
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 3
Query: 2748 NGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQI-TPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTE---ETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            +G  D+ YPNG+LK+IS D  ++ +  +N D+K+    +G V Y+YA+  +  T+Y +G E + + NG  E     G  EI+FP+ S+KI+ P  TE   E  + +G  +     GDK + LPNGQKEIHT   K+R YPDGT K VYPDG QET Y++GR+R+KDK+G LI+D
Sbjct:  722 DGSKDIWYPNGNLKKISADGMNLRMLYFNKDIKETNIREGTVKYYYAETNTWHTSYLDGLEILEFPNGQTEHRRKDGTVEIHFPNNSIKIVDPSDTEKLEEWRYADGTHLVQLRNGDKILNLPNGQKEIHTKLNKRREYPDGTVKLVYPDGSQETRYSNGRVRLKDKDGKLIMD 895          
BLAST of centromere protein J vs. Ensembl Zebrafish
Match: cenpj (centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030131-6323])

HSP 1 Score: 192.2 bits (487), Expect = 3.267e-49
Identity = 102/266 (38.35%), Postives = 155/266 (58.27%), Query Frame = 3
Query: 2487 NPFSADNGNNDIRGSAA-------SDYYTGEEESGSVDSK--PNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            +P  +  GN+  +GS         S ++   +E+ S  S+  P  + S+     NE   + P+  + P        N+  ++EI   D  +E++  +GG  VV+PNG+ K++S D +++ V  +NGDVK   PD RVIY+YA+ ++T  TY +G E + + N   E   P G +EI FPD++VK LHPD  EE+   +G +++++  G K I    GQ+EIHT   K+R YPDGT KTVY DGRQET Y +GR+R+KD  G +I+D
Sbjct:  857 SPSHSSKGNSSRKGSPETQISLTDSAFFPEVKETQSFKSELSPLVNQSSGVLVMNERSQDAPLNNSFPKLTITGQTNEK-QEEIMQSDSKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTTHITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLTDGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGTVKTVYSDGRQETQYPTGRVRLKDPQGKVIMD 1121          

HSP 2 Score: 88.5817 bits (218), Expect = 3.405e-17
Identity = 57/165 (34.55%), Postives = 106/165 (64.24%), Query Frame = 3
Query: 1719 VSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            V + + Q+ P +    QS  L++ +  LE+E+ RFK EN  + ++K E ++  + L+++   F+K + +E  K+EEYK  E KK+++E+K+FE++   +++ P+K++R EI  LK ++ +++E+   +EARW     RL+Q+V+ L SEN+ L  ++  LE+ RL
Sbjct:  660 VMMPEPQNKPSEEGAAQSRLLRERLVELETEIERFKSENAALARLKQENQDIRENLKKDKADFEKKRIEETAKWEEYKSEEYKKMQREKKLFEKHAATVRARPDKQERDEIQALKQQLNMMQEDLRKREARWSNTQKRLRQQVESLSSENTSLRDQVRTLEKLRL 824          
BLAST of centromere protein J vs. Ensembl Zebrafish
Match: cenpj (centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030131-6323])

HSP 1 Score: 192.2 bits (487), Expect = 3.267e-49
Identity = 102/266 (38.35%), Postives = 155/266 (58.27%), Query Frame = 3
Query: 2487 NPFSADNGNNDIRGSAA-------SDYYTGEEESGSVDSK--PNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            +P  +  GN+  +GS         S ++   +E+ S  S+  P  + S+     NE   + P+  + P        N+  ++EI   D  +E++  +GG  VV+PNG+ K++S D +++ V  +NGDVK   PD RVIY+YA+ ++T  TY +G E + + N   E   P G +EI FPD++VK LHPD  EE+   +G +++++  G K I    GQ+EIHT   K+R YPDGT KTVY DGRQET Y +GR+R+KD  G +I+D
Sbjct:  857 SPSHSSKGNSSRKGSPETQISLTDSAFFPEVKETQSFKSELSPLVNQSSGVLVMNERSQDAPLNNSFPKLTITGQTNEK-QEEIMQSDSKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTTHITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLTDGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGTVKTVYSDGRQETQYPTGRVRLKDPQGKVIMD 1121          

HSP 2 Score: 88.5817 bits (218), Expect = 3.405e-17
Identity = 57/165 (34.55%), Postives = 106/165 (64.24%), Query Frame = 3
Query: 1719 VSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            V + + Q+ P +    QS  L++ +  LE+E+ RFK EN  + ++K E ++  + L+++   F+K + +E  K+EEYK  E KK+++E+K+FE++   +++ P+K++R EI  LK ++ +++E+   +EARW     RL+Q+V+ L SEN+ L  ++  LE+ RL
Sbjct:  660 VMMPEPQNKPSEEGAAQSRLLRERLVELETEIERFKSENAALARLKQENQDIRENLKKDKADFEKKRIEETAKWEEYKSEEYKKMQREKKLFEKHAATVRARPDKQERDEIQALKQQLNMMQEDLRKREARWSNTQKRLRQQVESLSSENTSLRDQVRTLEKLRL 824          
BLAST of centromere protein J vs. Ensembl Zebrafish
Match: cenpj (centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030131-6323])

HSP 1 Score: 192.2 bits (487), Expect = 3.267e-49
Identity = 102/266 (38.35%), Postives = 155/266 (58.27%), Query Frame = 3
Query: 2487 NPFSADNGNNDIRGSAA-------SDYYTGEEESGSVDSK--PNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            +P  +  GN+  +GS         S ++   +E+ S  S+  P  + S+     NE   + P+  + P        N+  ++EI   D  +E++  +GG  VV+PNG+ K++S D +++ V  +NGDVK   PD RVIY+YA+ ++T  TY +G E + + N   E   P G +EI FPD++VK LHPD  EE+   +G +++++  G K I    GQ+EIHT   K+R YPDGT KTVY DGRQET Y +GR+R+KD  G +I+D
Sbjct:  857 SPSHSSKGNSSRKGSPETQISLTDSAFFPEVKETQSFKSELSPLVNQSSGVLVMNERSQDAPLNNSFPKLTITGQTNEK-QEEIMQSDSKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTTHITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLTDGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGTVKTVYSDGRQETQYPTGRVRLKDPQGKVIMD 1121          

HSP 2 Score: 88.5817 bits (218), Expect = 3.405e-17
Identity = 57/165 (34.55%), Postives = 106/165 (64.24%), Query Frame = 3
Query: 1719 VSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            V + + Q+ P +    QS  L++ +  LE+E+ RFK EN  + ++K E ++  + L+++   F+K + +E  K+EEYK  E KK+++E+K+FE++   +++ P+K++R EI  LK ++ +++E+   +EARW     RL+Q+V+ L SEN+ L  ++  LE+ RL
Sbjct:  660 VMMPEPQNKPSEEGAAQSRLLRERLVELETEIERFKSENAALARLKQENQDIRENLKKDKADFEKKRIEETAKWEEYKSEEYKKMQREKKLFEKHAATVRARPDKQERDEIQALKQQLNMMQEDLRKREARWSNTQKRLRQQVESLSSENTSLRDQVRTLEKLRL 824          
BLAST of centromere protein J vs. Ensembl Xenopus
Match: fam110b (family with sequence similarity 110 member B [Source:Xenbase;Acc:XB-GENE-961184])

HSP 1 Score: 189.504 bits (480), Expect = 4.352e-48
Identity = 88/187 (47.06%), Postives = 127/187 (67.91%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            ++ E+ + DG VERI  NG   + +PNG+ K++S D KS  V  +NGDVKQ+  D R+IY+YA D++T TTY +G E + + NG  E   P G +EI FPD+++K L+ D  EE+  P+G ++     G K I   NGQ+E+HT   K+R YPDGT KTVY +G+ ET Y+SGR+R+KDK+GN+++D
Sbjct: 1131 VQGEVTYSDGKVERILRNGYHVIEFPNGTRKEVSADGKSTTVKFFNGDVKQVLGDQRIIYYYADDQTTHTTYPDGLEILQFSNGQIEKHFPDGRKEITFPDQTIKNLYTDGREESILPDGTIITNHPDGSKVIEFDNGQREVHTPQYKRREYPDGTVKTVYNNGQTETKYSSGRLRIKDKDGNVVMD 1317          

HSP 2 Score: 77.0258 bits (188), Expect = 1.810e-13
Identity = 62/151 (41.06%), Postives = 104/151 (68.87%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            +++S  L++ +  LE+E+ RFK+EN  + K + ++E+ ++ L ++M  F++ K  E+ KFEE+K+ EIKKL+KERKVFE+Y  A +++P+K++R+EI  LK +V  L+E+   KEA+W     RL+ ++D L  EN+EL   I  +E+ RL
Sbjct:  861 SVRSRLLREKLVELETEIERFKIENAAVAKRREDQEKAMETLRKDMAAFEQQKALELAKFEEFKKEEIKKLQKERKVFEKYASAARAVPDKREREEIQALKQQVADLQEDIKRKEAKWSTTQGRLRNQIDALSKENTELKEEIKFIEKVRL 1011          
BLAST of centromere protein J vs. Ensembl Mouse
Match: Cenpj (centromere protein J [Source:MGI Symbol;Acc:MGI:2684927])

HSP 1 Score: 213.386 bits (542), Expect = 1.293e-55
Identity = 96/187 (51.34%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE+IY NG   V++PNG+ K++S D KS+ V  +NGDVKQ+ PD RV+Y+YA  ++T TTY  G E + + +G  E   P G +EI FPD+++K L  D  EE+ FP+G ++R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK+GN+++D
Sbjct: 1155 IQGEISHPDGKVEKIYKNGRRVVLFPNGTRKEVSADGKSVTVTFFNGDVKQVMPDERVVYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHFPDGRKEITFPDQTIKTLFADGQEESIFPDGTIVRVQRDGNKIIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYTSGRVRVKDKDGNVLMD 1341          

HSP 2 Score: 87.0409 bits (214), Expect = 1.270e-16
Identity = 60/151 (39.74%), Postives = 103/151 (68.21%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            +++S  L++ V  LESE+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EEY++ E +KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W +  SRL+ +++ L  EN++L   I  +E+ RL
Sbjct:  899 SVRSQVLREKVTELESEIEKFKAENTSLAKLRIERESALEKLRKEIADFEQQKARELARIEEYRKEETRKLQKERKVFEKYTAAARTFPDKKEREEIQALKQQIADLQEDLKRKETKWSSTQSRLRSQIEMLVKENTDLREEIKVMERFRL 1049          
BLAST of centromere protein J vs. Ensembl Mouse
Match: Cenpj (centromere protein J [Source:MGI Symbol;Acc:MGI:2684927])

HSP 1 Score: 213.386 bits (542), Expect = 1.293e-55
Identity = 96/187 (51.34%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE+IY NG   V++PNG+ K++S D KS+ V  +NGDVKQ+ PD RV+Y+YA  ++T TTY  G E + + +G  E   P G +EI FPD+++K L  D  EE+ FP+G ++R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK+GN+++D
Sbjct: 1155 IQGEISHPDGKVEKIYKNGRRVVLFPNGTRKEVSADGKSVTVTFFNGDVKQVMPDERVVYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHFPDGRKEITFPDQTIKTLFADGQEESIFPDGTIVRVQRDGNKIIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYTSGRVRVKDKDGNVLMD 1341          

HSP 2 Score: 87.0409 bits (214), Expect = 1.270e-16
Identity = 60/151 (39.74%), Postives = 103/151 (68.21%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            +++S  L++ V  LESE+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EEY++ E +KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W +  SRL+ +++ L  EN++L   I  +E+ RL
Sbjct:  899 SVRSQVLREKVTELESEIEKFKAENTSLAKLRIERESALEKLRKEIADFEQQKARELARIEEYRKEETRKLQKERKVFEKYTAAARTFPDKKEREEIQALKQQIADLQEDLKRKETKWSSTQSRLRSQIEMLVKENTDLREEIKVMERFRL 1049          
BLAST of centromere protein J vs. Ensembl Mouse
Match: Tcp10b (t-complex protein 10b [Source:MGI Symbol;Acc:MGI:98542])

HSP 1 Score: 190.66 bits (483), Expect = 5.914e-52
Identity = 95/211 (45.02%), Postives = 134/211 (63.51%), Query Frame = 3
Query: 2637 NVPVKQNAPSFAKMNHCNDIIK----DEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            N+P K  AP   ++   +D  K     E  HP+G VER+  +G   + +PNG+ K+IS D K+ L+  +NGD+K+I  D +VIY+YA  ++  TTY +G E + + N   E  +P G +E  FPD +VK L  D  EET FP+G  + +   GDK I+  NG+KEIHT   K++ +PDGT+KTVY +G QET YASGR+RVKD+ G +ILD
Sbjct:  229 NIPTKSRAPK--EIQQTSDTTKTDETKEKRHPNGKVERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKIKSDQKVIYYYADAQTMHTTYPDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKQLK-DGCEETVFPDGTFVTVKRNGDKTIMFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVKDEKGTVILD 436          
BLAST of centromere protein J vs. Ensembl Mouse
Match: Tcp10b (t-complex protein 10b [Source:MGI Symbol;Acc:MGI:98542])

HSP 1 Score: 190.66 bits (483), Expect = 5.914e-52
Identity = 95/211 (45.02%), Postives = 134/211 (63.51%), Query Frame = 3
Query: 2637 NVPVKQNAPSFAKMNHCNDIIK----DEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            N+P K  AP   ++   +D  K     E  HP+G VER+  +G   + +PNG+ K+IS D K+ L+  +NGD+K+I  D +VIY+YA  ++  TTY +G E + + N   E  +P G +E  FPD +VK L  D  EET FP+G  + +   GDK I+  NG+KEIHT   K++ +PDGT+KTVY +G QET YASGR+RVKD+ G +ILD
Sbjct:  229 NIPTKSRAPK--EIQQTSDTTKTDETKEKRHPNGKVERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKIKSDQKVIYYYADAQTMHTTYPDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKQLK-DGCEETVFPDGTFVTVKRNGDKTIMFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVKDEKGTVILD 436          
BLAST of centromere protein J vs. Ensembl Mouse
Match: Tcp10a (t-complex protein 10a [Source:MGI Symbol;Acc:MGI:98541])

HSP 1 Score: 188.734 bits (478), Expect = 1.689e-51
Identity = 94/211 (44.55%), Postives = 134/211 (63.51%), Query Frame = 3
Query: 2637 NVPVKQNAPSFAKMNHCNDIIK----DEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            N+P K  AP   ++   +D  K     E  HP+G VER+  +G   + +PNG+ K+IS D K+ L+  +NGD+K+I  + +VIY+YA  ++  TTY +G E + + N   E  +P G +E  FPD +VK L  D  EET FP+G  + +   GDK I+  NG+KEIHT   K++ +PDGT+KTVY +G QET YASGR+RVKD+ G +ILD
Sbjct:  211 NIPTKSRAPK--EIQQTSDTTKTDETKEKQHPNGKVERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKIKSNQKVIYYYADAQTMHTTYPDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKRLK-DGCEETVFPDGTFVTVKRNGDKTIMFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVKDEKGTVILD 418          
BLAST of centromere protein J vs. UniProt/SwissProt
Match: sp|Q9HC77|CENPJ_HUMAN (Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 1.334e-55
Identity = 97/187 (51.87%), Postives = 133/187 (71.12%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE++Y NG   +++PNG+ K++S D K+I V  +NGDVKQ+ PD RVIY+YA  ++T TTY  G E + + +G  E  +P G +EI FPD++VK L PD  EE+ FP+G ++R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK GN+++D
Sbjct: 1149 IQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQEESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEGNVLMD 1335          

HSP 2 Score: 85.8853 bits (211), Expect = 1.984e-15
Identity = 64/166 (38.55%), Postives = 111/166 (66.87%), Query Frame = 3
Query: 1716 KVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            K+++ Q Q  P DN   +S  L++ +  LE+E+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ ++  L  EN++L   I  +E+ RL
Sbjct:  888 KLNISQDQP-PGDN--ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL 1050          
BLAST of centromere protein J vs. UniProt/SwissProt
Match: sp|Q5BQN8|CENPJ_PANTR (Centromere protein J OS=Pan troglodytes OX=9598 GN=CENPJ PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.534e-55
Identity = 97/187 (51.87%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE++Y NG   +++PNG+ K++S D K+I V  +NGDVKQ+ PD RVIY+YA  ++T TTY  G E + + +G  E  +P G +EI FPD++VK L PD  EE+ FP+G  +R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK GN+++D
Sbjct: 1149 IQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQEESIFPDGTTVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEGNVLMD 1335          

HSP 2 Score: 89.7373 bits (221), Expect = 1.200e-16
Identity = 65/167 (38.92%), Postives = 114/167 (68.26%), Query Frame = 3
Query: 1713 PKVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            PK++++Q Q  P DN   +S  L++ +  LE+E+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EE+K+ E++KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W + +SRL+ +++ L  EN++L   I  +E+ RL
Sbjct:  888 PKLNINQDQP-PGDN--ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIEMLVRENTDLREEIKVMERFRL 1051          
BLAST of centromere protein J vs. UniProt/SwissProt
Match: sp|Q569L8|CENPJ_MOUSE (Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 9.043e-55
Identity = 96/187 (51.34%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            I+ EI HPDG VE+IY NG   V++PNG+ K++S D KS+ V  +NGDVKQ+ PD RV+Y+YA  ++T TTY  G E + + +G  E   P G +EI FPD+++K L  D  EE+ FP+G ++R+   G+K I   NGQ+E+HT   K+R YPDGT KTVY +G QET Y SGR+RVKDK+GN+++D
Sbjct: 1155 IQGEISHPDGKVEKIYKNGRRVVLFPNGTRKEVSADGKSVTVTFFNGDVKQVMPDERVVYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHFPDGRKEITFPDQTIKTLFADGQEESIFPDGTIVRVQRDGNKIIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYTSGRVRVKDKDGNVLMD 1341          

HSP 2 Score: 87.0409 bits (214), Expect = 8.886e-16
Identity = 60/151 (39.74%), Postives = 103/151 (68.21%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            +++S  L++ V  LESE+ +FK EN  + K++IE+E  L++L +E+  F++ K  E+ + EEY++ E +KL+KERKVFE+Y  A ++ P+KK+R+EI  LK ++  L+E+   KE +W +  SRL+ +++ L  EN++L   I  +E+ RL
Sbjct:  899 SVRSQVLREKVTELESEIEKFKAENTSLAKLRIERESALEKLRKEIADFEQQKARELARIEEYRKEETRKLQKERKVFEKYTAAARTFPDKKEREEIQALKQQIADLQEDLKRKETKWSSTQSRLRSQIEMLVKENTDLREEIKVMERFRL 1049          
BLAST of centromere protein J vs. TrEMBL
Match: A0A419Q1J7 (Centromere protein J OS=Clonorchis sinensis OX=79923 GN=CENPJ PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.153e-78
Identity = 194/524 (37.02%), Postives = 301/524 (57.44%), Query Frame = 3
Query: 1773 VKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVSQAISMKHMNIPINML------TKEDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSNSNTYRNE--IDVN------VPVK----QNAPSFAKMNHCND-----------IIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
              ++QW+  LESEV RFK EN  + ++K E+EE +KRLE E K+F++ ++ E + F +Y++ E++KLKKER+V +EYQ A+KS P KK+R+EI+ L+ E++  + + S +E RW AA +RL+ ++++LE+E  EL TR+  LE  R++LQAQL  N ++     L   + + T +SV         N P+                +  V    K R+S+I     +  +   +       +++    A + +       +  YYTGE++  S+ S   G N+++  + N+  ID++      VPV+    ++A   +K N  ++            +   + HPDG  E  Y+NG   + Y NGS+K++ PD K++LV L+NGD+K+  PDGRVIY YA D + Q TY +G E+I Y +G +E++HP   ++    + +VK+   +LT     PN         GD+EI LPNGQ+EIH+     RIYPDGT+KTV+PDGR ET Y+SGR+RVKD  GNLILD
Sbjct:  563 AAIRQWITRLESEVRRFKTENTNLLRLKAEREESMKRLECETKKFEEMREKERKLFSDYRENEMRKLKKERRVLDEYQRALKSTPAKKEREEIERLRDELQEARSDLSRREVRWHAAIARLRSRIEELEAERDELKTRVRRLEDDRIELQAQL--NTSRSANGSLTRTQIRRTASSVG--------NAPLGGYRWTSRSGSHSAGLDTLVGVGAKHRSSTIGSGVDRPLSARDSVSSSGRPSSLITRRATSTDGTRESVHSGGYYTGEDDCLSLTS---GGNADTERHDNKGGIDLDRISPATVPVQSQIDRSASGPSKRNAADEKLPVPGTAASGAVVRSVKHPDGSSEETYVNGATVISYANGSVKEVFPDRKTVLVSLFNGDIKRTLPDGRVIYHYAGDGTVQITYPDGTEEINYADGRQEIIHPKSTQKSQG-ESAVKLSGTELTSRR-LPN---------GDREISLPNGQREIHSC----RIYPDGTTKTVFPDGRHETRYSSGRLRVKDAQGNLILD 1058          
BLAST of centromere protein J vs. TrEMBL
Match: A0A158QFE5 (Tcp10_C domain-containing protein OS=Hymenolepis diminuta OX=6216 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.147e-71
Identity = 181/538 (33.64%), Postives = 288/538 (53.53%), Query Frame = 3
Query: 1740 SNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSI----KPKPTVTSVSQAISMKHMNI----PINMLTKEDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSAD-NGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSNSNTYRNEIDV-NVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREIN----FPDKSVKIL--------------HPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVS 3269
            S+ E++    S  +K W+  LE+EVNRF  E   + +++ E  + L  LE E K+F+KYK+  +++FE Y+Q EI KLK+ERKV  +YQ ++ +MP K+DR+EI+ LK ++   K EA+ +E R Q    R + ++++L +E +EL  RI  LE+ RL +Q  +      +     N +    K +  + S++Q I+    N     P N  T++        AG+  +R+                     +   V PFS   NGN ++    ++          S ++    + S+++T R  + + ++P +   P           +  E+ HPD   ER+Y +G   + Y NGS K+I  D  S +V+L+NGD KQ   DG V+Y YA D + QTT  +G E+IVY +G +E+ +P      +     P + + +L               P++ EE+ +P+G+ ++I   GDK I LPNGQ+EIH    K+RIYPDGT K+V+PDGRQET YASGR+RVKD +GNL++D  ++
Sbjct:  255 SSKEEHFDKSSASVKFWIARLEAEVNRFNTETATLIRLRTENAQALSALEMERKEFEKYKETTMKEFESYRQDEISKLKRERKVLSDYQRSLHTMPQKRDREEIERLKQQLSEEKIEAAQRETRLQNQLGRQRLRIEELTTEKNELLERIKRLEESRLAMQNTIAEERASRSLDGSNKLHRNFKSQNQIDSITQNITFPQCNAKSSHPSNAETQQSKVVRATSAGSVSSRS--------------------VVTPAVLPFSKSMNGNLNMEEMPSNSLPICLPSQLSSENISGYNGSSTSTSRTPLSLRSLPKRNRGP-----------VLREVRHPDSSFERLYCDGSRTIEYANGSAKEIFADGVSSIVYLFNGDTKQTMEDGTVVYKYAADGTVQTTKPDGTEEIVYNDGRREINYPRDRMPASNSSISPQQQLPLLPTHQRVPNSTNPANRPEIVEESRYPDGMSVQIFANGDKIISLPNGQREIHCLEFKRRIYPDGTVKSVFPDGRQETRYASGRVRVKDPDGNLLVDTRIA 761          
BLAST of centromere protein J vs. TrEMBL
Match: A0A3P7BIT2 (Tcp10_C domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8739 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.505e-71
Identity = 181/538 (33.64%), Postives = 288/538 (53.53%), Query Frame = 3
Query: 1740 SNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSI----KPKPTVTSVSQAISMKHMNI----PINMLTKEDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSAD-NGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSNSNTYRNEIDV-NVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREIN----FPDKSVKIL--------------HPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVS 3269
            S+ E++    S  +K W+  LE+EVNRF  E   + +++ E  + L  LE E K+F+KYK+  +++FE Y+Q EI KLK+ERKV  +YQ ++ +MP K+DR+EI+ LK ++   K EA+ +E R Q    R + ++++L +E +EL  RI  LE+ RL +Q  +      +     N +    K +  + S++Q I+    N     P N  T++        AG+  +R+                     +   V PFS   NGN ++    ++          S ++    + S+++T R  + + ++P +   P           +  E+ HPD   ER+Y +G   + Y NGS K+I  D  S +V+L+NGD KQ   DG V+Y YA D + QTT  +G E+IVY +G +E+ +P      +     P + + +L               P++ EE+ +P+G+ ++I   GDK I LPNGQ+EIH    K+RIYPDGT K+V+PDGRQET YASGR+RVKD +GNL++D  ++
Sbjct:  255 SSKEEHFDKSSASVKFWIARLEAEVNRFNTETATLIRLRTENAQALSALEMERKEFEKYKETTMKEFESYRQDEISKLKRERKVLSDYQRSLHTMPQKRDREEIERLKQQLSEEKIEAAQRETRLQNQLGRQRLRIEELTTEKNELLERIKRLEESRLAMQNTIAEERASRSLDGSNKLHRNFKSQNQIDSITQNITFPQCNAKSSHPSNAETQQSKVVRATSAGSVSSRS--------------------VVTPAVLPFSKSMNGNLNMEEMPSNSLPICLPSQLSSENISGYNGSSTSTSRTPLSLRSLPKRNRGP-----------VLREVRHPDSSFERLYCDGSRTIEYANGSAKEIFADGVSSIVYLFNGDTKQTMEDGTVVYKYAADGTVQTTKPDGTEEIVYNDGRREINYPRDRMPASNSSISPQQQLPLLPTHQRVPNSTNPANRPEIVEESRYPDGMSVQIFANGDKIISLPNGQREIHCLEFKRRIYPDGTVKSVFPDGRQETRYASGRVRVKDPDGNLLVDTRIA 761          
BLAST of centromere protein J vs. TrEMBL
Match: A0A1V4K9N3 (Centromere protein J-like OS=Patagioenas fasciata monilis OX=372326 GN=AV530_002921 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.214e-61
Identity = 175/506 (34.58%), Postives = 287/506 (56.72%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTS----VSQAISMKHMNIPINMLTK-EDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSADNGNNDIRGSA--ASDYYTGEEESGSVDSKPNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            T+ S  L++ +  LE+E+ RF+ EN  + K++ E+E  L    +E+ +FQ+ K  E+   EEYK+ E+KKL+KERKVFE+Y    K++P+KK+R EI  LK ++  L+E+   KEA+W   + RLK +++ L +EN EL   +  +E+ RL+   ++ +  +++  +   ++K   +        SQ+ S+    +P+   +K    + ++     ++T AS+                           ++D  N++   +   +S  +TG       D+ PN           E +V++P   + P+F      ++ I+ E  +PDG VE++  NG   + +PNG+ K++  D K+I +  +NGDVKQ+ PD  VIY+YA  ++T TTYS+G E + + NG  E  +P G +EI FPD+++K L  D  EE+ FP+G ++RI   G K I   NGQ+E+HT   K+R YPDGT KTVY +G+QET Y SGR+R+KDK+GN+I+D
Sbjct:  786 TVPSQVLRERLTELENEIERFRTENTTLTKLREEREHALANFRKEVAEFQQQKAQELAAIEEYKKKEMKKLQKERKVFEKYTTEAKAIPDKKERDEIQALKQQIAELQEDLKRKEAKWSTTHRRLKDQIEVLVNENMELKEEVKIMERFRLEAWKKVEAAGSKRKIENSGTLKRAESCLRNRGLKSQSASLL---LPVQKYSKINGKSYSQAKGKLSRTSASAP--------------------------ASDRSNSETMTALEDSSSTFTG-------DTSPN-----------EANVSLP---SGPAFTD----SEEIERETAYPDGKVEKVLKNGCHLIFFPNGTWKKVGSDGKTITITFFNGDVKQVMPDQTVIYYYADAKTTHTTYSDGLEVLQFSNGQIEKHYPDGKKEITFPDQTIKNLFTDGQEESIFPDGTIVRIQRDGSKTIEFNNGQRELHTPQFKRREYPDGTVKTVYVNGQQETKYVSGRVRIKDKDGNIIMD 1237          
BLAST of centromere protein J vs. TrEMBL
Match: A0A3L8STI5 (Tcp10_C domain-containing protein OS=Chloebia gouldiae OX=44316 GN=DV515_00003097 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 8.231e-61
Identity = 176/499 (35.27%), Postives = 275/499 (55.11%), Query Frame = 3
Query: 1761 TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVSQAISMKHMNIPINMLTKEDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            T+ S  L++ +  LE E+ RF+ EN  + K++ E+E  L  + +E+  F + K  E+ + EEYK+ EIKKL+KERKVFE+Y    +++P+KK+R EI  LK ++  L+E+   KEA+W   + RLK +++ L +EN EL   I  +E+ RL+   +  +  ++K             + +   +++     +P   L               K++A+S+     K    N     +     ++   A    N+   S A        +S  VD+ PN           E  V+ P   +AP F      ++ I+ E  +PDG VE++  NG   + +PNG+ K++  D K+I +  +NGDVKQI PD  VIY+YA  ++T TTYS+G E + + NG  E  +P G +EI FPD+++K L  D  EE+ FP+G ++R+   G K I   NGQ+E+HT   K+R YPDGT KTVY +G+QET Y SGR+R+KDK+GN+I+D
Sbjct:  873 TVPSQLLRERLAELEKEIERFRTENTILSKLREEREHALASIRKEIADFGQKKAQELAEIEEYKKKEIKKLQKERKVFEKYTTEARAIPDKKERDEIQALKQQIAELQEDLKRKEAKWSTTHRRLKDQIEALVNENFELKEEIKIMEKFRLEAWKKAEAAGSKK------------KIENPGMSLNRAESCLPNRDL---------------KSQAASLLLPVQKGKKINGKSYSQAKVGKLSRTPASGPANERNNSEAMTALEDSSQSSMVDTSPN-----------EAYVSAP---SAPVFTG----SEEIERETAYPDGKVEKVLKNGCHLIFFPNGTWKKVGSDGKTITITFFNGDVKQIMPDQTVIYYYADAKTTHTTYSDGLEVLQFSNGQIEKHYPDGKKEITFPDQTIKSLFSDGQEESIFPDGTIVRVQRDGTKTIEFSNGQRELHTPQFKRREYPDGTVKTVYMNGQQETKYVSGRVRIKDKDGNIIMD 1326          
BLAST of centromere protein J vs. Ensembl Cavefish
Match: cenpj (centromere protein J [Source:NCBI gene;Acc:103031572])

HSP 1 Score: 192.971 bits (489), Expect = 1.587e-49
Identity = 89/189 (47.09%), Postives = 129/189 (68.25%), Query Frame = 3
Query: 2691 DIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            D+ ++EI H DG +E++  +GG  +V+PNG+ K++S D  SI V  +NGD+K I PD RVIY+YA  ++T TTY +G E + + N   E   P G +EI FPD++VK ++PD  EE+   +G +++ +  G K+I   NGQ+E+HT   K+R YPDGT KTVY DGRQET Y SGR+R+KD  G +++D
Sbjct: 1003 DMEQEEITHTDGKIEKLLPDGGRLIVFPNGTRKELSADGLSIKVTFFNGDIKHIMPDQRVIYYYAGAQTTHTTYPDGIEVLQFPNNQIEKHFPDGHKEITFPDQTVKNIYPDGREESVLADGTIIQQNPDGSKKIQFNNGQRELHTAEFKRREYPDGTVKTVYSDGRQETRYPSGRVRLKDPQGRVVMD 1191          

HSP 2 Score: 90.8929 bits (224), Expect = 5.871e-18
Identity = 60/161 (37.27%), Postives = 105/161 (65.22%), Query Frame = 3
Query: 1743 NPEDNL----TIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
            NPE         QS  L++ +  LE+E+ RFK EN  + +++ E E+  + L +E  QFQ+   DE+ K+EE+K+ E +KL++E+K+FE++  A ++ P+K++R E+ +LK ++  L+E+   +EARW + + RL+Q+VD L +EN+ L  ++  LE+ RL
Sbjct:  716 NPEATCDEQGAAQSRLLRERLVELETEIERFKTENAVLSRLRQENEDVRENLRKETAQFQQKMADELAKWEEFKREESRKLQREKKLFEKHAAAARARPDKQERDEMQSLKQQLNSLQEDLRKREARWSSTHQRLRQQVDTLSAENTTLRGQVRMLEKLRL 876          
BLAST of centromere protein J vs. Ensembl Cavefish
Match: ENSAMXT00000049611.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001453.1:17496:34544:1 gene:ENSAMXG00000039482.1 transcript:ENSAMXT00000049611.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 1.529e-44
Identity = 80/169 (47.34%), Postives = 116/169 (68.64%), Query Frame = 3
Query: 2730 VERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDK 3236
            VE++  +G   +V+ NG+ K+IS D KS+ V  +NGDVK++ PDG V+Y+Y   ++T +TY +G E + + N  KE  HP G REI FPD +VK L+ D  +++ FP+G V++++  GDK +   NGQ+E+HT   K+RIYPDGT KTVY +GRQE  Y SGR+  K+K
Sbjct:  152 VEQLLSDGSRVIVFRNGTKKEISVDQKSVTVTFFNGDVKRLLPDGTVVYYYCDAKTTHSTYPSGLEILQFPNNQKEKHHPDGRREIFFPDGTVKSLYTDGRQQSVFPDGTVVKLN--GDKTVEFTNGQREVHTAQYKQRIYPDGTVKTVYLNGRQEIKYLSGRVSFKNK 318          
BLAST of centromere protein J vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004600.1 (pep scaffold:Pmarinus_7.0:GL476377:13485:16635:-1 gene:ENSPMAG00000004191.1 transcript:ENSPMAT00000004600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 2.292e-38
Identity = 65/130 (50.00%), Postives = 90/130 (69.23%), Query Frame = 3
Query: 2868 VIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
             IY+YA  ++TQTT+ +G E + + +   E  +P G +EI FPD++VK LH D  EET  P+G V+     GD+E+   +GQ+E+HT   K+R YPDGT KTV+PDGRQET YASGR+R+KD  GN++ D
Sbjct:    7 FIYYYADAQTTQTTFPDGLEILQFPDNQIEKHYPDGSKEIVFPDQTVKHLHVDGREETICPDGTVVHTQPNGDREMEFADGQREVHTARYKRREYPDGTVKTVFPDGRQETRYASGRLRLKDSAGNIVFD 136          

HSP 2 Score: 50.0618 bits (118), Expect = 2.404e-7
Identity = 34/122 (27.87%), Postives = 62/122 (50.82%), Query Frame = 3
Query: 2718 PDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTG 3083
            PDG+    + +  I+  YP+GS + + PD     +H+ +G  + I PDG V++          T  NG  ++ + +G +EV H +  +   +PD +VK + PD  +ET + +G +    + G
Sbjct:   22 PDGLEILQFPDNQIEKHYPDGSKEIVFPDQTVKHLHV-DGREETICPDGTVVH----------TQPNGDREMEFADGQREV-HTARYKRREYPDGTVKTVFPDGRQETRYASGRLRLKDSAG 131          
BLAST of centromere protein J vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010536.1 (pep scaffold:Pmarinus_7.0:GL485795:6714:10727:1 gene:ENSPMAG00000009545.1 transcript:ENSPMAT00000010536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 2.391e-7
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 2658 APSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVI 2873
            A  F      +D ++ EI +PDG VE +  +G   V + NG+ K++S D  ++ V   NGDVK+ T D RV+
Sbjct:   12 AVGFHDDREADDDVQQEILYPDGKVEMVLRSGRRMVQFRNGTRKEVSADGHTVTVAFPNGDVKKTTDDQRVV 83          
BLAST of centromere protein J vs. Ensembl Nematostella
Match: EDO41298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4L0])

HSP 1 Score: 192.586 bits (488), Expect = 1.241e-55
Identity = 87/184 (47.28%), Postives = 132/184 (71.74%), Query Frame = 3
Query: 2706 EIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILD 3257
            EI HPDG VE++  +G   +++ NG+ ++IS D K+++V  +NGD+KQ+ PD RV+Y+Y++ ++T TTY +G E + + N   E  +  G +EI FPD++VK LH + +EE  FP+G V R+S+ G++ I  PNGQ+EIHT   KKR YP+GT KTV+ DGR ET Y++GR+RV+D+ G +I+D
Sbjct:   37 EIAHPDGKVEQVQPDGSRVILFANGTRREISSDGKTVIVTFFNGDIKQVMPDQRVVYYYSEAQTTHTTYPDGLEVLQFPNNQIEKHYTDGTKEIIFPDQTVKYLHTNGSEECVFPDGTVQRLSHDGERTIEFPNGQREIHTKFYKKREYPNGTVKTVFQDGRTETRYSNGRLRVRDQEGRVIMD 220          
BLAST of centromere protein J vs. Ensembl Nematostella
Match: EDO46216 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQS0])

HSP 1 Score: 66.6254 bits (161), Expect = 2.476e-11
Identity = 55/193 (28.50%), Postives = 91/193 (47.15%), Query Frame = 3
Query: 2715 HPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQIT-PDGRVIYFYAQDESTQ-TTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            HP+G+    + NG   V +PNG      P+    + H  NG V+ +T P+G  + +  Q    Q  T+ NG + + + NG + V HP+GV+ +  P+    + HP+  +    PNG+       G + +  PNG Q   H NGV+   +P+G     +P   Q   + +G   V   NG     QYV++ + +
Sbjct:   47 HPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHP-NG-VQYVTHPNG--VQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVAHPYDVQYVTHPNGVQYVTHPNG----VQYVTQPNGV 231          

HSP 2 Score: 65.855 bits (159), Expect = 4.410e-11
Identity = 49/161 (30.43%), Postives = 75/161 (46.58%), Query Frame = 3
Query: 2715 HPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQ 3194
            HP+G+    + NG   V +PNG      P     + H  NG V+ +T    V Y    + S   T++NG   + Y NG + V HP+GV+ +   + S  + +P+  +    PNG        G + +  PNG Q   H NGV+   +P+G     YP+G Q
Sbjct:  273 HPNGVQYVTHPNGVQYVTHPNGVQYVTHPKDVQYVAHP-NG-VQYVTHPNGVQYLTHPNRSQYVTHNNGVHYVFYTNGVQYVTHPNGVQYVTHTNGSRYVTYPNGVQYVTHPNGAQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTYPNGVQ 431          

HSP 3 Score: 63.929 bits (154), Expect = 2.163e-10
Identity = 50/179 (27.93%), Postives = 80/179 (44.69%), Query Frame = 3
Query: 2709 IHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNG 3242
            + HP+G+      NG   V +PNG      P+    + H  NG V+ +T    V Y    +     T+ NG + + + NG + V  P+GV+ +  P+    + HP+  +    PNG+       G + +  PNG Q   H NGV+   +P+G      P+G Q   + +G   V   NG
Sbjct:   18 VFHPNGVQYVTQPNGVQYVTHPNGVRCVTHPNGVQYVTHP-NG-VQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNG 194          

HSP 4 Score: 63.1586 bits (152), Expect = 3.781e-10
Identity = 52/197 (26.40%), Postives = 89/197 (45.18%), Query Frame = 3
Query: 2697 IKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            ++  + HP+G+    + NG   V +PNG      P+    + H  NG V+ +T    V Y    +     T+    + + + NG + V HP+GV+ +  P++S  + H +     F+ NG+         + +  PNG Q   HTNG +   YP+G     +P+G Q   + +G   V   NG     QYV+  + +
Sbjct:  231 VQYYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHP-NG-VQYVTHPNGVQYVTHPNGVQYVTHPKDVQYVAHPNGVQYVTHPNGVQYLTHPNRSQYVTHNNGVHYVFYTNGV---------QYVTHPNGVQYVTHTNGSRYVTYPNGVQYVTHPNGAQYVTHPNGVQYVTHPNG----VQYVTHPNGV 412          

HSP 5 Score: 62.7734 bits (151), Expect = 4.272e-10
Identity = 52/191 (27.23%), Postives = 85/191 (44.50%), Query Frame = 3
Query: 2718 PDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEI--HTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            P+G+    + NG   V +PNG      P+    + H  NG V+ +T    V Y    +     T+ NG + +   NG + V HP+GV+ +  P+    + HP   +    PNG+       G + +  PNG +    H NGV+   +P+G     +P+G Q   + +G   V   NG     QYV+  + +
Sbjct:  102 PNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHP-NG-VQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVAHPYDVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNG----VQYVTHPNGV 286          

HSP 6 Score: 62.003 bits (149), Expect = 8.073e-10
Identity = 37/127 (29.13%), Postives = 62/127 (48.82%), Query Frame = 3
Query: 2907 TYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            T+ NG + + + NG + V HP+GV+ +  P+    + HP+  +    PNG+       G + +  PNG Q   H NGV+   +P+G     +P+G Q   + +G   V   NG     QYV+  + +
Sbjct:   46 THPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNG----VQYVTHPNGV 168          

HSP 7 Score: 58.9214 bits (141), Expect = 7.826e-9
Identity = 49/177 (27.68%), Postives = 75/177 (42.37%), Query Frame = 3
Query: 2715 HPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPN-GQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNG 3242
            HP  +    + NG   V +PNG      P+     V   NG V+ +T    V Y    +     T+ NG + + + NG + V HP+GV+ +  P+    + HP   +    PNG+       G + +  PN  Q   H NGV    Y +G     +P+G Q   + +G   V   NG
Sbjct:  200 HPYDVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYYVTHPNG-VQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPKDVQYVAHPNGVQYVTHPNGVQYLTHPNRSQYVTHNNGVHYVFYTNGVQYVTHPNGVQYVTHTNGSRYVTYPNG 375          

HSP 8 Score: 56.9954 bits (136), Expect = 3.141e-8
Identity = 35/124 (28.23%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 2916 NGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            NG + + + NG + V HP+GV+ +  P+    + HP+  +    PNG+       G + +  PNG Q     NGV+   +P+G     +P+G Q   + +G   V   NG     QYV+  + +
Sbjct:   31 NGVQYVTHPNGVRCVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNG----VQYVTHPNGV 150          

HSP 9 Score: 53.5286 bits (127), Expect = 3.236e-7
Identity = 35/125 (28.00%), Postives = 58/125 (46.40%), Query Frame = 3
Query: 2913 SNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSAL 3284
            S G + + + NG + V  P+GV+ +  P+    + HP+  +    PNG+       G + +  PNG Q   H NGV+   +P+G      P+G Q   + +G   V   NG     QYV+  + +
Sbjct:   12 SPGVQYVFHPNGVQYVTQPNGVQYVTHPNGVRCVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHPNG----VQYVTHPNGV 132          

HSP 10 Score: 52.7582 bits (125), Expect = 6.035e-7
Identity = 40/157 (25.48%), Postives = 70/157 (44.59%), Query Frame = 3
Query: 2715 HPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNG-QKEIHTNGVKKRIYPDGTSKTVYP 3182
            HP+G+    +      V +PNG      P+    L H      + +T +  V Y +  +     T+ NG + + + NG + V +P+GV+ +  P+ +  + HP+  +    PNG+         + +  PNG Q   H NGV+   YP+G     +P
Sbjct:  291 HPNGVQYVTHPKDVQYVAHPNGVQYVTHPNGVQYLTHP--NRSQYVTHNNGVHYVFYTNGVQYVTHPNGVQYVTHTNGSRYVTYPNGVQYVTHPNGAQYVTHPNGVQYVTHPNGV---------QYVTHPNGVQYVTHPNGVQYVTYPNGVQYVTHP 436          
BLAST of centromere protein J vs. Ensembl Medaka
Match: cenpj (centromere protein J [Source:NCBI gene;Acc:101163446])

HSP 1 Score: 198.364 bits (503), Expect = 4.570e-51
Identity = 90/190 (47.37%), Postives = 128/190 (67.37%), Query Frame = 3
Query: 2691 DIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQ 3260
            D ++D I HPDG +E++ + G   +V+PNG+ K++S D  S+ +  +NGD KQ T D RVIY+YA+ ++T  TY  G E + + N   E   P G +EI FPD++VK L PD  EE+   +G ++R++  G KEI    GQKE+HT   K+R YPDGT KTVY DGRQET Y +GR+R+KD+ GN+I+D+
Sbjct: 1087 DSVQDVIKHPDGKIEKVLVGGDRLIVFPNGTRKEVSADGLSVKITFFNGDTKQTTADQRVIYYYAEAQTTHITYPEGLEVLHFPNNQTEKHFPDGRKEITFPDQTVKNLFPDGREESVLTDGTIIRVNTDGIKEIHFNTGQKEVHTADFKRREYPDGTVKTVYNDGRQETRYPTGRVRIKDREGNVIMDK 1276          

HSP 2 Score: 87.0409 bits (214), Expect = 9.803e-17
Identity = 64/172 (37.21%), Postives = 108/172 (62.79%), Query Frame = 3
Query: 1701 CPIYPKVSVDQRQSNPEDNLT-IQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRL 2213
             P  P  S   +QSN  D +   QS +L++ +  LE E+ RFK EN  + K++ + E+  + L  E   F + K  E+ +F++YK+ E +KL+KERK+FE++  A ++ P+KK+R+EI +LK ++  L+EE   +E+RW + ++RL+Q++D L  +N+ L   I  LE+ RL
Sbjct:  787 APPPPVGSESSQQSN--DTVQQAQSRQLRERLVELEIEIERFKKENAALAKLRQDCEKKQEELRRERLDFDQAKAAELARFDDYKKEENRKLQKERKLFEKHATAARAAPDKKEREEIQSLKEQLNSLQEELKRRESRWTSTHTRLRQQIDSLNKDNAALREEIQMLEKLRL 956          
BLAST of centromere protein J vs. Planmine SMEST
Match: SMESG000028453.1 (SMESG000028453.1)

HSP 1 Score: 1904.03 bits (4931), Expect = 0.000e+0
Identity = 1073/1080 (99.35%), Postives = 1077/1080 (99.72%), Query Frame = 3
Query:   57 MTSSLKANFDSTNSWASRAGVVVGYKPEDTMKSFLFNQNNRHCVNINQNEFSILQLPQXXXXXXXXXXXXXXXXXXXXMTKVTVKNASSVAVNSYEETENVNINKKSRSGTEIEMWNKNENSDDDCTSADISNDFEYKEDKVSIGIPNKTFEEILEEKLKHDTTVSKIQKDHCKSDPGTKPKFSFLKKNSGKSAWCSNIKTSENLLEKINNSKSRSQSNEREKTTKQKEMNKSHQPARKMKSLSSMXXXXXXXXXXXXXXXXXXSCQKTVHFASSYQSNSRIDLPIEDPVTITQINQKAPEIEDTNSKFIEESQMIDKDLVEFELLEQIANVXXXXXXXXXLARYDEENLRVKLRHCQNMPPPLSITQNKSWNSSCNSYNEASKTITRTENPFQVLSVCEEKSENIQSTNSSITNVESDFEDIKDISQNTSVNTTTLSEYEELKSCXXXXXXXXXXXXXALTRKVSKQKERYKSSEDETEEWLDDNPFQLKNNNISDKINDFPQRTLLKSSNIDWTFADPFHESDSYSDEDIEPRINQKQTLNDNLEICPIYPKVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCXXXXXXXXXXXXXXXXXXXXXQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRQEIDNXXXXXXXXXXXXSGKEARWQAANSRLKQKVDQLESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVSQAISMKHMNIPINMLTKEDXXXXXXXXXXXKTRASSIXXXXXXXXXXXXXXXXXXXXXXVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSALTNSD 3296
            MTSSLKANFDSTNSWASRAGVVVGYKPEDTMKSFLFNQNNRHCVNINQNEFSILQLPQSELENALNLLSSDSDSESSSMTKVTVKNASSVAVNSYEETENVNINKKSRSGTEIEMWNKNENSDDDCTSADISNDFEYKEDK+SIGIPNKTFEEILEEKLKHDTTVSKIQKDHCKSDPGTKPKFSFLKKNSGKSAWCSNIKTSENL EKINNSKSRSQSNEREKTTKQKEMNKSHQPARKMKSLSSMIKRPEKPEIPNKPEKQIKSCQKTVHFASSYQSNSRIDLPIEDPVTITQINQKAPEIEDTNSKFIEESQMIDKDLVEFELLEQIANVSISSSIASSLARYDEENLRVKLRHCQNMPPPLSITQNKSWNSSCNSYNEASKTITRTENPFQVLSVCEEKSENIQSTNSSITNVESDFEDIKDISQNTSVNTTTLSEYEELKSCKPTQIPIPKPPTQALTRKVSKQKERYK+SEDETEEWLDDNPFQLKNNNISDKINDFPQRTLLKSSNIDWTFADPFHESDSYSDEDIEPRINQKQTLNDNLEICPIYPKVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCEIEKMKIEKEEGLKRLEEEMKQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDR+EIDNLKAEVELLKEEASGKEARWQAANSRLKQKVDQ ESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVSQAISMKHMNIPINMLTKEDNNNNKCVAGNNKTRASSIKPTNVKANNNNSNKQPKQLKNNVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSK NGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKE+IVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSALTNSD
Sbjct:    1 MTSSLKANFDSTNSWASRAGVVVGYKPEDTMKSFLFNQNNRHCVNINQNEFSILQLPQSELENALNLLSSDSDSESSSMTKVTVKNASSVAVNSYEETENVNINKKSRSGTEIEMWNKNENSDDDCTSADISNDFEYKEDKISIGIPNKTFEEILEEKLKHDTTVSKIQKDHCKSDPGTKPKFSFLKKNSGKSAWCSNIKTSENLHEKINNSKSRSQSNEREKTTKQKEMNKSHQPARKMKSLSSMIKRPEKPEIPNKPEKQIKSCQKTVHFASSYQSNSRIDLPIEDPVTITQINQKAPEIEDTNSKFIEESQMIDKDLVEFELLEQIANVSISSSIASSLARYDEENLRVKLRHCQNMPPPLSITQNKSWNSSCNSYNEASKTITRTENPFQVLSVCEEKSENIQSTNSSITNVESDFEDIKDISQNTSVNTTTLSEYEELKSCKPTQIPIPKPPTQALTRKVSKQKERYKNSEDETEEWLDDNPFQLKNNNISDKINDFPQRTLLKSSNIDWTFADPFHESDSYSDEDIEPRINQKQTLNDNLEICPIYPKVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCEIEKMKIEKEEGLKRLEEEMKQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQEAMKSMPNKKDRREIDNLKAEVELLKEEASGKEARWQAANSRLKQKVDQFESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVSQAISMKHMNIPINMLTKEDNNNNKCVAGNNKTRASSIKPTNVKANNNNSNKQPKQLKNNVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSKSNGHNSNSNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGGIDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQTTYSNGKEEIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNGLVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFYASGRMRVKDKNGNLILDQYVSKNSALTNSD 1080          
The following BLAST results are available for this feature:
BLAST of centromere protein J vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CENPJ2.777e-5651.87centromere protein J [Source:HGNC Symbol;Acc:HGNC:... [more]
CENPJ4.361e-1638.55centromere protein J [Source:HGNC Symbol;Acc:HGNC:... [more]
CENPJ4.852e-1638.55centromere protein J [Source:HGNC Symbol;Acc:HGNC:... [more]
CENPJ2.056e-1340.78centromere protein J [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of centromere protein J vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centromere protein J vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sas-47.952e-3745.40gene:FBgn0011020 transcript:FBtr0081569[more]
back to top
BLAST of centromere protein J vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cenpj3.267e-4938.35centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030... [more]
cenpj3.267e-4938.35centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030... [more]
cenpj3.267e-4938.35centromere protein J [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of centromere protein J vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam110b4.352e-4847.06family with sequence similarity 110 member B [Sour... [more]
back to top
BLAST of centromere protein J vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cenpj1.293e-5551.34centromere protein J [Source:MGI Symbol;Acc:MGI:26... [more]
Cenpj1.293e-5551.34centromere protein J [Source:MGI Symbol;Acc:MGI:26... [more]
Tcp10b5.914e-5245.02t-complex protein 10b [Source:MGI Symbol;Acc:MGI:9... [more]
Tcp10b5.914e-5245.02t-complex protein 10b [Source:MGI Symbol;Acc:MGI:9... [more]
Tcp10a1.689e-5144.55t-complex protein 10a [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of centromere protein J vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9HC77|CENPJ_HUMAN1.334e-5551.87Centromere protein J OS=Homo sapiens OX=9606 GN=CE... [more]
sp|Q5BQN8|CENPJ_PANTR3.534e-5551.87Centromere protein J OS=Pan troglodytes OX=9598 GN... [more]
sp|Q569L8|CENPJ_MOUSE9.043e-5551.34Centromere protein J OS=Mus musculus OX=10090 GN=C... [more]
back to top
BLAST of centromere protein J vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419Q1J74.153e-7837.02Centromere protein J OS=Clonorchis sinensis OX=799... [more]
A0A158QFE55.147e-7133.64Tcp10_C domain-containing protein OS=Hymenolepis d... [more]
A0A3P7BIT25.505e-7133.64Tcp10_C domain-containing protein OS=Hymenolepis d... [more]
A0A1V4K9N31.214e-6134.58Centromere protein J-like OS=Patagioenas fasciata ... [more]
A0A3L8STI58.231e-6135.27Tcp10_C domain-containing protein OS=Chloebia goul... [more]
back to top
BLAST of centromere protein J vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cenpj1.587e-4947.09centromere protein J [Source:NCBI gene;Acc:1030315... [more]
ENSAMXT00000049611.11.529e-4447.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of centromere protein J vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004600.12.292e-3850.00pep scaffold:Pmarinus_7.0:GL476377:13485:16635:-1 ... [more]
ENSPMAT00000010536.12.391e-737.50pep scaffold:Pmarinus_7.0:GL485795:6714:10727:1 ge... [more]
back to top
BLAST of centromere protein J vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centromere protein J vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO412981.241e-5547.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462162.476e-1128.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of centromere protein J vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cenpj4.570e-5147.37centromere protein J [Source:NCBI gene;Acc:1011634... [more]
back to top
BLAST of centromere protein J vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028453.10.000e+099.35SMESG000028453.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021824 ID=SMED30021824|Name=centromere protein J|organism=Schmidtea mediterranea sexual|type=transcript|length=3576bp
CAGTCTTGTTTTAATATTATAACAACATTTGATTGCTTGGATCTTTAATT
TTCAAGATGACTTCAAGCCTCAAAGCGAATTTTGATTCTACCAATTCTTG
GGCTTCTCGAGCTGGAGTTGTTGTTGGCTATAAACCAGAAGACACTATGA
AAAGCTTTTTATTTAATCAAAATAATCGTCATTGTGTTAATATTAATCAA
AATGAATTTTCCATTTTACAATTACCACAAAGTGAACTCGAGAATGCATT
AAATTTACTTTCTAGTGATTCAGACTCCGAATCAAGCTCAATGACTAAAG
TCACAGTAAAAAATGCATCTTCAGTTGCAGTCAATTCTTACGAGGAGACA
GAAAATGTTAATATAAATAAAAAATCCAGAAGTGGAACTGAAATTGAAAT
GTGGAATAAAAATGAAAATTCCGATGACGATTGCACATCTGCAGACATCT
CAAACGATTTTGAATACAAGGAGGACAAAGTTTCAATTGGTATTCCCAAT
AAGACCTTCGAAGAGATTCTCGAGGAGAAATTAAAACACGATACTACTGT
ATCTAAAATCCAAAAAGATCACTGTAAATCTGATCCTGGAACTAAGCCTA
AATTTTCTTTTCTGAAAAAAAATTCCGGAAAATCAGCATGGTGTAGCAAT
ATTAAAACGTCGGAAAATCTTCTTGAGAAAATAAATAACTCCAAAAGCAG
AAGTCAGTCAAATGAAAGAGAAAAAACGACAAAACAGAAAGAAATGAACA
AATCTCATCAGCCTGCTCGAAAAATGAAATCTTTGTCGAGCATGATTAAA
AGGCCAGAAAAGCCTGAAATTCCAAATAAACCCGAAAAACAAATTAAAAG
TTGTCAGAAAACCGTTCATTTCGCCTCTTCATATCAAAGCAATTCACGGA
TTGATCTACCAATTGAAGATCCAGTTACGATTACTCAAATAAATCAGAAA
GCTCCTGAGATTGAAGATACCAACTCAAAATTCATCGAAGAAAGCCAAAT
GATTGATAAAGATCTCGTTGAATTTGAATTATTGGAACAAATCGCTAATG
TATCTATCTCTAGTTCAATAGCCAGTTCTTTGGCCAGATACGACGAAGAA
AATCTTCGAGTGAAATTGCGACACTGTCAAAATATGCCTCCGCCTTTAAG
TATTACTCAAAATAAATCATGGAATTCCTCTTGTAATTCTTATAATGAAG
CCAGTAAAACTATTACAAGGACTGAAAATCCGTTTCAAGTATTATCAGTT
TGTGAAGAGAAAAGTGAAAATATTCAATCCACAAATTCATCTATCACAAA
TGTAGAAAGCGATTTTGAGGATATTAAAGACATTTCTCAAAATACCAGCG
TAAATACTACTACGCTTAGTGAATATGAAGAATTGAAATCTTGTAAGCCA
ACACAAATACCAATACCAAAACCACCAACTCAAGCACTTACTCGGAAAGT
TTCGAAACAAAAAGAACGATACAAGAGTTCTGAAGATGAGACTGAAGAAT
GGTTGGATGACAATCCGTTTCAATTGAAAAACAATAATATTTCTGATAAA
ATCAATGATTTTCCCCAAAGAACTTTATTGAAATCATCGAATATAGATTG
GACATTTGCTGATCCTTTCCATGAGTCTGATTCATATAGTGATGAGGACA
TTGAACCACGTATCAACCAAAAACAAACTTTAAATGACAATTTGGAGATT
TGCCCAATCTATCCCAAAGTTTCAGTTGATCAGAGACAATCCAATCCCGA
GGACAATTTGACAATTCAGTCCGTTAAATTAAAGCAGTGGGTTCAACTAC
TGGAAAGTGAAGTTAATCGATTTAAATTAGAAAATTGTGAAATTGAAAAA
ATGAAAATTGAAAAAGAAGAAGGTCTTAAACGATTAGAAGAAGAAATGAA
ACAGTTTCAAAAATATAAGGATGATGAAGTCAGAAAATTTGAAGAATACA
AACAAACTGAAATTAAAAAACTAAAAAAAGAACGAAAGGTTTTCGAAGAA
TATCAAGAAGCAATGAAAAGTATGCCAAACAAGAAAGACAGACAGGAAAT
TGATAATCTTAAAGCCGAAGTTGAGCTATTAAAAGAAGAAGCATCGGGTA
AAGAAGCCAGGTGGCAAGCTGCTAATTCTAGACTTAAACAAAAAGTCGAT
CAATTGGAATCTGAAAATTCTGAGCTTCATACCAGAATTCATGGTCTGGA
ACAAAAACGATTGCAACTTCAAGCTCAATTGGTCTCGAATAACAATCAAA
AACCTAAACAAGAACTCAATTCAATTAAACCAAAACCAACTGTGACCTCA
GTCTCTCAAGCTATATCAATGAAGCATATGAATATCCCAATCAACATGCT
AACAAAAGAAGACAATAATAACAATAAATGCGTGGCTGGTAATAATAAAA
CAAGGGCTTCATCCATAAAACCTACTAACGTGAAAGCTAATAACAACAAT
TCAAATAAACAACCAAAGCAATTAAAGAACAATGTCAATCCTTTTTCAGC
AGACAATGGAAATAATGATATCAGAGGGAGCGCTGCGAGTGATTATTATA
CGGGAGAAGAAGAGAGTGGATCTGTTGATTCCAAACCAAACGGACATAAC
AGTAATTCAAACACTTATCGTAATGAAATAGATGTAAATGTTCCTGTAAA
ACAAAATGCTCCTTCTTTTGCAAAAATGAATCATTGCAACGACATTATAA
AGGATGAAATACATCATCCCGATGGAATCGTTGAAAGGATATATATGAAT
GGTGGAATTGATGTAGTTTATCCTAATGGATCATTGAAGCAAATATCACC
GGATAGTAAATCAATTTTAGTACACCTTTACAATGGGGATGTTAAACAAA
TAACTCCAGATGGCCGAGTGATTTATTTCTATGCCCAAGATGAAAGCACA
CAAACGACATATTCAAATGGAAAGGAAAAAATTGTCTATAAAAACGGCCA
TAAAGAAGTCCTTCATCCTTCTGGTGTCAGGGAAATCAATTTTCCTGATA
AATCCGTCAAGATTTTACATCCAGATTTAACTGAAGAAACATTCTTCCCT
AATGGTTTAGTAATGCGGATCAGTAATACCGGTGATAAAGAAATTCTCCT
TCCGAACGGCCAAAAAGAAATTCATACAAATGGAGTAAAGAAAAGAATCT
ATCCCGACGGTACATCGAAAACAGTGTACCCAGATGGTCGCCAGGAAACA
TTTTATGCTTCTGGAAGAATGCGAGTCAAAGACAAAAATGGAAATCTAAT
ACTTGATCAGTATGTCAGTAAAAATAGTGCATTGACAAATTCTGATTGAT
TTCCAGTGAATTTGTGTTTGTTACTCAAAACCTTTACACCTCAGAGAAAC
TCAAAATCCGTTGGCATATAAATATTTGCATATTATTCGTCGGCCAGCAT
ACATATATAAAATATATAAATCTAGAGATTATCTATTCTTTAATTGTCGA
AAGTATTTGCGGAGGGTTGTGATGTATTGTGTAGTTTTTTGAAATGTGCA
AAAAATTATGTAATCGATTTATCTTTGTTCTTTCTTATTAATTTTAGTTA
TAAATTATCGTCGATTTTTGGCCGAT
back to top

protein sequence of SMED30021824-orf-1

>SMED30021824-orf-1 ID=SMED30021824-orf-1|Name=SMED30021824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1081bp
MTSSLKANFDSTNSWASRAGVVVGYKPEDTMKSFLFNQNNRHCVNINQNE
FSILQLPQSELENALNLLSSDSDSESSSMTKVTVKNASSVAVNSYEETEN
VNINKKSRSGTEIEMWNKNENSDDDCTSADISNDFEYKEDKVSIGIPNKT
FEEILEEKLKHDTTVSKIQKDHCKSDPGTKPKFSFLKKNSGKSAWCSNIK
TSENLLEKINNSKSRSQSNEREKTTKQKEMNKSHQPARKMKSLSSMIKRP
EKPEIPNKPEKQIKSCQKTVHFASSYQSNSRIDLPIEDPVTITQINQKAP
EIEDTNSKFIEESQMIDKDLVEFELLEQIANVSISSSIASSLARYDEENL
RVKLRHCQNMPPPLSITQNKSWNSSCNSYNEASKTITRTENPFQVLSVCE
EKSENIQSTNSSITNVESDFEDIKDISQNTSVNTTTLSEYEELKSCKPTQ
IPIPKPPTQALTRKVSKQKERYKSSEDETEEWLDDNPFQLKNNNISDKIN
DFPQRTLLKSSNIDWTFADPFHESDSYSDEDIEPRINQKQTLNDNLEICP
IYPKVSVDQRQSNPEDNLTIQSVKLKQWVQLLESEVNRFKLENCEIEKMK
IEKEEGLKRLEEEMKQFQKYKDDEVRKFEEYKQTEIKKLKKERKVFEEYQ
EAMKSMPNKKDRQEIDNLKAEVELLKEEASGKEARWQAANSRLKQKVDQL
ESENSELHTRIHGLEQKRLQLQAQLVSNNNQKPKQELNSIKPKPTVTSVS
QAISMKHMNIPINMLTKEDNNNNKCVAGNNKTRASSIKPTNVKANNNNSN
KQPKQLKNNVNPFSADNGNNDIRGSAASDYYTGEEESGSVDSKPNGHNSN
SNTYRNEIDVNVPVKQNAPSFAKMNHCNDIIKDEIHHPDGIVERIYMNGG
IDVVYPNGSLKQISPDSKSILVHLYNGDVKQITPDGRVIYFYAQDESTQT
TYSNGKEKIVYKNGHKEVLHPSGVREINFPDKSVKILHPDLTEETFFPNG
LVMRISNTGDKEILLPNGQKEIHTNGVKKRIYPDGTSKTVYPDGRQETFY
ASGRMRVKDKNGNLILDQYVSKNSALTNSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026581TCP10_fam
IPR009852Tcp10_C_dom
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0044458motile cilium assembly
GO:0046599regulation of centriole replication
GO:0046785microtubule polymerization
GO:0051298centrosome duplication
GO:0051301cell division
GO:0061511centriole elongation
GO:0097711ciliary basal body docking
GO:0098534centriole assembly
GO:1902857positive regulation of non-motile cilium assembly
GO:1905515non-motile cilium assembly
GO:0000086G2/M transition of mitotic cell cycle
GO:0006977DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0007020microtubule nucleation
GO:0007099centriole replication
Vocabulary: cellular component
TermDefinition
GO:0008275gamma-tubulin small complex
GO:0036064ciliary basal body
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005886plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0015631tubulin binding
GO:0019901protein kinase binding
GO:0019904protein domain specific binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 658..731
NoneNo IPR availableCOILSCoilCoilcoord: 596..627
NoneNo IPR availableCOILSCoilCoilcoord: 458..478
NoneNo IPR availableGENE3DG3DSA:2.60.450.20coord: 886..1067
e-value: 1.5E-70
score: 238.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 835..857
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..478
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 779..807
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..236
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 831..857
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 458..480
IPR009852T-complex protein 10, C-terminal domainPFAMPF07202Tcp10_Ccoord: 893..1068
e-value: 2.2E-68
score: 229.6
IPR026581T-complex protein 10 familyPANTHERPTHR10331T COMPLEX PROTEIN 10coord: 119..1052