Transient receptor potential cation channel subfamily M member

Overview
NameTransient receptor potential cation channel subfamily M member
Smed IDSMED30021821
Length (bp)5791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member (SMED30021821) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30021821) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member (SMED30021821) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30021821) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021821

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021821SMESG000078720.1 Contig5235uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021821SMESG000078720.1 Contig5235newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021821SMESG000051516.1 Contig5235uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021821SMESG000051516.1 Contig5235newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30021821SMESG000078720.1 SmedASXL_008049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021821SMESG000078720.1 dd_Smed_v4_17981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021821SMESG000078720.1 dd_Smed_v4_17981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021821SMESG000078720.1 dd_17981dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30021821SMESG000078720.1 dd_17981dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021821SMESG000078720.1 dd_Smed_v6_17981_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 189.504 bits (480), Expect = 1.555e-47
Identity = 167/510 (32.75%), Postives = 262/510 (51.37%), Query Frame = 3
Query:  267 EESKGHL--STNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAK-FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYT--DAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLA----LAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            E +K H    T +DP+K  +   +PT+AFG+I FTGL+Q  K +VR+   TP   I  ++   W L  P L+IS+ GG  +F  K +LK I ++GL K A++ G WIIT G + G+MK  GEAVRD++   +Y   +++ IG+A W  V + + L +    G++PA Y  +E+ + N             LD+NHS+F L D     +   E  +  R+R E  IS    + +        ++PI  +V+ G   TL  + N+   N  P VV +GS   ADV+A    L +       +++    F     E   ES I E   KI        ++ V+ +Q++T       VF   +D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF++  +WK  DL+  M  AL+S++ +FVKLFLE G  L+EF+T   L  LY    +NL+    +FH              +++  V +V++ L+GDF  PLY
Sbjct:  101 EATKPHTFQGTQWDPKKHVQE--MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHP--TGSFPAEYILDEDGQGN----------LTCLDSNHSHFILVDDGTHGQYGVE--IPLRTRLEKFIS----EQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATT-NGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI--------QDIVRRRQLLT-------VFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLY----ENLDPSC-LFH------------SKLQMHHVAQVLRELLGDFTQPLY 557          

HSP 2 Score: 148.673 bits (374), Expect = 5.544e-35
Identity = 162/630 (25.71%), Postives = 271/630 (43.02%), Query Frame = 3
Query: 2301 SSLDFHEIDRMLH---AKSKSTLYSETSEND----LLKYQNENLGNIIQTNFDELDDRKLKEISLER-PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGII-MPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF----SGI--SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF-----------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            S L  H + ++L          LY     ND    LL   +  L N+   +   L  R    ++    P R+L+IW+++  + ++A + WA  ++ IA AL  S +L  L+ + +D    E+    ++ +E +A GV  ECY +DE+RAQ L+ +  + +G+++ + LA + + +KF++H   Q FLT  W+G LS  N     L  V L ++  P ++  +IS++E     +G   ++        +             ++   N LSY     F  L  F  +    F PV  +                             E  +  W+ +L+ EE++Q  +     G+    + YFSD WNKLD  AI LFV G   RLI    Y           R+IL+                 F +R+M+IF+    LGPK+I++++M+  D+  F+ +L+V+++ +GV   A                     N    D +    +  SY  +FG+                  G D  +   P C   D           L  L L L++L TN+LL NLLIAMF  T+++++  +   W +QR+ +I E+  +    PPFI++ H 
Sbjct:  534 SKLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKL-NVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNG----LWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPV-------------VVFHLNILSY-----FAFLCLFAYVLMVDFQPVPSWC----------------------------ECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPG---------RVILS------------LDFILFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILI-----------------HNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYK---PKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHL 1070          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 186.808 bits (473), Expect = 1.321e-46
Identity = 166/517 (32.11%), Postives = 262/517 (50.68%), Query Frame = 3
Query:  267 EESKGHL--STNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAK-FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYT--DAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLA----LAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLW-------DNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            E +K H    T +DP+K  +   +PT+AFG+I FTGL+Q  K +VR+   TP   I  ++   W L  P L+IS+ GG  +F  K +LK I ++GL K A++ G WIIT G + G+MK  GEAVRD++   +Y   +++ IG+A W  V + + L +    G++PA Y  +E+ + N             LD+NHS+F L D     +   E  +  R+R E  IS    + +        ++PI  +V+ G   TL  + N+   N  P VV +GS   ADV+A    L +       +++    F     E   ES I E   KI        ++ V+ +Q++T       VF   +D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF++  +WK  DL+  M  AL+S++ +FVKLFLE G  L+EF+T   L  LY    +NL+       +L        +          +++  V +V++ L+GDF  PLY
Sbjct:  101 EATKPHTFQGTQWDPKKHVQE--MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHP--TGSFPAEYILDEDGQGN----------LTCLDSNHSHFILVDDGTHGQYGVE--IPLRTRLEKFIS----EQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATT-NGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI--------QDIVRRRQLLT-------VFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLY----ENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLY 577          

HSP 2 Score: 148.673 bits (374), Expect = 6.602e-35
Identity = 162/632 (25.63%), Postives = 271/632 (42.88%), Query Frame = 3
Query: 2286 AIRRISSLDFHEIDRMLHAKSKSTLYSETSEND----LLKYQNENLGNIIQTNFDELDDRKLKEISLER-PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGII-MPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF----SGI--SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF-----------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            A  R+      ++ R L       LY     ND    LL   +  L N+   +   L  R    ++    P R+L+IW+++  + ++A + WA  ++ IA AL  S +L  L+ + +D    E+    ++ +E +A GV  ECY +DE+RAQ L+ +  + +G+++ + LA + + +KF++H   Q FLT  W+G LS  N     L  V L ++  P ++  +IS++E     +G   ++        +             ++   N LSY     F  L  F  +    F PV  +                             E  +  W+ +L+ EE++Q  +     G+    + YFSD WNKLD  AI LFV G   RLI    Y           R+IL+                 F +R+M+IF+    LGPK+I++++M+  D+  F+ +L+V+++ +GV   A                     N    D +    +  SY  +FG+                  G D  +   P C   D           L  L L L++L TN+LL NLLIAMF  T+++++  +   W +QR+ +I E+  +    PPFI++ H 
Sbjct:  552 AAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKL-NVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNG----LWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPV-------------VVFHLNILSY-----FAFLCLFAYVLMVDFQPVPSWC----------------------------ECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPG---------RVILS------------LDFILFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILI-----------------HNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYK---PKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHL 1090          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 186.422 bits (472), Expect = 1.621e-46
Identity = 166/517 (32.11%), Postives = 262/517 (50.68%), Query Frame = 3
Query:  267 EESKGHL--STNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAK-FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYT--DAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLA----LAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLW-------DNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            E +K H    T +DP+K  +   +PT+AFG+I FTGL+Q  K +VR+   TP   I  ++   W L  P L+IS+ GG  +F  K +LK I ++GL K A++ G WIIT G + G+MK  GEAVRD++   +Y   +++ IG+A W  V + + L +    G++PA Y  +E+ + N             LD+NHS+F L D     +   E  +  R+R E  IS    + +        ++PI  +V+ G   TL  + N+   N  P VV +GS   ADV+A    L +       +++    F     E   ES I E   KI        ++ V+ +Q++T       VF   +D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF++  +WK  DL+  M  AL+S++ +FVKLFLE G  L+EF+T   L  LY    +NL+       +L        +          +++  V +V++ L+GDF  PLY
Sbjct:  101 EATKPHTFQGTQWDPKKHVQE--MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHP--TGSFPAEYILDEDGQGN----------LTCLDSNHSHFILVDDGTHGQYGVE--IPLRTRLEKFIS----EQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATT-NGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI--------QDIVRRRQLLT-------VFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLY----ENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLY 577          

HSP 2 Score: 147.902 bits (372), Expect = 9.577e-35
Identity = 164/632 (25.95%), Postives = 272/632 (43.04%), Query Frame = 3
Query: 2286 AIRRISSLDFHEIDRMLHAKSKSTLYSETSEND----LLKYQNENLGNIIQTNFDELDDRKLKEISLER-PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGII-MPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF----SGI--SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF-----------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            A  R+      ++ R L       LY     ND    LL   +  L N+   +   L  R    ++    P R+L+IW+++  + ++A + WA  ++ IA AL  S +L  L+ + +D    E+    ++ +E +A GV  ECY +DE+RAQ L+ +  + +G+++ + LA + + +KF++H   Q FLT  W+G LS  N     L  V L ++  P ++  +IS++E     +G   ++        +             ++   N LSY     F  L  F  +    F PV  +                           CE  I   W+ +L+ EE++Q  +     G+    + YFSD WNKLD  AI LFV G   RLI    Y           R+IL+                 F +R+M+IF+    LGPK+I++++M+  D+  F+ +L+V+++ +GV   A                     N    D +    +  SY  +FG+                  G D  +   P C   D           L  L L L++L TN+LL NLLIAMF  T+++++  +   W +QR+ +I E+  +    PPFI++ H 
Sbjct:  552 AAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKL-NVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNG----LWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPV-------------VVFHLNILSY-----FAFLCLFAYVLMVDFQPVPSW---------------------------CECAIY-LWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPG---------RVILS------------LDFILFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILI-----------------HNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYK---PKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHL 1090          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 186.422 bits (472), Expect = 1.621e-46
Identity = 166/517 (32.11%), Postives = 262/517 (50.68%), Query Frame = 3
Query:  267 EESKGHL--STNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAK-FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYT--DAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLA----LAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLW-------DNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            E +K H    T +DP+K  +   +PT+AFG+I FTGL+Q  K +VR+   TP   I  ++   W L  P L+IS+ GG  +F  K +LK I ++GL K A++ G WIIT G + G+MK  GEAVRD++   +Y   +++ IG+A W  V + + L +    G++PA Y  +E+ + N             LD+NHS+F L D     +   E  +  R+R E  IS    + +        ++PI  +V+ G   TL  + N+   N  P VV +GS   ADV+A    L +       +++    F     E   ES I E   KI        ++ V+ +Q++T       VF   +D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF++  +WK  DL+  M  AL+S++ +FVKLFLE G  L+EF+T   L  LY    +NL+       +L        +          +++  V +V++ L+GDF  PLY
Sbjct:  101 EATKPHTFQGTQWDPKKHVQE--MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHP--TGSFPAEYILDEDGQGN----------LTCLDSNHSHFILVDDGTHGQYGVE--IPLRTRLEKFIS----EQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATT-NGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI--------QDIVRRRQLLT-------VFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLY----ENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLY 577          

HSP 2 Score: 147.902 bits (372), Expect = 9.577e-35
Identity = 164/632 (25.95%), Postives = 272/632 (43.04%), Query Frame = 3
Query: 2286 AIRRISSLDFHEIDRMLHAKSKSTLYSETSEND----LLKYQNENLGNIIQTNFDELDDRKLKEISLER-PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGII-MPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF----SGI--SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF-----------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            A  R+      ++ R L       LY     ND    LL   +  L N+   +   L  R    ++    P R+L+IW+++  + ++A + WA  ++ IA AL  S +L  L+ + +D    E+    ++ +E +A GV  ECY +DE+RAQ L+ +  + +G+++ + LA + + +KF++H   Q FLT  W+G LS  N     L  V L ++  P ++  +IS++E     +G   ++        +             ++   N LSY     F  L  F  +    F PV  +                           CE  I   W+ +L+ EE++Q  +     G+    + YFSD WNKLD  AI LFV G   RLI    Y           R+IL+                 F +R+M+IF+    LGPK+I++++M+  D+  F+ +L+V+++ +GV   A                     N    D +    +  SY  +FG+                  G D  +   P C   D           L  L L L++L TN+LL NLLIAMF  T+++++  +   W +QR+ +I E+  +    PPFI++ H 
Sbjct:  552 AAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKL-NVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNG----LWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPV-------------VVFHLNILSY-----FAFLCLFAYVLMVDFQPVPSW---------------------------CECAIY-LWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPG---------RVILS------------LDFILFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILI-----------------HNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYK---PKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHL 1090          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM5 (transient receptor potential cation channel subfamily M member 5 [Source:HGNC Symbol;Acc:HGNC:14323])

HSP 1 Score: 182.956 bits (463), Expect = 1.359e-45
Identity = 173/640 (27.03%), Postives = 299/640 (46.72%), Query Frame = 3
Query: 2475 ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLG-----QTKSQDTQQNQI---------VIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF-------VCEEIILTFWIGTLLLEEIKQATFSG------ISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSS-----QDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKK--ERELVKWEHMKAMDYLRKLNEPTQKSRQTRG 4292
            E P R+L +W++L  + +MA  FWAM +E +A AL A  +L  +++       +    T    +E  A  + +ECY   E RA  L+ +  + + +++ + LA +  +  F AH   Q FLT  W+G++++    + LL   G  +    V   +I++ E+  +  G        S DT+++ +         ++E  +   + G R++                      R + F+ +PV  F+ N V Y  FL LF+  LL    V+F          E+ L FW+ TL+LEEI+Q  F+         F+ Y  D WNK D  AI LF++G   R++                      S F   +T +      F +R+++IF+ H  LGPK+I++ +M+  D+  F+  LSV+++ YGVT  A  +P                 +    + +   +L + Y  +FG+  LD +     +CS+     +D    P+  +  L  L L   +L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+  +  L PPFI++ H     SL  R++F  E E K        +   DL    ++++V WE ++  ++L K+    ++ R + G
Sbjct:  509 ENPWRDLFLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMSHLET--EAEAARATREAKYERLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLL---GAFLCPALVYTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVF------------------LLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL----VDFRPPPQGPSGPEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLP---------------------SAFEAGRTVLAMDFMVFTLRLIHIFAIHKQLGPKIIVVERMM-KDVFFFLFFLSVWLVAYGVTTQALLHP-----------------HDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL----SLTLRRVFKKEAEHKRE------HLERDLPDPLDQKVVTWETVQKENFLSKME---KRRRDSEG 1069          

HSP 2 Score: 155.992 bits (393), Expect = 2.474e-37
Identity = 134/431 (31.09%), Postives = 220/431 (51.04%), Query Frame = 3
Query:  348 GEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDC--PASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESV----QLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
            GE+ F G  +   KFVR+ +      +  +L  +W L  P LV+S+ G +  F  K  L+ +++KGL KAA+S G WI+T  L +G+ +  G+AVRD++ A    K+  VA+G+A    V    +LE +     +P  Y         DDG    +    SLD+N S+F L +   P     ++E     R R E  IS    Q + Y  +    +P+  L+V GD  TL ++ +  +E   P ++  GS G ADVLA  ++           +   +VP  A       E  FK     K F  E +    +L Q +T   +L++V+D E++   +LD  I+ +L+ +  S   + Q  L++L++ +  +R DIAK +IF  + +WK  DL + M +AL+S++ +FV+LF++ G  + +FLT   L++LY
Sbjct:   18 GEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQVHEDFPVHY-------PEDDG--GSQGPLCSLDSNLSHFILVEPGPPGKGDGLTE----LRLRLEKHIS---EQRAGYGGTGSIEIPVLCLLVNGDPNTLERI-SRAVEQAAPWLILVGSGGIADVLAALVN-----------QPHLLVPKVA-------EKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELY 413          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 172.17 bits (435), Expect = 1.618e-42
Identity = 156/520 (30.00%), Postives = 253/520 (48.65%), Query Frame = 3
Query:  312 IRKN-YTLPTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTR-VPICGLVVGGDILTLRQVFNSIIE-NKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY------LVSVFDMEE--DWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEK 1826
            +RK+  +L TNAFG++EF G      A++VR+   T    I ++ +  W++  P L+I++ GG  +F+ + KL  + +KGL KAA + G WIIT G + G++K    A+     A   NK+V IGIAPW ++ K    E+ + Q      Y S              + +   L+  HSYF L D     +  +E  V  R R E  IS         +    TR VP+  +V+ G   T+R V + +    + PVVVC GS  AAD+LA A          +   E  ++P     + I R+ L  +      F        +++ EL        L+++F + E  + D+D  I+++LL        QN    +QL + L  NR DIA+  +F    +W +  L++ M  AL+ DR DFV+L LEQG ++++FLT+  L++LY       N+   I   +    + +R     KL ++G VI+ L+G+ Y   Y + EF++   K  ++   + H++K
Sbjct:  265 LRKHTVSLATNAFGQVEFQGGPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR-NKIVCIGIAPWGLLKKR---EDFIGQDKTVPYYPS------------SSKGRFTGLNNRHSYFLLVDNGTVGRYGAE--VILRKRLEMYIS------QKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA---------HQNVTEDGLLP-----DDIRRQVLLLVE---TTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG------QNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRVRQGYRF----KLPDIGLVIEKLMGNSYQCSYTTSEFRD---KYKQRMKRVKHAQK 730          

HSP 2 Score: 72.7886 bits (177), Expect = 3.351e-12
Identity = 56/181 (30.94%), Postives = 94/181 (51.93%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS-DDFTDKE---DYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQI 3011
            P  ELMIW++L  +  MA   W   +E +A AL+A  L  SLA ++ +D+ + E   + K Y++ F   +  +L+ CY  D+ +   L+  EL  +   + + LA    +  F+AHPCCQ  L   W+G L  +  + +    V LG+I P  I +++ +K  E + L Q ++    QN +
Sbjct:  851 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNI---KVVLGLICPPFI-QMLEFKTREEL-LNQPQTAAEHQNDM 1026          

HSP 3 Score: 65.855 bits (159), Expect = 4.198e-10
Identity = 100/436 (22.94%), Postives = 182/436 (41.74%), Query Frame = 3
Query: 3048 NRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDL-NYVPTKVSRT-----------LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLR-KLNEPTQKSRQ 4283
            N S L KSN  S  +P      Q  +++K  +R   FY +P+  F   ++S++ F+  F+  LL K        E IL  ++    LE++++   S          TY    WN +   AI  +++GF +R      Y           R+IL             C    + ++++   S H  LGP + M  KMI N +   +++L V ++ +G+   +  YP            E   +       ++  I +K Y+ ++GE   D +         Q L N  P  +              + PL +   +L+ N+LL ++LIA+F   ++  +  S   W +QRY+ + E+ +   L PP   ++H   I   ++ +L  +++++++    F +    D  +  +L  +E     D  R KLNE    + Q
Sbjct: 1165 NLSKLQKSNITSTDRPNPMEQFQGTRKIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAY----------GRVIL------------ACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITYP-----------DETWHW------ILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSNEQ 1560          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 172.17 bits (435), Expect = 1.640e-42
Identity = 156/520 (30.00%), Postives = 253/520 (48.65%), Query Frame = 3
Query:  312 IRKN-YTLPTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTR-VPICGLVVGGDILTLRQVFNSIIE-NKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY------LVSVFDMEE--DWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEK 1826
            +RK+  +L TNAFG++EF G      A++VR+   T    I ++ +  W++  P L+I++ GG  +F+ + KL  + +KGL KAA + G WIIT G + G++K    A+     A   NK+V IGIAPW ++ K    E+ + Q      Y S              + +   L+  HSYF L D     +  +E  V  R R E  IS         +    TR VP+  +V+ G   T+R V + +    + PVVVC GS  AAD+LA A          +   E  ++P     + I R+ L  +      F        +++ EL        L+++F + E  + D+D  I+++LL        QN    +QL + L  NR DIA+  +F    +W +  L++ M  AL+ DR DFV+L LEQG ++++FLT+  L++LY       N+   I   +    + +R     KL ++G VI+ L+G+ Y   Y + EF++   K  ++   + H++K
Sbjct:  305 LRKHTVSLATNAFGQVEFQGGPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR-NKIVCIGIAPWGLLKKR---EDFIGQDKTVPYYPSSS------------KGRFTGLNNRHSYFLLVDNGTVGRYGAE--VILRKRLEMYIS------QKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA---------HQNVTEDGLLP-----DDIRRQVLLLVE---TTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG------QNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRVRQGYRF----KLPDIGLVIEKLMGNSYQCSYTTSEFRD---KYKQRMKRVKHAQK 770          

HSP 2 Score: 72.7886 bits (177), Expect = 3.392e-12
Identity = 56/181 (30.94%), Postives = 94/181 (51.93%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS-DDFTDKE---DYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQI 3011
            P  ELMIW++L  +  MA   W   +E +A AL+A  L  SLA ++ +D+ + E   + K Y++ F   +  +L+ CY  D+ +   L+  EL  +   + + LA    +  F+AHPCCQ  L   W+G L  +  + +    V LG+I P  I +++ +K  E + L Q ++    QN +
Sbjct:  891 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNI---KVVLGLICPPFI-QMLEFKTREEL-LNQPQTAAEHQNDM 1066          

HSP 3 Score: 65.4698 bits (158), Expect = 4.779e-10
Identity = 100/436 (22.94%), Postives = 182/436 (41.74%), Query Frame = 3
Query: 3048 NRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDL-NYVPTKVSRT-----------LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLR-KLNEPTQKSRQ 4283
            N S L KSN  S  +P      Q  +++K  +R   FY +P+  F   ++S++ F+  F+  LL K        E IL  ++    LE++++   S          TY    WN +   AI  +++GF +R      Y           R+IL             C    + ++++   S H  LGP + M  KMI N +   +++L V ++ +G+   +  YP            E   +       ++  I +K Y+ ++GE   D +         Q L N  P  +              + PL +   +L+ N+LL ++LIA+F   ++  +  S   W +QRY+ + E+ +   L PP   ++H   I   ++ +L  +++++++    F +    D  +  +L  +E     D  R KLNE    + Q
Sbjct: 1205 NLSKLQKSNITSTDRPNPMEQFQGTRKIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAY----------GRVIL------------ACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITYP-----------DETWHW------ILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSNEQ 1600          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 171.785 bits (434), Expect = 2.210e-42
Identity = 156/520 (30.00%), Postives = 253/520 (48.65%), Query Frame = 3
Query:  312 IRKN-YTLPTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTR-VPICGLVVGGDILTLRQVFNSIIE-NKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY------LVSVFDMEE--DWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEK 1826
            +RK+  +L TNAFG++EF G      A++VR+   T    I ++ +  W++  P L+I++ GG  +F+ + KL  + +KGL KAA + G WIIT G + G++K    A+     A   NK+V IGIAPW ++ K    E+ + Q      Y S              + +   L+  HSYF L D     +  +E  V  R R E  IS         +    TR VP+  +V+ G   T+R V + +    + PVVVC GS  AAD+LA A          +   E  ++P     + I R+ L  +      F        +++ EL        L+++F + E  + D+D  I+++LL        QN    +QL + L  NR DIA+  +F    +W +  L++ M  AL+ DR DFV+L LEQG ++++FLT+  L++LY       N+   I   +    + +R     KL ++G VI+ L+G+ Y   Y + EF++   K  ++   + H++K
Sbjct:  366 LRKHTVSLATNAFGQVEFQGGPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR-NKIVCIGIAPWGLLKKR---EDFIGQDKTVPYYPS------------SSKGRFTGLNNRHSYFLLVDNGTVGRYGAE--VILRKRLEMYIS------QKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA---------HQNVTEDGLLP-----DDIRRQVLLLVE---TTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG------QNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRVRQGYRF----KLPDIGLVIEKLMGNSYQCSYTTSEFRD---KYKQRMKRVKHAQK 831          

HSP 2 Score: 72.4034 bits (176), Expect = 3.498e-12
Identity = 56/181 (30.94%), Postives = 94/181 (51.93%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS-DDFTDKE---DYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQI 3011
            P  ELMIW++L  +  MA   W   +E +A AL+A  L  SLA ++ +D+ + E   + K Y++ F   +  +L+ CY  D+ +   L+  EL  +   + + LA    +  F+AHPCCQ  L   W+G L  +  + +    V LG+I P  I +++ +K  E + L Q ++    QN +
Sbjct:  952 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNI---KVVLGLICPPFI-QMLEFKTREEL-LNQPQTAAEHQNDM 1127          

HSP 3 Score: 65.855 bits (159), Expect = 4.024e-10
Identity = 100/436 (22.94%), Postives = 182/436 (41.74%), Query Frame = 3
Query: 3048 NRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDL-NYVPTKVSRT-----------LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLR-KLNEPTQKSRQ 4283
            N S L KSN  S  +P      Q  +++K  +R   FY +P+  F   ++S++ F+  F+  LL K        E IL  ++    LE++++   S          TY    WN +   AI  +++GF +R      Y           R+IL             C    + ++++   S H  LGP + M  KMI N +   +++L V ++ +G+   +  YP            E   +       ++  I +K Y+ ++GE   D +         Q L N  P  +              + PL +   +L+ N+LL ++LIA+F   ++  +  S   W +QRY+ + E+ +   L PP   ++H   I   ++ +L  +++++++    F +    D  +  +L  +E     D  R KLNE    + Q
Sbjct: 1266 NLSKLQKSNITSTDRPNPMEQFQGTRKIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAY----------GRVIL------------ACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITYP-----------DETWHW------ILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSNEQ 1661          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 171.4 bits (433), Expect = 2.952e-42
Identity = 156/492 (31.71%), Postives = 241/492 (48.98%), Query Frame = 3
Query:  330 LPTNAFGEIEFTGLNQSAKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIE-NKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQ--LKQIV--TELGYLVSVFDMEEDW--DLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQN 1775
            +PT+A+G I F G    A++ R+  +S P   +  ++++ W+L  P L+I+I GG   F+ + KL    +KG+ K A+S   WIIT GL+ G++K    A+ D+ +    N +VAIGIA W ++ +           TY           TN    V +  + K L+ NHSYF   D    ++  +E  +  R R E  ++    + S+        +P+  +V+ G   T++ V + +    + PV+VC GS  AAD+LA A  A               V     L   IR  L  I   I  +  ++ Q  +KQIV  +    L+++F + E    DLD  I+S LL        QN    EQL++ L  NRADIA+ +IF    +W   DL++ M  AL +DR DFV L LE G S+++FLT   LE LY       N+   +   L  + K H     +KL EVG++++ L+G+ Y   Y  +EF+N
Sbjct:  191 VPTDAYGNIVFEGTAHHAQYARISFDSDPRDIVHLMMKV-WKLKPPKLIITINGGLTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRFVGKDSTVTY----------ATN----VFNNTRLKELNDNHSYFLFSDNGTVNRYGAE--IIMRKRLEAYLAQGDKKRSA--------IPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILAFAHQA---------------VSQNGFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKG------QNLSPPEQLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTDKGPQNT---LRTNLLVDSKHH-----IKLVEVGRLVENLMGNLYKSNYTKEEFKN 628          

HSP 2 Score: 72.7886 bits (177), Expect = 2.757e-12
Identity = 55/173 (31.79%), Postives = 86/173 (49.71%), Query Frame = 3
Query: 2430 NFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDK----EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNS----AMMLLASVGLGIIMPF 2924
            +F  L++    + +   P  +LMIW++L  + +MA+L W   +E +A AL+AS L  SLA  +   T +    +D+  +S  F   A  VL  C      +   L+  EL  +G  + + LAA     KF+AHPCCQ  L+  W G L  KN+     +  LA+  L  ++ F
Sbjct:  699 DFSNLEEEANMDFTFRYPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGLLMKNNQNSKVLTCLAAPPLIFLLGF 871          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 152.525 bits (384), Expect = 1.611e-36
Identity = 140/472 (29.66%), Postives = 226/472 (47.88%), Query Frame = 3
Query:  447 WELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTR-VPICGLVVGGDILTLRQVFNSIIE-NKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY------LVSVFDMEE--DWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEK 1826
            W++  P L+I++ GG  +F+ + KL  + +KGL KAA + G WIIT G + G++K    A+     A   NK+V IGIAPW ++ K    E+ + Q      Y S              + +   L+  HSYF L D     +  +E  V  R R E  IS         +    TR VP+  +V+ G   T+R V + +    + PVVVC GS  AAD+LA A          +   E  ++P     + I R+ L  +      F        +++ EL        L+++F + E  + D+D  I+++LL        QN    +QL + L  NR DIA+  +F    +W +  L++ M  AL+ DR DFV+L LEQG ++++FLT+  L++LY       N+   I   +    + +R     KL ++G VI+ L+G+ Y   Y + EF++   K  ++   + H++K
Sbjct:    8 WQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR-NKIVCIGIAPWGLLKKR---EDFIGQDKTVPYYPS------------SSKGRFTGLNNRHSYFLLVDNGTVGRYGAE--VILRKRLEMYIS------QKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA---------HQNVTEDGLLP-----DDIRRQVLLLVE---TTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKG------QNLSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVRVRQGYRF----KLPDIGLVIEKLMGNSYQCSYTTSEFRD---KYKQRMKRVKHAQK 425          

HSP 2 Score: 72.7886 bits (177), Expect = 2.532e-12
Identity = 56/181 (30.94%), Postives = 94/181 (51.93%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS-DDFTDKE---DYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQI 3011
            P  ELMIW++L  +  MA   W   +E +A AL+A  L  SLA ++ +D+ + E   + K Y++ F   +  +L+ CY  D+ +   L+  EL  +   + + LA    +  F+AHPCCQ  L   W+G L  +  + +    V LG+I P  I +++ +K  E + L Q ++    QN +
Sbjct:  546 PYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNI---KVVLGLICPPFI-QMLEFKTREEL-LNQPQTAAEHQNDM 721          

HSP 3 Score: 66.2402 bits (160), Expect = 3.005e-10
Identity = 100/436 (22.94%), Postives = 182/436 (41.74%), Query Frame = 3
Query: 3048 NRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDL-NYVPTKVSRT-----------LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLR-KLNEPTQKSRQ 4283
            N S L KSN  S  +P      Q  +++K  +R   FY +P+  F   ++S++ F+  F+  LL K        E IL  ++    LE++++   S          TY    WN +   AI  +++GF +R      Y           R+IL             C    + ++++   S H  LGP + M  KMI N +   +++L V ++ +G+   +  YP            E   +       ++  I +K Y+ ++GE   D +         Q L N  P  +              + PL +   +L+ N+LL ++LIA+F   ++  +  S   W +QRY+ + E+ +   L PP   ++H   I   ++ +L  +++++++    F +    D  +  +L  +E     D  R KLNE    + Q
Sbjct:  860 NLSKLQKSNITSTDRPNPMEQFQGTRKIKMRRRFYEFYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTVIEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAY----------GRVIL------------ACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQN-MSYIIVMLVVTLLSFGLARQSITYP-----------DETWHW------ILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEYESTPFLPPPLTPLYHGVLILQFVRTRLSCSKSQERNPMFDFSLKLFLDNDQIEKLHDFEEDCMEDLARQKLNEKNTSNEQ 1255          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 172.17 bits (435), Expect = 2.344e-42
Identity = 163/572 (28.50%), Postives = 283/572 (49.48%), Query Frame = 3
Query: 2472 LERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDK--EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQ----------DTQQNQIVIENSKEDVEMGN-RSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS---GIS--FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGE-FGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRK 4124
             E P  EL+IW++L  + QMA L W   +E +A +L++  L  ++A+++  DD   +  E+ ++Y+K FES+   +L+  Y +D ++AQ L+  EL  +   S + LA        +AHPC Q  L   W G L ++ +       V LG+ MPF I ++    ++E   + QT+ +          D+ ++Q   E S  D +    R   N S    Y++ ++ + L+  K+   FY +P+ +F  +S++Y+ FL++FS  +L K +     +E     +I TL  E++++   S    I+  FS +  + WN  D  AI LFVIG        F++     D+ +   I   DS+             ++Y+R++ I   +  LGP + M+ KM+ N +I F+++L+V ++ +GV+  A  YP                 N   T S+I  +  + Y+ ++GE F  D    I P C  +D +         + P+ + +++L+ N+LL NLLIA+F   + E+ S S   W +QR+ ++ E+  K  L PPFI + HFY +     RK
Sbjct:  568 FEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNF---KVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSE---YNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLA------FRFRENTMDIGRV--IYCVDSI-------------YWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYP-----------------NKQPTWSLIKEVTFQPYFMLYGEVFAGD----IDPPC-GEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK 1089          

HSP 2 Score: 167.548 bits (423), Expect = 5.162e-41
Identity = 157/496 (31.65%), Postives = 250/496 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-----WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSK 1787
            PT+A+G IEF G      A++VRL  ++ PE+ +Q +   +W L  P L+I++ GG  +F+ + KLK  I+KGL KAA++ G WI T G N G+ K  G+A+        G ++V+IGIAPW +V +N  L                   E     +   R+K   L+  H+YF L D    +K  +E  +  R + E  IS  K    ++ ++     P+  LV+ G   T+R V   + ++   PVVVC GS  AAD+LA       K+   +G E+  +  +   L   I++  F++   +   +K   +L Q  T    L++VF ++E       +LD  I+++L  S      Q+    EQL + LT NR DIA+ +IF+  ++W  G L++ M  AL  DR DFVKL LE G S+++FLT+  LE+LY  +    N+   I   +  +     +     L ++G VI  L+G  Y   Y  ++F+ + +K
Sbjct:   72 PTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQ-LFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTG-RVVSIGIAPWGIVERNHELLG--------------HNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAE--LILRRKLEKFISNLKLHPFTHSST-----PVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFV----HKY-ASDGEEQPVLESMRDYLIGTIQKT-FEVG--LDQSEKLYQELLQ-CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKS------QHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI---YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAK 526          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339078)

HSP 1 Score: 168.318 bits (425), Expect = 3.403e-41
Identity = 157/496 (31.65%), Postives = 250/496 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-----WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSK 1787
            PT+A+G IEF G      A++VRL  ++ PE+ +Q +   +W L  P L+I++ GG  +F+ + KLK  I+KGL KAA++ G WI T G N G+ K  G+A+        G ++V+IGIAPW +V +N  L                   E     +   R+K   L+  H+YF L D    +K  +E  +  R + E  IS  K    ++ ++     P+  LV+ G   T+R V   + ++   PVVVC GS  AAD+LA       K+   +G E+  +  +   L   I++  F++   +   +K   +L Q  T    L++VF ++E       +LD  I+++L  S      Q+    EQL + LT NR DIA+ +IF+  ++W  G L++ M  AL  DR DFVKL LE G S+++FLT+  LE+LY  +    N+   I   +  +     +     L ++G VI  L+G  Y   Y  ++F+ + +K
Sbjct:   72 PTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQ-LFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTG-RVVSIGIAPWGIVERNHELLG--------------HNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAE--LILRRKLEKFISNLKLHPFTHSST-----PVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFV----HKY-ASDGEEQPVLESMRDYLIGTIQKT-FEVG--LDQSEKLYQELLQ-CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKS------QHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI---YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAK 526          

HSP 2 Score: 127.872 bits (320), Expect = 7.044e-29
Identity = 121/442 (27.38%), Postives = 216/442 (48.87%), Query Frame = 3
Query: 2472 LERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDK--EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQ----------DTQQNQIVIENSKEDV---------EMGNRSILNKS--------NTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS---GIS--FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYP 3689
             E P  EL+IW++L  + QMA L W   +E +A +L++  L  ++A+++  DD   +  E+ ++Y+K FES+   +L+  Y +D ++AQ L+  EL  +   S + LA        +AHPC Q  L   W G L ++ +       V LG+ MPF I ++    ++E   + QT+ +          D+ ++Q   E    D          E G  S+ +          N   Y++ ++ + L+  K+   FY +P+ +F  +S++Y+ FL++FS  +L K +     +E     +I TL  E++++   S    I+  FS +  + WN  D  AI LFVIG        F++     D+ +   I   DS+             ++Y+R++ I   +  LGP + M+ KM+ N +I F+++L+V ++ +GV+  A  YP
Sbjct:  568 FEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNF---KVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLA------FRFRENTMDIGRV--IYCVDSI-------------YWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYP 984          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 168.318 bits (425), Expect = 3.490e-41
Identity = 157/496 (31.65%), Postives = 250/496 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-----WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSK 1787
            PT+A+G IEF G      A++VRL  ++ PE+ +Q +   +W L  P L+I++ GG  +F+ + KLK  I+KGL KAA++ G WI T G N G+ K  G+A+        G ++V+IGIAPW +V +N  L                   E     +   R+K   L+  H+YF L D    +K  +E  +  R + E  IS  K    ++ ++     P+  LV+ G   T+R V   + ++   PVVVC GS  AAD+LA       K+   +G E+  +  +   L   I++  F++   +   +K   +L Q  T    L++VF ++E       +LD  I+++L  S      Q+    EQL + LT NR DIA+ +IF+  ++W  G L++ M  AL  DR DFVKL LE G S+++FLT+  LE+LY  +    N+   I   +  +     +     L ++G VI  L+G  Y   Y  ++F+ + +K
Sbjct:  174 PTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQ-LFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTG-RVVSIGIAPWGIVERNHELLG--------------HNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAE--LILRRKLEKFISNLKLHPFTHSST-----PVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFV----HKY-ASDGEEQPVLESMRDYLIGTIQKT-FEVG--LDQSEKLYQELLQ-CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKS------QHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI---YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAK 628          

HSP 2 Score: 165.236 bits (417), Expect = 3.409e-40
Identity = 163/587 (27.77%), Postives = 284/587 (48.38%), Query Frame = 3
Query: 2475 ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDK--EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQ----------DTQQNQIVIENSKEDV---------EMGNRSILNKS--------NTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS---GIS--FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGE-FGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRK 4124
            E P  EL+IW++L  + QMA L W   +E +A +L++  L  ++A+++  DD   +  E+ ++Y+K FES+   +L+  Y +D ++AQ L+  EL  +   S + LA        +AHPC Q  L   W G L ++ +       V LG+ MPF I ++    ++E   + QT+ +          D+ ++Q   E    D          E G  S+ +          N   Y++ ++ + L+  K+   FY +P+ +F  +S++Y+ FL++FS  +L K +     +E     +I TL  E++++   S    I+  FS +  + WN  D  AI LFVIG        F++     D+ +   I   DS+             ++Y+R++ I   +  LGP + M+ KM+ N +I F+++L+V ++ +GV+  A  YP                 N   T S+I  +  + Y+ ++GE F  D    I P C  +D +         + P+ + +++L+ N+LL NLLIA+F   + E+ S S   W +QR+ ++ E+  K  L PPFI + HFY +     RK
Sbjct:  671 EFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNF---KVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLA------FRFRENTMDIGRV--IYCVDSI-------------YWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYP-----------------NKQPTWSLIKEVTFQPYFMLYGEVFAGD----IDPPC-GEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK 1210          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339081)

HSP 1 Score: 167.933 bits (424), Expect = 3.941e-41
Identity = 157/496 (31.65%), Postives = 250/496 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-----WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSK 1787
            PT+A+G IEF G      A++VRL  ++ PE+ +Q +   +W L  P L+I++ GG  +F+ + KLK  I+KGL KAA++ G WI T G N G+ K  G+A+        G ++V+IGIAPW +V +N  L                   E     +   R+K   L+  H+YF L D    +K  +E  +  R + E  IS  K    ++ ++     P+  LV+ G   T+R V   + ++   PVVVC GS  AAD+LA       K+   +G E+  +  +   L   I++  F++   +   +K   +L Q  T    L++VF ++E       +LD  I+++L  S      Q+    EQL + LT NR DIA+ +IF+  ++W  G L++ M  AL  DR DFVKL LE G S+++FLT+  LE+LY  +    N+   I   +  +     +     L ++G VI  L+G  Y   Y  ++F+ + +K
Sbjct:   79 PTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQ-LFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTG-RVVSIGIAPWGIVERNHELLG--------------HNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAE--LILRRKLEKFISNLKLHPFTHSST-----PVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFV----HKY-ASDGEEQPVLESMRDYLIGTIQKT-FEVG--LDQSEKLYQELLQ-CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKS------QHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI---YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAK 533          

HSP 2 Score: 156.762 bits (395), Expect = 1.178e-37
Identity = 164/612 (26.80%), Postives = 286/612 (46.73%), Query Frame = 3
Query: 2475 ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDK--EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENS---KEDVE----MGNRSI------------------------------------LNKSNTLS---------YSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS---GIS--FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGE-FGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRK 4124
            E P  EL+IW++L  + QMA L W   +E +A +L++  L  ++A+++  DD   +  E+ ++Y+K FES+   +L+  Y +D ++AQ L+  EL  +   S + LA        +AHPC Q  L   W G L ++ +       V LG+ MPF I ++    ++E   + QT+ +  +   +  ++S   + D E       RSI                                    L  S+T           Y++ ++ + L+  K+   FY +P+ +F  +S++Y+ FL++FS  +L K +     +E     +I TL  E++++   S    I+  FS +  + WN  D  AI LFVIG        F++     D+ +   I   DS++             +Y+R++ I   +  LGP + M+ KM+ N +I F+++L+V ++ +GV+  A  YP                 N   T S+I  +  + Y+ ++GE F  D    I P C  +D +         + P+ + +++L+ N+LL NLLIA+F   + E+ S S   W +QR+ ++ E+  K  L PPFI + HFY +     RK
Sbjct:  576 EFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNF---KVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAESALLKAKRSISLRYRMGAGANNRDKALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLA------FRFRENTMDIGRV--IYCVDSIY-------------WYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYP-----------------NKQPTWSLIKEVTFQPYFMLYGEVFAGD----IDPPCG-EDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK 1140          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 167.933 bits (424), Expect = 4.463e-41
Identity = 157/496 (31.65%), Postives = 250/496 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-----WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSK 1787
            PT+A+G IEF G      A++VRL  ++ PE+ +Q +   +W L  P L+I++ GG  +F+ + KLK  I+KGL KAA++ G WI T G N G+ K  G+A+        G ++V+IGIAPW +V +N  L                   E     +   R+K   L+  H+YF L D    +K  +E  +  R + E  IS  K    ++ ++     P+  LV+ G   T+R V   + ++   PVVVC GS  AAD+LA       K+   +G E+  +  +   L   I++  F++   +   +K   +L Q  T    L++VF ++E       +LD  I+++L  S      Q+    EQL + LT NR DIA+ +IF+  ++W  G L++ M  AL  DR DFVKL LE G S+++FLT+  LE+LY  +    N+   I   +  +     +     L ++G VI  L+G  Y   Y  ++F+ + +K
Sbjct:   72 PTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQ-LFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRTG-RVVSIGIAPWGIVERNHELLG--------------HNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAE--LILRRKLEKFISNLKLHPFTHSST-----PVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFV----HKY-ASDGEEQPVLESMRDYLIGTIQKT-FEVG--LDQSEKLYQELLQ-CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKS------QHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI---YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAK 526          

HSP 2 Score: 165.622 bits (418), Expect = 2.220e-40
Identity = 163/588 (27.72%), Postives = 284/588 (48.30%), Query Frame = 3
Query: 2472 LERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDK--EDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQ----------DTQQNQIVIENSKEDV---------EMGNRSILNKS--------NTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS---GIS--FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGE-FGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRK 4124
             E P  EL+IW++L  + QMA L W   +E +A +L++  L  ++A+++  DD   +  E+ ++Y+K FES+   +L+  Y +D ++AQ L+  EL  +   S + LA        +AHPC Q  L   W G L ++ +       V LG+ MPF I ++    ++E   + QT+ +          D+ ++Q   E    D          E G  S+ +          N   Y++ ++ + L+  K+   FY +P+ +F  +S++Y+ FL++FS  +L K +     +E     +I TL  E++++   S    I+  FS +  + WN  D  AI LFVIG        F++     D+ +   I   DS+             ++Y+R++ I   +  LGP + M+ KM+ N +I F+++L+V ++ +GV+  A  YP                 N   T S+I  +  + Y+ ++GE F  D    I P C  +D +         + P+ + +++L+ N+LL NLLIA+F   + E+ S S   W +QR+ ++ E+  K  L PPFI + HFY +     RK
Sbjct:  568 FEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNF---KVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLA------FRFRENTMDIGRV--IYCVDSI-------------YWYLRILNILGVNKYLGPLVTMMGKMVKN-MIYFVVLLAVVLMSFGVSRQAILYP-----------------NKQPTWSLIKEVTFQPYFMLYGEVFAGD----IDPPC-GEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK 1108          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 194.897 bits (494), Expect = 2.847e-49
Identity = 160/536 (29.85%), Postives = 263/536 (49.07%), Query Frame = 3
Query:  246 EGIAQILEESKGHLSTNFDPE--------KIRKNYTLPTNAFGEIEFTGLNQ-SAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGG--NKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKI-NPEIKDFKK----ESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXX-XRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTV-YILEKLYTDQ-----LKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ 1772
            EGI +       H      PE        K R     PT+AFG+I F GL Q + K+VR+ + T   N+  ++  +W+L  P L+IS+ GG  +F  K  LK   ++GL K A++ G WI+T G + G+MK  G AVRDYT + G    ++V IG+APW V+     L +   +G +PA Y  +E+ +           +   LD NH++F L D    ++     +++ R+R E  IS    + S     +   +P+  +V+ G   TL  ++NS++ N  P VV +GS   ADV+A                    VP+     ++I   L +    E K+F +    E  +  Q +  + +L++VF ++ED  +D+D  I+ +LL ++ SD    +   E+        NR DIA+ +IF E  +W   DL+  MF+AL+ D+ +FV+L LE G  + EFL     L +LY+       L+ L  R++   ++    +     + V L  V + ++ L+G F  PLY++  ++
Sbjct:   58 EGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHP--EGRFPAYYSLDEQGQ----------GRLSCLDINHTHFLLVD--DGTQGHYGVEIELRARLEKLIS----KLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSML-NHTPCVVLEGSGRLADVIA----------------HVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQ-GGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYK 557          

HSP 2 Score: 165.622 bits (418), Expect = 2.686e-40
Identity = 159/560 (28.39%), Postives = 272/560 (48.57%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ--ATFSGISF----STYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF--------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            P R+L +W+++    ++AE+ W   ++ IA AL AS +L  LA +S  DD  +  +    + H+E QA GV +EC+  D +RAQ L+ +    +G+S+ + LA +     F+AH   Q  LT  W G LS  N    +L  +   I  P +    ++++ DE I   Q +++ T+Q ++ +E+    V  G      K +   +S+  + K L    R+ +F  SP ++F +N  SY  FL LF+  L+  F+      E++L  W+ +L+ EEI+Q    F G  F      Y  D WN LD  +I LF+ G I RL                     +D++F   +  +      F +R+M IFS    LGPK+I++R+M+ +    FM +LS++++ YGV                +L +   + N      +I   + + Y  +FG F               +++   + P C   + +  P      L  + L +++L  N+LL NLLIA+F  T++E++ ++   W +QRY++I E+ ++  L PPFI++ H 
Sbjct:  590 PGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCM---IFFPLIYTGFLTFRRDEDI---QRQAERTEQQKLAMES----VFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQA-------------------SDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFF-FMFLLSIWVVAYGVA------------KQGILIENEERLNW-----IIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPV-FPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHL 1101          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 191.815 bits (486), Expect = 1.472e-48
Identity = 147/434 (33.87%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  345 FGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYD----CPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINP------EIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
             G+I+FTG++++  KFVR+ +ST    I  IL  +W L  P LV+++ GGD   + K  L+  ++KGL KAA+S G WI+T GL  GI K  G+AVRD++ A    K+  VAIGIAPWN++   D+L ++  +  +PA Y +E+       G V       SLD NHS+F L D     P ++ E+       R +    IS    Q + Y  +    +P+  L+V G+   L++++ +I +N  P ++  GS G AD+L   +D         G  + +IV          +E L    P      EI  + K    L Q + + G+L++V D E+D +LD  I+ +L+ +  S   + Q  L++L++ +  NR DIAK +IF  + +W   DL + M  AL++D+ DFV+LF++ G ++++FLT   L++LY
Sbjct:   17 LGDIDFTGVSRTRGKFVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSA--KPDHPATYPTEDLPY----GAVY------SLDCNHSHFILVDEDPKRPGATGEM-------RVKMLKHISL---QRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNI-QNSIPWLILAGSGGVADILVTLMD--------RGCWDADIV----------QELLINTFPDGLHSTEITSWTK----LIQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY 405          

HSP 2 Score: 179.104 bits (453), Expect = 1.123e-44
Identity = 182/652 (27.91%), Postives = 306/652 (46.93%), Query Frame = 3
Query: 2424 QTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESI------PLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGISFST------YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGL---DSLQGISPSCSSQ-------DLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTR 4289
            Q N  ++D R       E P R+L +W++L  + +MA  FWAM  E +A AL+   ++  +A+ + +       K  +  +E  A  + +ECY   E RA  L+ ++   + +++V+ +A   ++  F AH   Q  LT  W+G + +  S   L+ +     I P V   +I +  +E +      P  +  S +T+Q  ++ +    D   G  S    + T + S    F R+   +R   F+ +PV  F+ N + Y  FL+LFS  LL    ++F           EIIL FW+ TL+LEEI+Q+ F+    S       Y  D WNK D  AI+LFV+G   R+                       S +   +T +      F +R+++IF+ H  LGPK+I++ +MI  D+  F+  LSV++I YGVT  A  +P                 N    D +    L + Y  +FG+  L   D+ +    +C++         L   P   +  L  L L +++L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+ ++  L PPFIII H       + + L +   + ++  D         L  +++L+ WE ++  +YL KL    ++S   R
Sbjct:  482 QKNLPDMDRR------CEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMK--NAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF---FIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDG---DPVAGEGS----AETAARSCSATFIRV-VLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLL----LDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM---------------------STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMI-KDVFFFLFFLSVWLIAYGVTTQALLHP-----------------NDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISH-------ITQALLSFIKKTENTQDLLGKELPSGL--DQKLMTWETVQKENYLAKLEHEHRESSGER 1062          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 191.815 bits (486), Expect = 1.504e-48
Identity = 147/434 (33.87%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  345 FGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYD----CPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINP------EIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
             G+I+FTG++++  KFVR+ +ST    I  IL  +W L  P LV+++ GGD   + K  L+  ++KGL KAA+S G WI+T GL  GI K  G+AVRD++ A    K+  VAIGIAPWN++   D+L ++  +  +PA Y +E+       G V       SLD NHS+F L D     P ++ E+       R +    IS    Q + Y  +    +P+  L+V G+   L++++ +I +N  P ++  GS G AD+L   +D         G  + +IV          +E L    P      EI  + K    L Q + + G+L++V D E+D +LD  I+ +L+ +  S   + Q  L++L++ +  NR DIAK +IF  + +W   DL + M  AL++D+ DFV+LF++ G ++++FLT   L++LY
Sbjct:   17 LGDIDFTGVSRTRGKFVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSA--KPDHPATYPTEDLPY----GAVY------SLDCNHSHFILVDEDPKRPGATGEM-------RVKMLKHISL---QRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNI-QNSIPWLILAGSGGVADILVTLMD--------RGCWDADIV----------QELLINTFPDGLHSTEITSWTK----LIQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY 405          

HSP 2 Score: 181.415 bits (459), Expect = 2.118e-45
Identity = 194/697 (27.83%), Postives = 321/697 (46.05%), Query Frame = 3
Query: 2313 FHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGN----IIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESI------PLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGISFST------YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGL---DSLQGISPSCSSQ-------DLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYE-IYSLLKRKLFTN---ENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTR 4289
            FHE+ ++L          +T +    K   E +G       Q N  ++D R       E P R+L +W++L  + +MA  FWAM  E +A AL+   ++  +A+ + +       K  +  +E  A  + +ECY   E RA  L+ ++   + +++V+ +A   ++  F AH   Q  LT  W+G + +  S   L+ +     I P V   +I +  +E +      P  +  S +T+Q  ++ +    D   G  S    + T + S    F R+   +R   F+ +PV  F+ N + Y  FL+LFS  LL    ++F           EIIL FW+ TL+LEEI+Q+ F+    S       Y  D WNK D  AI+LFV+G   R+                       S +   +T +      F +R+++IF+ H  LGPK+I++ +MI  D+  F+  LSV++I YGVT  A  +P                 N    D +    L + Y  +FG+  L   D+ +    +C++         L   P   +  L  L L +++L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+ ++  L PPFIII H  + + S +K+   T    E E  S  D             ++L+ WE ++  +YL KL    ++S   R
Sbjct:  451 FHEVSKVL-----KDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRR------CEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMK--NAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF---FIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDG---DPVAGEGS----AETAARSCSATFIRV-VLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLL----LDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM---------------------STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMI-KDVFFFLFFLSVWLIAYGVTTQALLHP-----------------NDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQALLSFIKKTENTQDLLERELPSGLD-------------QKLMTWETVQKENYLAKLEHEHRESSGER 1067          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 191.43 bits (485), Expect = 2.235e-48
Identity = 147/434 (33.87%), Postives = 236/434 (54.38%), Query Frame = 3
Query:  345 FGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYD----CPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINP------EIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
             G+I+FTG++++  KFVR+ +ST    I  IL  +W L  P LV+++ GGD   + K  L+  ++KGL KAA+S G WI+T GL  GI K  G+AVRD++ A    K+  VAIGIAPWN++   D+L ++  +  +PA Y +E+       G V       SLD NHS+F L D     P ++ E+       R +    IS    Q + Y  +    +P+  L+V G+   L++++ +I +N  P ++  GS G AD+L   +D         G  + +IV          +E L    P      EI  + K    L Q + + G+L++V D E+D +LD  I+ +L+ +  S   + Q  L++L++ +  NR DIAK +IF  + +W   DL + M  AL++D+ DFV+LF++ G ++++FLT   L++LY
Sbjct:   66 LGDIDFTGVSRTRGKFVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSA--KPDHPATYPTEDLPY----GAVY------SLDCNHSHFILVDEDPKRPGATGEM-------RVKMLKHISL---QRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNI-QNSIPWLILAGSGGVADILVTLMD--------RGCWDADIV----------QELLINTFPDGLHSTEITSWTK----LIQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY 454          

HSP 2 Score: 179.874 bits (455), Expect = 6.828e-45
Identity = 190/693 (27.42%), Postives = 320/693 (46.18%), Query Frame = 3
Query: 2313 FHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGN----IIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESI------PLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGISFST------YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGL---DSLQGISPSCSSQ-------DLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTR 4289
            FHE+ ++L          +T +    K   E +G       Q N  ++D R       E P R+L +W++L  + +MA  FWAM  E +A AL+   ++  +A+ + +       K  +  +E  A  + +ECY   E RA  L+ ++   + +++V+ +A   ++  F AH   Q  LT  W+G + +  S   L+ +     I P V   +I +  +E +      P  +  S +T+Q  ++ +    D   G  S    + T + S    F R+   +R   F+ +PV  F+ N + Y  FL+LFS  LL    ++F           EIIL FW+ TL+LEEI+Q+ F+    S       Y  D WNK D  AI+LFV+G   R+                       S +   +T +      F +R+++IF+ H  LGPK+I++ +MI  D+  F+  LSV++I YGVT  A  +P                 N    D +    L + Y  +FG+  L   D+ +    +C++         L   P   +  L  L L +++L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+ ++  L PPFIII H       + + L +   + ++  D         L  +++L+ WE ++  +YL KL    ++S   R
Sbjct:  500 FHEVSKVL-----KDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRR------CEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMK--NAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTF---FIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDG---DPVAGEGS----AETAARSCSATFIRV-VLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLL----LDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM---------------------STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMI-KDVFFFLFFLSVWLIAYGVTTQALLHP-----------------NDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISH-------ITQALLSFIKKTENTQDLLGKELPSGL--DQKLMTWETVQKENYLAKLEHEHRESSGER 1116          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 179.489 bits (454), Expect = 4.162e-47
Identity = 149/500 (29.80%), Postives = 252/500 (50.40%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGG---NKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKS-LDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXX-XRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDN-HKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRK 1799
            PT+A+G++EF G  +  + F+RL N+T    +  +++  W+L  P+LV+S+ GG+   E K  ++ I+++GL KAA+S G WIIT GL  GI +  GEAV+D   A      NK++ IGIAPW ++     L NS  +G++PA Y            MV++ + E   LD NH  F L D   +  +  E  + FR+R E  IS  +   +S +      +P+  +++ GD         S++EN  P +V  GS G A             +LEE +    I+ L  +L + ++    K  P   D  K   ++  I      ++S+++ E++   D D  ++  L+ ++    +++  +           NR DIAK ++F  N  WK  +L D M +AL +++  FV+L ++ G ++  +LT   LEKLY        ++  + H L +  H+++  + ++ L EV ++++ L+GD  HP YLS E       T RK
Sbjct:   66 PTDAYGDLEFAGAGKRHSYFLRLSNTTDPARVFDLMKEHWKLPQPSLVLSVVGGEGRSEVKSWVRDILRQGLVKAAQSTGAWIITGGLRQGISRCIGEAVKDNATAVSSITLNKVLPIGIAPWGLLGNRQQLVNS--EGSFPARY------------MVRNISPEYCYLDNNHKAFLLVDDGTTRHKGGE--LAFRARLEDYISHQRPGGASID------IPVLNMLIAGD--------TSMLENSTPCLVLAGSGGLA-------------NLEEDAS--PIMELREQLAAKVK----KYFPAENDTDKLVDKVLSIYQNKD-IISIYNAEQEGAEDFDIVMLKVLVQASKRHASESTNSYADELRLSVTWNRVDIAKSELFNGNIDWKVEELVDSMTDALENNKPQFVRLLIDNGLNILSYLTYGRLEKLYNSISDTCLAKTLLLHHLDERMHESNEQIYSISLYEVSRLLEDLLGDVCHPFYLS-ELSLYAGSTRRK 514          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 188.348 bits (477), Expect = 1.809e-49
Identity = 160/493 (32.45%), Postives = 258/493 (52.33%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGN--KMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF-DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN--LNSRIEIFHRLWDNHKT---HRLV--------KNVKLREVGKVIKILVGDFYHPLY 1754
            PT+A+G++EF G  +  +KF+RL N T   ++ +++   W++  P LV+S+ GGD  F+ K  LK I++KGL KAA+S G WI+T G+ +GI K  GEAVRD+  A   +  K+VA+GIAPW +V     L N   +G++PA Y  +     N DG         SLD N+S F L D     +   E    FR R E  IS    Q +         +P+  +++ G+   L +V+N+  ++  P ++  GS G AD LA  ++              E + LE+ +  +I E L    P  ++  K   ++++IV E   LV+V+ D +   D +  I+ +L+ +     +     L++L++ +  NR DIAK ++F     WK  DL+D M +AL++++  FVKLF++ G ++ ++LT   LE+LY+  L N  L   ++  H    N KT   H L+        +  KL EV K+++ L+GD     Y
Sbjct:   74 PTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNP--KGSFPATYYMD-----NVDG------PTYSLDNNYSVFLLADDGTHGQMGGE--TSFRFRLEEHIS---RQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNAT-KSPIPCLLVAGSGGVADCLAEILE--------------ESIALES-IRGLIEEKLKHYFPN-ENLTKMVEKVERIV-ENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFY 530          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: c8b (complement component 8, beta polypeptide [Source:Xenbase;Acc:XB-GENE-998160])

HSP 1 Score: 189.504 bits (480), Expect = 4.596e-49
Identity = 162/497 (32.60%), Postives = 261/497 (52.52%), Query Frame = 3
Query:  330 LPTNAFGEIEFTGLNQSA--KFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNK---MVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPE---------IKDFKKESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY--TDQLKNLNSRI-EIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            +PT+AFG+I F GL      ++VR+ + TP   +  ++   W L  P+L+IS+ GG  +F  + +LK I ++GL KAA++ G WIIT G + G+MK  GEAVRDY+  +GG K   +V IGIA W +V     L ++   G +PA Y  EEE++ N             LD NHS+F L D   + K   E  +  R++ E  IS    + ++ +     ++PI  +V+ G   TL  ++N+I  N  P V+ +GS   ADV+A                +   +P+     S+I+E +  + P+         I D+ K+     Q +     L+++F +++D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF +  +WK  DL+  M  AL+ ++ DFVKLFLEQG  LEE+ T   +  LY  TD     +S++ ++F       +T +  K ++L  V +V++ L GDF   LY
Sbjct:  114 VPTDAFGDISFIGLGPRVGKQYVRVSSDTPSDVLYQLMTEHWGLEVPSLLISVTGGAKNFRMQMRLKNIFRRGLVKAAQTTGAWIITGGSHAGVMKQVGEAVRDYS--FGGIKDSEIVTIGIATWGIVHNRRSLISA--TGAFPADYLLEEENQGN----------LSCLDNNHSHFILVDDGTNGKYGVE--ILLRAKLEKFIS----EQTTEKGGVAIKIPIVCVVLEGGPGTLDTIYNAI-RNNTPCVIVEGSGRVADVIA----------------QVAHLPISKITISLIQEKIRTLFPDTFDTFTEYKIADWTKKI----QDIMRNNQLLTIFQVDKDDQHDIDFAILQALLKASLSHDQQGHENWDHQLKLAVAWNRVDIARSEIFTDELQWKPSDLHPLMTAALIGNKPDFVKLFLEQGVRLEEYATQETIINLYNNTDPSCLFHSKLAKVFEDERLRLETSKSFK-LQLHHVSQVLRELFGDFTKHLY 568          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 186.808 bits (473), Expect = 4.361e-47
Identity = 159/513 (30.99%), Postives = 263/513 (51.27%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGN--KMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF-DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN--LNSRIEIFHRLWDNHKT---HRLV--------KNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMT 1814
            PT+A+G++EF G  +  +KF+RL N T   ++ +++   W++  P LV+S+ GGD  F+ K  LK I++KGL KAA+S G WI+T G+ +GI K  GEAVRD+  A   +  K+VA+GIAPW +V     L N   +G++PA Y  +     N DG         SLD N+S F L D     +   E    FR R E  IS    Q +         +P+  +++ G+   L +V+N+  ++  P ++  GS G AD LA  ++              E + LE+ +  +I E L    P      +   ++ + + E   LV+V+ D +   D +  I+ +L+ +     +     L++L++ +  NR DIAK ++F     WK  DL+D M +AL++++  FVKLF++ G ++ ++LT   LE+LY+  L N  L   ++  H    N KT   H L+        +  KL EV K+++ L+GD     Y +    N+    +++ S ++
Sbjct:   71 PTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNP--KGSFPATYYMD-----NVDG------PTYSLDNNYSVFLLADDGTHGQMGGE--TSFRFRLEEHIS---RQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNAT-KSPIPCLLVAGSGGVADCLAEILE--------------ESIALES-IRGLIEEKLKHYFP-----NENLTKMVERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFY-THVLGNMKGSVNKRNSGVS 543          

HSP 2 Score: 119.398 bits (298), Expect = 3.180e-26
Identity = 117/440 (26.59%), Postives = 197/440 (44.77%), Query Frame = 3
Query: 2451 RKLKEISLER--------PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGI-----SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFT 3707
            + +++I++E+        P  +L IW++L  + +MA  FW M  E +  AL A  +L  L+    +  +    +  +  FE Q   V NECY   E RA  L+ +    +G ++ + LA +  +  F A    Q  LT  W+G ++       ++ +       P +   +I++K+     +G  +                ++  G    L  +      K ++  R ++ +R K F+ +PV  F  N V Y  FL LFS  LL    +EF           E IL FWI T++ EEI+Q+ F G          Y  D WN +D  A+ LF+IG I R+      +NE                F   +T +      F +R+++IF+ +  LGPK+I++RKM+  D+  F+  L V++I YGVT     +P  ++ +
Sbjct:  556 KSMEQIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRMESEAEESLAMRDLAAKFE-QLAIVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF---FCPPLIYTDLITFKD----AVGSCRKSG-------------ELTSGEGPFLFLAPEAEIIKEKQ--RPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLL----LEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRM------FNES---------------FEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMM-KDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLS 946          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 187.193 bits (474), Expect = 4.923e-47
Identity = 162/511 (31.70%), Postives = 261/511 (51.08%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGN--KMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF-DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN--LNSRIEIFHRLWDNHKT---HRLV--------KNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRST 1808
            PT+A+G++EF G  +  +KF+RL N T   ++ +++   W++  P LV+S+ GGD  F+ K  LK I++KGL KAA+S G WI+T G+ +GI K  GEAVRD+  A   +  K+VA+GIAPW +V     L N   +G++PA Y  +     N DG         SLD N+S F L D     +   E    FR R E  IS    Q +         +P+  +++ G+   L +V+N+  ++  P ++  GS G AD LA  ++              E + LE+ +  +I E L    P      +   ++ + + E   LV+V+ D +   D +  I+ +L+ +     +     L++L++ +  NR DIAK ++F     WK  DL+D M +AL++++  FVKLF++ G ++ ++LT   LE+LY+  L N  L   ++  H    N KT   H L+        +  KL EV K+++ L+GD     Y     Q  V K   ++ST
Sbjct:   74 PTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNP--KGSFPATYYMD-----NVDG------PTYSLDNNYSVFLLADDGTHGQMGGE--TSFRFRLEEHIS---RQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNAT-KSPIPCLLVAGSGGVADCLAEILE--------------ESIALES-IRGLIEEKLKHYFP-----NENLTKMVERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTH---QIAVEKYQPRKST 542          

HSP 2 Score: 158.303 bits (399), Expect = 3.659e-38
Identity = 162/634 (25.55%), Postives = 277/634 (43.69%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGI-----SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFG---LDSLQGISPSCSSQDLNYVPTKVSRTLNPXX-------XXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEK-KSNSDPFCINFSEDLK---KERELVKWEHMKAMDYL-----RKLNEPTQKSRQT 4286
            P  +L IW++L  + +MA  FW M  E +  AL A  +L  L+    +  +    +  +  FE  A GV NECY   E RA  L+ +    +G ++ + LA +  +  F A    Q  LT  W+G ++               +++ F  P +I     + I     +     + +I+ E                            +R ++ +R K F+ +PV  F  N V Y      F     +   +EF           E IL FWI T++ EEI+Q+ F G          Y  D WN +D  A+ LF+IG I R+      +NE                F   +T +      F +R+++IF+ +  LGPK+I++RKM+  D+  F+  L V++I YGVT     +P  ++ +                  +   +  + Y  +FG+      D+ +  S +C++  +  +  +     N          L + +L+ N+LL NLLIAMF+ T+ +++ +S  YW +QRY +I E+ N+  L PPFIII H   I + +KRK+    ++K +  S+ F I+    L     +  ++ WE ++  +Y+      K +  T++ R+T
Sbjct:  544 PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVW--------AMVLTFFCPPLIY---TDLITFNSVEQNGAPEAEIIKEK---------------------------QRPRWMQRWKQFWSAPVTAFFGNVVMY----FAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRM------FNE---------------SFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMM-KDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLS-----------------WIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISH---INTFIKRKIRKVASQKIRHFSECFRIHRPSTLALFTLDNRMLIWEAVQKENYMVSVAKHKRDSDTERLRRT 1093          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 187.193 bits (474), Expect = 5.126e-47
Identity = 162/511 (31.70%), Postives = 261/511 (51.08%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGN--KMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF-DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKN--LNSRIEIFHRLWDNHKT---HRLV--------KNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRST 1808
            PT+A+G++EF G  +  +KF+RL N T   ++ +++   W++  P LV+S+ GGD  F+ K  LK I++KGL KAA+S G WI+T G+ +GI K  GEAVRD+  A   +  K+VA+GIAPW +V     L N   +G++PA Y  +     N DG         SLD N+S F L D     +   E    FR R E  IS    Q +         +P+  +++ G+   L +V+N+  ++  P ++  GS G AD LA  ++              E + LE+ +  +I E L    P      +   ++ + + E   LV+V+ D +   D +  I+ +L+ +     +     L++L++ +  NR DIAK ++F     WK  DL+D M +AL++++  FVKLF++ G ++ ++LT   LE+LY+  L N  L   ++  H    N KT   H L+        +  KL EV K+++ L+GD     Y     Q  V K   ++ST
Sbjct:   74 PTDAYGDVEFVGAGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNP--KGSFPATYYMD-----NVDG------PTYSLDNNYSVFLLADDGTHGQMGGE--TSFRFRLEEHIS---RQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNAT-KSPIPCLLVAGSGGVADCLAEILE--------------ESIALES-IRGLIEEKLKHYFP-----NENLTKMVERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTH---QIAVEKYQPRKST 542          

HSP 2 Score: 155.992 bits (393), Expect = 2.447e-37
Identity = 170/630 (26.98%), Postives = 286/630 (45.40%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGI-----SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFG---LDSLQGISPSCSSQDLNYVPTKVSRTLNPXX-------XXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYL-----RKLNEPTQKSRQT 4286
            P  +L IW++L  + +MA  FW M  E +  AL A  +L  L+    +  +    +  +  FE  A GV NECY   E RA  L+ +    +G ++ + LA +  +  F A    Q  LT  W+G ++       ++ +       P +   +I++K +  + +    S D   + + I          N ++L +        P+++K+         F+ +PV  F  N V Y  FL LFS  LL    +EF           E IL FWI T++ EEI+Q+ F G          Y  D WN +D  A+ LF+IG I R+      +NE                F   +T +      F +R+++IF+ +  LGPK+I++RKM+  D+  F+  L V++I YGVT     +P  ++ +                  +   +  + Y  +FG+      D+ +  S +C++  +  +  +     N          L + +L+ N+LL NLLIAMF+ T+ +++ +S  YW +QRY +I E+ N+  L PPFIII H   I + +KRK+    ++K         +FSE     R L+ WE ++  +Y+      K +  T++ R+T
Sbjct:  544 PWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTF---FCPPLIYTDLITFKPNNYM-ISSHLSIDPTPHTVTI----------NSNLLGREGCCRL-LPERWKQ---------FWSAPVTAFFGNVVMYFAFLFLFSYVLL----LEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRM------FNES---------------FEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMM-KDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLS-----------------WIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISH---INTFIKRKIRKVASQKIR-------HFSE---YNRMLI-WEAVQKENYMVSVAKHKRDSDTERLRRT 1092          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 178.333 bits (451), Expect = 4.419e-44
Identity = 158/498 (31.73%), Postives = 248/498 (49.80%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+  ++ P++ +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  ++      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  137 PTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLH-LMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLIGRDVVRP-----YQT----------MSNPMSKLTVLNSMHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGLIN-----ESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 584          

HSP 2 Score: 152.14 bits (383), Expect = 3.928e-36
Identity = 201/782 (25.70%), Postives = 362/782 (46.29%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIIS--YKEDESIPLGQTKSQDTQ--------QNQIVIENSKEDVEMGNRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQ---------GISPSCSSQD-------LNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLK---RKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEIN---HQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDE 4640
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LGI++P   P I+S  +K  + +P   T++Q+            +   E  +ED+E+   ++L +SN  S  K        + + +   ++I  FY +P+++F + +++Y+ +L+LF+  +L K +     +E I+  +I TL +E++++   S           +  + WN  D  AI LF +G ILRL             +Q +R   +D   I    C+  ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A  +P                 N   +  +   I    Y+ ++GE   D +            S  C   +       +   P K    + P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F  +  L PP II  H   I+  +    RK  ++++E+      F  +  ++LKK  +   +E     +Y R+              D R      F S       +  + V+N    +   EE+N   H +    + VD++L++L +L   IG  A  ++     L G++   +   +KI +     CT+   +   SS  S E
Sbjct:  625 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGILLP---PSILSLEFKNKDDMPY-MTQAQEIHLQEKEPEEPEKPTKEKDEEDMELT--AMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL------------QDQPFR---SDGRVI---YCV--NIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFP-----------------NEEPSWKLAKNIFYMPYWMIYGEVFADQIDRKQVYDSHTPKSAPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITD--DELKKVHD---FEEQCIEEYFRE-------------KDDR------FNSSNDERIRVTSERVEN---MSMRLEEVNEREHSMKASLQTVDIRLAQLEDL---IGRMATALER----LTGLERAES---NKIRSRTSSDCTDAAYIVRQSSFNSQE 1319          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 177.948 bits (450), Expect = 4.556e-44
Identity = 158/498 (31.73%), Postives = 248/498 (49.80%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+  ++ P++ +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  ++      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  137 PTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLH-LMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLIGRDVVRP-----YQT----------MSNPMSKLTVLNSMHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGLIN-----ESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 584          

HSP 2 Score: 159.458 bits (402), Expect = 2.508e-38
Identity = 202/773 (26.13%), Postives = 362/773 (46.83%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIIS--YKEDESIPLGQTKSQDTQ--------QNQIVIENSKEDVEMGNRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQD-------LNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLK---RKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEIN---HQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDE 4640
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LGI++P   P I+S  +K  + +P   T++Q+            +   E  +ED+E+   ++L +SN  S  K        + + +   ++I  FY +P+++F + +++Y+ +L+LF+  +L K +     +E I+  +I TL +E++++   S           +  + WN  D  AI LF +G ILRL             +Q +R   +D   I    C+  ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A  +P                 N   +  +   I    Y+ ++GE   D    I P C   +       +   P K    + P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F  +  L PP II  H   I+  +    RK  ++++E+      F  +  ++LKK  +   +E     +Y R+              D R      F S       +  + V+N    +   EE+N   H +    + VD++L++L +L   IG  A  ++     L G++   +   +KI +     CT+   +   SS  S E
Sbjct:  615 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGILLP---PSILSLEFKNKDDMPY-MTQAQEIHLQEKEPEEPEKPTKEKDEEDMELT--AMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL------------QDQPFR---SDGRVI---YCV--NIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFP-----------------NEEPSWKLAKNIFYMPYWMIYGEVFADQ---IDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITD--DELKKVHD---FEEQCIEEYFRE-------------KDDR------FNSSNDERIRVTSERVEN---MSMRLEEVNEREHSMKASLQTVDIRLAQLEDL---IGRMATALER----LTGLERAES---NKIRSRTSSDCTDAAYIVRQSSFNSQE 1297          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 177.948 bits (450), Expect = 4.860e-44
Identity = 158/498 (31.73%), Postives = 248/498 (49.80%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+  ++ P++ +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  ++      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  137 PTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLH-LMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLIGRDVVRP-----YQT----------MSNPMSKLTVLNSMHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGLIN-----ESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 584          

HSP 2 Score: 159.073 bits (401), Expect = 2.788e-38
Identity = 202/773 (26.13%), Postives = 362/773 (46.83%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIIS--YKEDESIPLGQTKSQDTQ--------QNQIVIENSKEDVEMGNRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQD-------LNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLK---RKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEIN---HQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDE 4640
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LGI++P   P I+S  +K  + +P   T++Q+            +   E  +ED+E+   ++L +SN  S  K        + + +   ++I  FY +P+++F + +++Y+ +L+LF+  +L K +     +E I+  +I TL +E++++   S           +  + WN  D  AI LF +G ILRL             +Q +R   +D   I    C+  ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A  +P                 N   +  +   I    Y+ ++GE   D    I P C   +       +   P K    + P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F  +  L PP II  H   I+  +    RK  ++++E+      F  +  ++LKK  +   +E     +Y R+              D R      F S       +  + V+N    +   EE+N   H +    + VD++L++L +L   IG  A  ++     L G++   +   +KI +     CT+   +   SS  S E
Sbjct:  625 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGILLP---PSILSLEFKNKDDMPY-MTQAQEIHLQEKEPEEPEKPTKEKDEEDMELT--AMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL------------QDQPFR---SDGRVI---YCV--NIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFP-----------------NEEPSWKLAKNIFYMPYWMIYGEVFADQ---IDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITD--DELKKVHD---FEEQCIEEYFRE-------------KDDR------FNSSNDERIRVTSERVEN---MSMRLEEVNEREHSMKASLQTVDIRLAQLEDL---IGRMATALER----LTGLERAES---NKIRSRTSSDCTDAAYIVRQSSFNSQE 1307          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 177.948 bits (450), Expect = 4.995e-44
Identity = 158/498 (31.73%), Postives = 248/498 (49.80%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRL-LNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+  ++ P++ +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  ++      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  135 PTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLH-LMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLIGRDVVRP-----YQT----------MSNPMSKLTVLNSMHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGLIN-----ESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 582          

HSP 2 Score: 159.458 bits (402), Expect = 2.382e-38
Identity = 202/773 (26.13%), Postives = 362/773 (46.83%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIIS--YKEDESIPLGQTKSQDTQ--------QNQIVIENSKEDVEMGNRSILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQD-------LNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLK---RKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEIN---HQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDE 4640
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LGI++P   P I+S  +K  + +P   T++Q+            +   E  +ED+E+   ++L +SN  S  K        + + +   ++I  FY +P+++F + +++Y+ +L+LF+  +L K +     +E I+  +I TL +E++++   S           +  + WN  D  AI LF +G ILRL             +Q +R   +D   I    C+  ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A  +P                 N   +  +   I    Y+ ++GE   D    I P C   +       +   P K    + P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F  +  L PP II  H   I+  +    RK  ++++E+      F  +  ++LKK  +   +E     +Y R+              D R      F S       +  + V+N    +   EE+N   H +    + VD++L++L +L   IG  A  ++     L G++   +   +KI +     CT+   +   SS  S E
Sbjct:  613 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGILLP---PSILSLEFKNKDDMPY-MTQAQEIHLQEKEPEEPEKPTKEKDEEDMELT--AMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL------------QDQPFR---SDGRVI---YCV--NIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFP-----------------NEEPSWKLAKNIFYMPYWMIYGEVFADQ---IDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITD--DELKKVHD---FEEQCIEEYFRE-------------KDDR------FNSSNDERIRVTSERVEN---MSMRLEEVNEREHSMKASLQTVDIRLAQLEDL---IGRMATALER----LTGLERAES---NKIRSRTSSDCTDAAYIVRQSSFNSQE 1295          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:MGI Symbol;Acc:MGI:2675603])

HSP 1 Score: 175.252 bits (443), Expect = 7.722e-44
Identity = 165/553 (29.84%), Postives = 269/553 (48.64%), Query Frame = 3
Query:  264 LEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQ--SAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFK-KESVQLKQIVTELGYL---VSVFDM--EEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKN--VKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRK-RSTMTHSEKINSNNSYEKAFKSNLKATS 1883
            L  ++GH    +  EK       PT+ FG I F        +K++R    T   ++  ++  +W +  P LVIS+ GG  +F+   KLK    +GL KAAE+ G WIITEG+N G+ K  G+A++ ++ +    K+  +GI PW V+      +  L       +YQ+          +    +K  +L+  HS+F L  C   +  +   + + R   E  +S  K  T S +      VP+ GLV+ G    +  V+ ++ +NK PVVVC+G+  AAD+LA     F    LE+G            L   ++E LF +   + +F  ++S  L QI+ E       +++FD   EE  DLD  I+++LL   +          EQL + +  +R DIAK+ I    + WK G L   M +AL+ DR DFVKL +E G +L  FLT+  LE+LY  +    N   +    L  + K H L+ +  + L ++G VI+ L+G  Y   Y  K F+ L +   RK +S  + ++ ++ ++ +++    N K +S
Sbjct:   61 LSVTEGHGDEQWSVEK--HTVKSPTDTFGTINFQDGEHIHHSKYIRTSWDTKSDHLLHLMLKEWNMELPKLVISVHGGLQNFKISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALKAHS-SKSLRKIWTVGIPPWGVIEN----QRELVGKDVVCMYQT----------LGNPLSKLTTLNCMHSHFIL--CDDGTVGMYGNEEKLRRNLEKHLSMQKIHTCSRQG-----VPVVGLVMEGGPNVILWVWETV-KNKEPVVVCEGTGRAADLLA-----FTYKHLEDG----------GILRPQVKEELFCLIQNMFNFSLRQSKHLFQILMECMVHKDSITIFDADSEEHQDLDLAILTALLKGTS------LSISEQLNLAMAWDRMDIAKKHILTYGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELYNTKQGPTN---KFLRHLVQDVKQHTLLSSYRITLIDIGLVIEYLIGGAYRSSYTRKSFRILYNNLYRKHKSVSSFAQGLSQHSLHQRHSLRNRKESS 564          

HSP 2 Score: 70.4774 bits (171), Expect = 2.194e-11
Identity = 68/254 (26.77%), Postives = 113/254 (44.49%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXX------XXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKII------SYKEDESIPLGQTKSQDTQ----QNQIVIENSKE-------DVEMGNRSILNKSNTLSYSK-PQKFKRLKYFKRIKAFYFSPVIRFIY 3170
            P  +L++W++L+ +  MA  FW   +E    A+       A       +N  DD +  E+ K YS+ F   A  VL + + ++E  A  L+  ELK +  S+ + LA  G    F++H C Q  LT  W G L  + ++        L II+  ++P +I      S  E   +P    +SQD Q     +   + N+KE       D+E G     ++   L     PQ    L + +R+  FY +P ++F +
Sbjct:  613 PYNDLLVWAVLMKRQNMAMFFWQHGEEATVKAVIASILYRAMAREAKESNMVDDTS--EELKNYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSGGLRPFVSHSCTQMLLTDMWMGRLKMRKNSW-------LKIIISILLPPMILTLEFKSKAEMSHVP----QSQDFQFTWNYSDQGLSNTKESACVKDYDLERGPDEKPDEPLHLDLRNVPQS---LPWTRRVYEFYSAPFVKFWF 850          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.807e-50
Identity = 174/590 (29.49%), Postives = 293/590 (49.66%), Query Frame = 3
Query: 2472 LERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDD---FTD-KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGI-IMPFV--IP----------------------KIISYKEDES---IPLGQTKSQDTQQN----QIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXX--------XXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISF-----STYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            L  P  ++ +W++L  + ++A + W   +E +A AL+AS LL  +A+++ +    TD   D   +++ FE +A GVL+EC+ E+E  +Q L+ +EL +Y + + + LA   +S  F+AH  CQ  LT  W G ++       +L  + L + I P +  +P                      K+ S+KE      +P+ ++K +    N    ++  EN +ED ++ +  I       S     + K+L +  RI  FY +P  +F+ N V YL F+ L++  +L         K        EI+L FW+ T+L+EEI+Q       +     S YFSD WN +D  ++T+F+I  ILR  T                      +F  S+  +   + FF VR + IFS +  LGPKL+MI+KM+  DL  F+IIL+VF I YG+  +A  +P     +  +  + N+          I +++   Y+ M+GE  LD +QG  P    ++   V     R L+PL L ++++ TN+LL NLLIA+F  T+E ++  S   W +QRY ++ E+ ++    PP +++ H 
Sbjct:  576 LPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLED-YIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFT-------------------NSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFP-----SPGIYARNNTWVT-------ITSVVQYPYWQMYGELFLDEIQGEKP----KEFGEVDPD-GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHI 1127          

HSP 2 Score: 187.193 bits (474), Expect = 5.122e-46
Identity = 157/481 (32.64%), Postives = 240/481 (49.90%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLN--QSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMV-AIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF--DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            PTNA+GEI+F G    + A ++R+ + T    + T++  +W L  P LVIS+ GG   F  K +L+ + ++GL KAA++ G WIIT G N G+MK  GEAV++    +G +  V  IGIA W +V K   L  S   G YPA+Y S E +  +   M         LD NHS+FFL D     K   E  +  RSR E +I   K +T S   +    VP+  LV+ G   T+  ++  +I+ K P VV  GS  AA V+  A +   K +++  +    I  ++ + E  +R  + ++    K   K    +K ++ E   ++SV+  D E   D+D  I+ +LL +  S                   R D+AK  IF E ++W    L+  M  AL+ D+ +F +LFL+ G S+ EFL++ IL KLY +   N   +      L       R VK + +  VG+VI+ L+GD +   Y
Sbjct:   91 PTNAYGEIDFEGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDL-ISEKNGKYPALY-SMEPTPGHQGAM---------LDPNHSHFFLVDDGTEGKYGVE--IGMRSRIEEAIM--KVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYE-LIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQT----INVIDPQYEDEVRAKVVEVFGA-KGADKTYSMIKDVL-EDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWN------RIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIK-----PLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYY 538          

HSP 3 Score: 97.8265 bits (242), Expect = 6.296e-20
Identity = 78/241 (32.37%), Postives = 130/241 (53.94%), Query Frame = 3
Query: 4923 YPG---MRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDS---YNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERA--NRYGIPWFLVDHNSGCELNECSNKTAITFLDQRL-QASYSGKKYEFLRKKI--VAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            YPG    R  V +NMV WQ+P+ DY   + +  ++L  N    D D   +       YN+ D+T  + R S  G Y +      P NP GRTG++GRGLL  +GPNH+   + TRW RT++G  + +  K++++++A++R   N++ IP  +V+          +      F ++ + + + S ++ E + K+I  +     +I+KG++DD  N DNAW+ETV +NFH+     F D  L+
Sbjct: 1282 YPGSTAKRFAVQDNMVDWQVPFPDYKPVNYTAPVVL-ANPVWADKDLMAMSPRPELPYNQMDHTCNVNRVSYNGTYVVK--DGLPLNPMGRTGMQGRGLLGRFGPNHAADPVVTRWKRTSAGVML-QGGKKVLEFVAIQRKDNNQWAIPGGMVEPG-----QLVTQALKAEFGEEAMAKLNVSQEEKERIAKQIERLFQQGQEIYKGYVDDPRNTDNAWMETVAVNFHDDKGDLFGDITLQ 1513          

HSP 4 Score: 24.2534 bits (51), Expect = 6.296e-20
Identity = 10/31 (32.26%), Postives = 19/31 (61.29%), Query Frame = 2
Query: 5633 VKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            V+W  ++ ++ L  SH  IL+ +++  DA F
Sbjct: 1521 VRWQRVSGNIPLYASHVSILEKVAKMRDAAF 1551          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 2.149e-48
Identity = 160/536 (29.85%), Postives = 263/536 (49.07%), Query Frame = 3
Query:  246 EGIAQILEESKGHLSTNFDPE--------KIRKNYTLPTNAFGEIEFTGLNQ-SAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGG--NKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKI-NPEIKDFKK----ESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXX-XRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTV-YILEKLYTDQ-----LKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ 1772
            EGI +       H      PE        K R     PT+AFG+I F GL Q + K+VR+ + T   N+  ++  +W+L  P L+IS+ GG  +F  K  LK   ++GL K A++ G WI+T G + G+MK  G AVRDYT + G    ++V IG+APW V+     L +   +G +PA Y  +E+ +           +   LD NH++F L D    ++     +++ R+R E  IS    + S     +   +P+  +V+ G   TL  ++NS++ N  P VV +GS   ADV+A                    VP+     ++I   L +    E K+F +    E  +  Q +  + +L++VF ++ED  +D+D  I+ +LL ++ SD    +   E+        NR DIA+ +IF E  +W   DL+  MF+AL+ D+ +FV+L LE G  + EFL     L +LY+       L+ L  R++   ++    +     + V L  V + ++ L+G F  PLY++  ++
Sbjct:   58 EGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHP--EGRFPAYYSLDEQGQ----------GRLSCLDINHTHFLLVD--DGTQGHYGVEIELRARLEKLIS----KLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSML-NHTPCVVLEGSGRLADVIA----------------HVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQ-GGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYK 557          

HSP 2 Score: 165.622 bits (418), Expect = 2.028e-39
Identity = 159/560 (28.39%), Postives = 272/560 (48.57%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ--ATFSGISF----STYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF--------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            P R+L +W+++    ++AE+ W   ++ IA AL AS +L  LA +S  DD  +  +    + H+E QA GV +EC+  D +RAQ L+ +    +G+S+ + LA +     F+AH   Q  LT  W G LS  N    +L  +   I  P +    ++++ DE I   Q +++ T+Q ++ +E+    V  G      K +   +S+  + K L    R+ +F  SP ++F +N  SY  FL LF+  L+  F+      E++L  W+ +L+ EEI+Q    F G  F      Y  D WN LD  +I LF+ G I RL                     +D++F   +  +      F +R+M IFS    LGPK+I++R+M+ +    FM +LS++++ YGV                +L +   + N      +I   + + Y  +FG F               +++   + P C   + +  P      L  + L +++L  N+LL NLLIA+F  T++E++ ++   W +QRY++I E+ ++  L PPFI++ H 
Sbjct:  590 PGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCM---IFFPLIYTGFLTFRRDEDI---QRQAERTEQQKLAMES----VFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQA-------------------SDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFF-FMFLLSIWVVAYGVA------------KQGILIENEERLNW-----IIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPV-FPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHL 1101          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|O94759|TRPM2_HUMAN (Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 7.782e-46
Identity = 166/517 (32.11%), Postives = 262/517 (50.68%), Query Frame = 3
Query:  267 EESKGHL--STNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAK-FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYT--DAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLA----LAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAAS-DXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLW-------DNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            E +K H    T +DP+K  +   +PT+AFG+I FTGL+Q  K +VR+   TP   I  ++   W L  P L+IS+ GG  +F  K +LK I ++GL K A++ G WIIT G + G+MK  GEAVRD++   +Y   +++ IG+A W  V + + L +    G++PA Y  +E+ + N             LD+NHS+F L D     +   E  +  R+R E  IS    + +        ++PI  +V+ G   TL  + N+   N  P VV +GS   ADV+A    L +       +++    F     E   ES I E   KI        ++ V+ +Q++T       VF   +D   D+D  I+ +LL ++ S D   ++    QL++ +  NR DIA+ +IF++  +WK  DL+  M  AL+S++ +FVKLFLE G  L+EF+T   L  LY    +NL+       +L        +          +++  V +V++ L+GDF  PLY
Sbjct:  101 EATKPHTFQGTQWDPKKHVQE--MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHP--TGSFPAEYILDEDGQGN----------LTCLDSNHSHFILVDDGTHGQYGVE--IPLRTRLEKFIS----EQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATT-NGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKI--------QDIVRRRQLLT-------VFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLY----ENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLY 577          

HSP 2 Score: 147.902 bits (372), Expect = 4.599e-34
Identity = 164/632 (25.95%), Postives = 272/632 (43.04%), Query Frame = 3
Query: 2286 AIRRISSLDFHEIDRMLHAKSKSTLYSETSEND----LLKYQNENLGNIIQTNFDELDDRKLKEISLER-PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGII-MPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF----SGI--SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEF-----------------GLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            A  R+      ++ R L       LY     ND    LL   +  L N+   +   L  R    ++    P R+L+IW+++  + ++A + WA  ++ IA AL  S +L  L+ + +D    E+    ++ +E +A GV  ECY +DE+RAQ L+ +  + +G+++ + LA + + +KF++H   Q FLT  W+G LS  N     L  V L ++  P ++  +IS++E     +G   ++        +             ++   N LSY     F  L  F  +    F PV  +                           CE  I   W+ +L+ EE++Q  +     G+    + YFSD WNKLD  AI LFV G   RLI    Y           R+IL+                 F +R+M+IF+    LGPK+I++++M+  D+  F+ +L+V+++ +GV   A                     N    D +    +  SY  +FG+                  G D  +   P C   D           L  L L L++L TN+LL NLLIAMF  T+++++  +   W +QR+ +I E+  +    PPFI++ H 
Sbjct:  552 AAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKL-NVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNG----LWRVTLCMLAFPLLLTGLISFREKRLQDVGTPAARARAFFTAPV-------------VVFHLNILSY-----FAFLCLFAYVLMVDFQPVPSW---------------------------CECAIY-LWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPG---------RVILS------------LDFILFCLRLMHIFTISKTLGPKIIIVKRMM-KDVFFFLFLLAVWVVSFGVAKQAILI-----------------HNERRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYK---PKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHL 1090          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q9BX84|TRPM6_HUMAN (Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 7.697e-45
Identity = 174/573 (30.37%), Postives = 271/573 (47.29%), Query Frame = 3
Query:  213 RGLGGANHGEFEGI--AQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY---LVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKN--VKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATS 1883
            R   G   G+  GI  +  +  +KG  S  +  EK       PT+ FG I F     +  AK++R    T   ++  ++  +W++  P LVIS+ GG  +F    K K I  +GL KAAE+ G WIITEG+N G+ K  G+A++ ++ ++   K+  +GI PW V+      +  L       +YQ      T D+ +    +K  +L++ HS+F L D     K  +E  ++ R   E  +S  K    S +      VP+ GLVV G    +  V+ ++ ++K PVVVC+G+  AAD+LA        F  +  ++E  + P       +  E +  I        K+S  L QI+ E       +++FD   EE  DLD  I+++LL   N +AS+     +  +         R DIAK+ I +  + WK   L   M +AL+ DR DFVKL +E G +L  FLT+  LE+LY  +    N+   + H L  + K H L+    + L ++G V++ L+G  Y   Y  K F+ L +   RK     HS   N N S E    S    T+
Sbjct:   51 RCYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEK--HTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHS-SHSLRKIWTVGIPPWGVIEN----QRDLIGKDVVCLYQ------TLDNPL----SKLTTLNSMHSHFILSDDGTVGKYGNE--MKLRRNLEKYLSLQKIHCRSRQG-----VPVVGLVVEGGPNVILSVWETV-KDKDPVVVCEGTGRAADLLA--------FTHKHLADEGMLRP------QVKEEIICMIQNTFNFSLKQSKHLFQILMECMVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWD---------RVDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNT---LLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSG-NRNESAESTLHSQFIRTA 571          

HSP 2 Score: 120.553 bits (301), Expect = 1.033e-25
Identity = 139/555 (25.05%), Postives = 258/555 (46.49%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS------DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQT-KSQDTQ-------QNQIVIENSKE-------DVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGIS--PSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNK 4055
            P  +L++W++L+ + +MA  FW   +E    A++A +L  ++A+++      DD +  E+ K YSK F   A  +L + + ++E+ A  L+  EL+ +  S+ + LA  G    F++H C Q  LT  W G L   KNS + ++ S    II+P   P I++ +      +    +SQD Q       QN     +SKE       D+E G+   L+++    +      + L + +++  FY +P+++F + +++YL FL+LF+  +L + + +   +E +++ +I T  +E +++   S           + S+ WN  ++ AI LF  GF+LR                       D  F  +   + C  + F++ R++  F+ +   GP + MI KM +N +   +II+++ ++ +GV   A   P           KE   +      S+   I+ + Y+ ++GE     +   S  PSC               L P    +++ +  +++ NLLIA F   Y ++ES S   W Y RY+ I  +  K
Sbjct:  607 PYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDAS--EELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIIS----IILP---PTILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNA---SSSKESASVKEYDLERGHDEKLDENQ--HFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLR---------------------WGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTAN-MFYIVIIMAIVLLSFGVARKAILSP-----------KEPPSW------SLARDIVFEPYWMIYGEVYAGEIDVCSSQPSCPPGSF----------LTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEK 1098          
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Match: sp|Q9NZQ8|TRPM5_HUMAN (Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 8.851e-45
Identity = 172/640 (26.88%), Postives = 299/640 (46.72%), Query Frame = 3
Query: 2475 ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLG-----QTKSQDTQQNQI---------VIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF-------VCEEIILTFWIGTLLLEEIKQATFSG------ISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSS-----QDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKK--ERELVKWEHMKAMDYLRKLNEPTQKSRQTRG 4292
            E P R+L +W++L  + +MA  FWAM +E +A AL A  +L  +++       +    T    +E  A  + +ECY   E RA  L+ +  + + +++ + LA +  +  F AH   Q FLT  W+G++++    + LL +    +    V   +I++ E+  +  G        S DT+++ +         ++E  +   + G R++                      R + F+ +PV  F+ N V Y  FL LF+  LL    V+F          E+ L FW+ TL+LEEI+Q  F+         F+ Y  D WNK D  AI LF++G   R++                      S F   +T +      F +R+++IF+ H  LGPK+I++ +M+  D+  F+  LSV+++ YGVT  A  +P                 +    + +   +L + Y  +FG+  LD +     +CS+     +D    P+  +  L  L L   +L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+  +  L PPFI++ H     SL  R++F  E E K        +   DL    ++++V WE ++  ++L K+    ++ R + G
Sbjct:  515 ENPWRDLFLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMSHLET--EAEAARATREAKYERLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAF---LCPALVYTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVF------------------LLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL----VDFRPPPQGPSGPEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLP---------------------SAFEAGRTVLAMDFMVFTLRLIHIFAIHKQLGPKIIVVERMM-KDVFFFLFFLSVWLVAYGVTTQALLHP-----------------HDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL----SLTLRRVFKKEAEHKRE------HLERDLPDPLDQKVVTWETVQKENFLSKME---KRRRDSEG 1075          

HSP 2 Score: 154.066 bits (388), Expect = 5.009e-36
Identity = 135/431 (31.32%), Postives = 221/431 (51.28%), Query Frame = 3
Query:  348 GEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGD--FEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDC--PASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESV----QLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
            GE+ F G  +   KFVR+ +      +  +L  +W L  P LV+S+ G +  F  K  L+ +++KGL KAA+S G WI+T  L +G+ +  G+AVRD++ A    K+  VA+G+A    V    +LE +  Q  +P  Y         DDG    +    SLD+N S+F L +   P     ++E     R R E  IS    Q + Y  +    +P+  L+V GD  TL ++ +  +E   P ++  GS G ADVLA  ++           +   +VP  A       E  FK     K F  E +    +L Q +T   +L++V+D E++   +LD  I+ +L+ +  S   + Q  L++L++ +  +R DIAK +IF  + +WK  DL + M +AL+S++ +FV+LF++ G  + +FLT   L++LY
Sbjct:   26 GEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEA--QEDFPVHY-------PEDDG--GSQGPLCSLDSNLSHFILVEPGPPGKGDGLTE----LRLRLEKHIS---EQRAGYGGTGSIEIPVLCLLVNGDPNTLERI-SRAVEQAAPWLILVGSGGIADVLAALVN-----------QPHLLVPKVA-------EKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELY 419          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A267GS13 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004938g2 PE=4 SV=1)

HSP 1 Score: 1033.09 bits (2670), Expect = 0.000e+0
Identity = 659/1467 (44.92%), Postives = 902/1467 (61.49%), Query Frame = 3
Query:  327 TLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAG---------CWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGM----VKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAF---------QKFDLEEGSEEFEIVPLEARLESIIRECLFKINPE-IKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ-NLVSKTDRKRSTMTH-----SEKINSNNSYEKAFKSNLKATSFNEYK--MLVFXXXXXXXXXXXXXYIDQMDIDATDRKTNCDDRQNHSYEN-----NGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNXXXXXXLDMINILGQNR-ENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQN----ENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYK-EDESIP--LGQTKSQDTQQNQIVIENSKEDVEMGNRSI--LNKSNTLSYSKPQKFKRL-KYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLN-QQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMT-----ILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSN-SDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLN-ELESQIGSFAENIKEIGISLVGVKTMNNELLS 4562
             LPTNAFGEIEF+G+ Q AKFVRL ++TPE  +  +L  KWE+  PTLVI+IFGGDFEKKR+LKMI KKGLWKAAESAG         CWI+T G N+GIMKL GEAVRDYTDAYG N M AIGIA W  +A+ + LEN  Y+G++PA YQSE+        +    +    +E  LD NH++FFL D   + ++    D QFR+RF H I  W+      E + + +VP+CGL++GGD   L Q+F ++ +N+CP++  +G+ GAADV+A+A D++          K +LE  ++E +   L A+L  I +E  F  +PE   D+ +E   L  I+ +   L+ +FDMEED+DLDG +I+SLL+SA SD   +QLNL+QL+I LTLNRADIA++KIFLENKKWKKG+LN++M+ ALM DRHDFVKLFLEQGFSLE+FLTVYILEKLYTDQLK LNS++ IF +LW+ +++HR  K VKLREVGKVIK+LVGDFY PLY  K+F+ NL +     +    H       K  S N       S L+    +E++  +      +  +       +++M I   +R       ++H+ +      N + SD+N      FS I+ ++       D+ F  K     +  LD+  +   +   +F G + +  S          K+  NF     RR SSL+F E  R   + S        +   +   Q+    E  G   +   +E  + KLK I+LERPAREL+IWSLLVGKLQMAELFW MEKE +A ALL+SM+L ++  ++DDFTDKED++     FE  A GVL++CY EDE+RA LLIN+ELK+YG SS I LAA+G+SIKFMAHPCCQDFLTSTW G LS+KNS       +  GI+ P+++P ++ YK  D  I   + + + Q T       E++  D E G  +    ++ + LS+ +        +  +R+K FY +PV+RF+YN+ SYLTFL +FS  LLF  K +F   E I+  WI TLLLEE+KQAT SGISFSTY SD WNKLD TA+ LFV+G +LRLI+      E   L+   Y +ILTD LF+ ++ C   SLF F +R+MYIFSFHIALGPKLIMI KM+ NDL+PFM+IL VF++GYGV   + AYP G           N  FN +S   M  T      L ++Y+ MFG+FGLDS+Q     C   D    P   ++ L P+ LG++VLLTN+L+FNLLIAMF+ TYE I   S  +WNYQRY MI E++ +SPL PP II WH YE+   ++ +    +  K S   DP  I++ +++KKERELVKWEHMKAMD+LR+  E   K  +   +D +S++ R  G    A   L+P A D     +  T  I  +L+K+FK VD +L+K++ + + ++   +  +    +++  ++     L S
Sbjct:   48 ALPTNAFGEIEFSGMKQLAKFVRLDSNTPEEALHELLVKKWEMSRPTLVINIFGGDFEKKRQLKMIFKKGLWKAAESAGRDKSNTQGGCWIVTGGFNVGIMKLTGEAVRDYTDAYGSNHMNAIGIASWGCIARREALENHNYEGSFPASYQSEDSDSGRPQDLQPASIAQDEEELPLDPNHTHFFLVDTGFNRRKGR--DCQFRTRFAHVIGTWRD-----EENREVKVPMCGLLIGGDRFNLEQIFYALTDNRCPIMAIKGTGGAADVVAVAFDSYFQEVASPDNPKKELE--TDEEKQARLSAKLAGICQE--FFNSPEGFCDYSREVEMLHTIMAQHTSLIEIFDMEEDFDLDGKMIASLLSSAGSDTNPDQLNLKQLKICLTLNRADIARDKIFLENKKWKKGNLNEFMYQALMEDRHDFVKLFLEQGFSLEDFLTVYILEKLYTDQLKRLNSKVAIFLQLWEYYRSHRSSKQVKLREVGKVIKVLVGDFYQPLYTKKDFEGNLANPAVSGKQKPGHFPLPGHRKDKSGNGS----GSFLQQPQQSEHRQSLQQQQQQQQPQHPGPSPGLEEMAICDYERSPVNFSGKDHARKRDLAIANKISSDSNV---TAFSGIMFMDEE-----DQSFDTKGMGFANPMLDLAGVESPSSVADFNGASRDGSSG-------TKKVKSNFFRLKRRR-SSLEFMEAVRAPASGSSGHSGKGANSQQMGSKQHLRQQELSGAAAKATKEE--ESKLKTINLERPARELLIWSLLVGKLQMAELFWTMEKEPVAAALLSSMILKAMVGRTDDFTDKEDFQRGGAQFEDHAWGVLDQCYREDERRALLLINRELKFYGDSSCIYLAAEGESIKFMAHPCCQDFLTSTWMGRLSAKNSMTRFSIGILCGIVCPWLVPSVMLYKLTDREIERQVAEQQQQKTPSLTARSEDAAADPESGGPTYEGGDRKSLLSHIRQASVLNCGQTCQRMKEFYMAPVVRFVYNTFSYLTFLFMFSYLLLFDLKHDFTVMEYIVISWIVTLLLEEVKQATLSGISFSTYISDSWNKLDCTAVGLFVLGLVLRLISLLSESPETVLLSGHAYDVILTDGLFVAARICYAFSLFAFCIRLMYIFSFHIALGPKLIMIGKMVINDLVPFMVILLVFILGYGVAAQSIAYPTG-------FYTPNQDFNKTSPKKMTHTEIFIHFLTRAYFQMFGDFGLDSIQAEDSGC--LDEGKCPHWTAKWLLPIMLGVYVLLTNILMFNLLIAMFSSTYESINQFSALHWNYQRYSMIKEYIERSPLAPPLIIFWHAYELVFFIQLRY---QGRKLSELEDPLRISYKDNVKKERELVKWEHMKAMDFLRQDQECHGK--KGGRSDSKSVIVRTSGPQLGA-GGLLPAAADVAKQMSDATSGIGMELEKKFKSVDTQLTKISTDFDQRLTDLSNTLNGFSVAVQALREGQERLAS 1466          

HSP 2 Score: 254.603 bits (649), Expect = 7.854e-69
Identity = 127/274 (46.35%), Postives = 180/274 (65.69%), Query Frame = 3
Query: 4830 PNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQ-------------ASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            P V++  TGRLIE     HRLWRY PFNFE YPGMRM VP + + W+I Y+DY AFDAS+E+L++PN++ FD     +   ++N+ D+ + L+RQSM+G+Y LD ++ AP NP GRTGLKG+GLLP WGPN+++++  TRW+R  SG+ IHR    ++Q ++L R  ++ +PWFL DH   C+ ++C       F+ +RL+             A   G+  + LR  +       IFKG++DDHLNADNAW+E VVIN HESD + F+D +LK
Sbjct: 1644 PVVDDPGTGRLIEYRSLQHRLWRYVPFNFEQYPGMRMNVPPDKIPWEIDYRDYFAFDASEEVLIFPNEESFDGPTVPLQSINFNQLDSRSGLRRQSMMGRYRLDTVSSAPLNPMGRTGLKGKGLLPRWGPNNAVVIAMTRWSRAPSGAVIHRLGHPILQVLSLFRHKQFCLPWFLTDHFDNCDYDDCVPALLKNFISRRLKQLLQKKDARQEINAIMKGRAEQALRNSMSDV----IFKGYMDDHLNADNAWIEAVVINVHESDNWKFSDAMLK 1913          

HSP 3 Score: 39.2762 bits (90), Expect = 7.854e-69
Identity = 16/38 (42.11%), Postives = 27/38 (71.05%), Query Frame = 2
Query: 5612 EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            E++S E  +WM++A+S  +R+SH  +LKTI+    A+F
Sbjct: 1917 EVDSDEQARWMEVAYSTAMRSSHCEMLKTIASNHRAYF 1954          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A267EZB1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004938g1 PE=4 SV=1)

HSP 1 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 658/1467 (44.85%), Postives = 902/1467 (61.49%), Query Frame = 3
Query:  327 TLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAG---------CWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGM----VKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAF---------QKFDLEEGSEEFEIVPLEARLESIIRECLFKINPE-IKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ-NLVSKTDRKRSTMTH-----SEKINSNNSYEKAFKSNLKATSFNEYKMLVFXXXXXXXXXXXXXY--IDQMDIDATDRKTNCDDRQNHSYEN-----NGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNXXXXXXLDMINILGQNR-ENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQN----ENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYK-EDESI--PLGQTKSQDTQQNQIVIENSKEDVEMGNRSI--LNKSNTLSYSKPQKFKRL-KYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLN-QQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMT-----ILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSN-SDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLN-ELESQIGSFAENIKEIGISLVGVKTMNNELLS 4562
             LPTNAFGEIEF+G+ Q AKFVRL ++TPE  +  +L  KWE+  PTLVI+IFGGDFEKKR+LKMI KKGLWKAAESAG         CWI+T G N+GIMKL GEAVRDYTDAYG N M AIGIA W  +A+ + LEN  Y+G++PA YQSE+        +    +    +E  LD NH++FFL D   + ++    D QFR+RF H I  W+      E + + +VP+CGL++GGD   L Q+F ++ +N+CP++  +G+ GAADV+A+A D++          K +LE  ++E +   L A+L  I +E  F  +PE   D+ +E   L  I+++   L+ +FDMEED+DLDG +I+SLL+SA SD   +QLNL+QL+I LTLNRADIA++KIFLENKKWKKG+LN++M+ ALM DRHDFVKLFLEQGFSLE+FLTVYILEKLYTDQLK LNS++ IF +LW+ +++HR  K VKLREVGKVIK+LVGDFY PLY  K+F+ NL +     +    H       K  S N       S L+    +E++  +    +            +++M I   +R       ++H+ +      N + S++N      FS I+ ++       D+ F  K+    +  LD+  +   +   +F G + +  S          K+  NF     RR SSL+F E  R   + S        +   +   Q+    E  G   +   +E  + KLK I+LERPAREL+IWSLLVGKLQMAELFW MEKE +A ALL+SM+L ++  ++DDFTDKED++     FE  A GVL++CY EDE RA LLIN+ELK+YG SS I LAA+G+SIKFMAHPCCQDFLTSTW G LS+KNS       +  GI+ P+++P ++ YK  D  I   + + + Q T       E++  D E G  +    ++ + LS+ +        +  +R+K FY +PV+RF+YN+ SYLTFL +FS  LLF  K +F   E I+  WI TLLLEE+KQAT SGISFSTY SD WNKLD TA+ LFV+G +LRLI+      E   L+   Y +ILTD LF+ ++ C   SLF F +R+MYIFSFHIALGPKLIMI KM+ NDL+PFM+IL VF++GYGV   + AYP G           N  FN +S   M  T      L ++Y+ MFG+FGLDS+Q     C   D    P   ++ L P+ LG++VLLTN+L+FNLLIAMF+ TYE I   S  +WNYQRY MI E++ +SPL PP II WH YE+   ++ +    +  K S   DP  I++ +++KKERELVKWEHMKAMD+LR+  E   K  +   +D +S++ R  G    A   L+P A D     +  T  I  +L+K+FK VD +L+K++ + + ++   +  +    +++  ++     L S
Sbjct:   47 ALPTNAFGEIEFSGMKQLAKFVRLDSNTPEEALHELLVKKWEMSRPTLVINIFGGDFEKKRQLKMIFKKGLWKAAESAGRDKSNTQGGCWIVTGGFNVGIMKLTGEAVRDYTDAYGSNHMNAIGIASWGCIARREALENHNYEGSFPASYQSEDSDSGRPQDLQPASIAQDEEELPLDPNHTHFFLVDTGFNRRKGR--DCQFRTRFAHVIGTWRD-----EENREVKVPMCGLLIGGDRFNLEQIFYALTDNRCPIMAIKGTGGAADVVAVAFDSYFQEVASPDNPKKELE--TDEEKQARLSAKLAGICQE--FFNSPEGFCDYSREVEMLHTIMSQHTSLIEIFDMEEDFDLDGKMIASLLSSAGSDTNPDQLNLKQLKICLTLNRADIARDKIFLENKKWKKGNLNEFMYQALMEDRHDFVKLFLEQGFSLEDFLTVYILEKLYTDQLKRLNSKVAIFLQLWEYYRSHRSSKQVKLREVGKVIKVLVGDFYQPLYTKKDFEGNLANPAVSGKQKPGHFPLPGHRKDKSGNGS----GSFLQQPQQSEHRQSLQQQQQQQPPQHPGPSPGLEEMAICDYERSPVNFSGKDHARKRDLAIANKISSESNV---TAFSGIMFMDEE-----DQSFDTKRMGFANPMLDLAGVESPSSVADFNGASRDGSSG-------TKKVKSNFFRLKRRR-SSLEFMEAVRAPASGSSGHSGKGANSQQMGSKQHLRQQELSGAAAKATKEE--ESKLKTINLERPARELLIWSLLVGKLQMAELFWTMEKEPVAAALLSSMILKAMVGRTDDFTDKEDFQRGGAQFEDHAWGVLDQCYREDESRALLLINRELKFYGDSSCIYLAAEGESIKFMAHPCCQDFLTSTWMGRLSAKNSMTRFSIGILCGIVCPWLVPSVMLYKLTDREIERQVAEQQQQKTPSLTARSEDAAADPESGGPTYEGGDRKSLLSHIRQASVLNCGQTCQRMKEFYMAPVVRFVYNTFSYLTFLFMFSYLLLFDLKHDFTVMEYIVISWIVTLLLEEVKQATLSGISFSTYISDSWNKLDCTAVGLFVLGLVLRLISLLSESPETVLLSGHAYDVILTDGLFVAARICYAFSLFAFCIRLMYIFSFHIALGPKLIMIGKMVINDLVPFMVILLVFILGYGVAAQSIAYPTG-------FYTPNQDFNKTSPKKMTHTEIFIHFLTRAYFQMFGDFGLDSIQAEDSGC--LDEGKCPHWTAKWLLPIMLGVYVLLTNILMFNLLIAMFSSTYESINQFSALHWNYQRYSMIKEYIERSPLAPPLIIFWHAYELVFFIQLRY---QGRKLSELEDPLRISYKDNVKKERELVKWEHMKAMDFLRQDQECHGK--KGGRSDSKSVIVRTSGPQLGA-GGLLPAAADVAKQMSDATSGIGMELEKKFKSVDTQLTKISTDFDQRLTDLSNTLNGFSVAVQALREGQERLAS 1465          

HSP 2 Score: 199.519 bits (506), Expect = 2.538e-47
Identity = 93/187 (49.73%), Postives = 134/187 (71.66%), Query Frame = 3
Query: 4830 PNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNEC 5390
            P V++  TGRLIE     HRLWRY PFNFE YPGMRM VP + + W+I Y+DY AFDAS+E+L++PN++ FD     +   ++N+ D+ + L+RQSM+G+Y LD ++ AP NP GRTGLKG+GLLP WGPN+++++  TRW+R  SG+ IHR    ++Q ++L R  ++ +PWFL DH   C+ ++C
Sbjct: 1643 PVVDDPGTGRLIEYRSLQHRLWRYVPFNFEQYPGMRMNVPPDKIPWEIDYRDYFAFDASEEVLIFPNEESFDGPTVPLQSINFNQLDSRSGLRRQSMMGRYRLDTVSSAPLNPMGRTGLKGKGLLPRWGPNNAVVIAMTRWSRAPSGAVIHRLGHPILQVLSLFRHKQFCLPWFLTDHFDNCDYDDC 1829          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A183A5N4 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2269 PE=4 SV=1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 534/1093 (48.86%), Postives = 714/1093 (65.32%), Query Frame = 3
Query: 2445 DDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTK--SQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNE--LSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSST----DSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRG-ADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCT----ETVKVHGGSSRESDEEI---TKLELAVRSAILALRSELQ------------------PLMSDFSIPRKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNR-TNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHE--SDKFHFTDDILK 5612
            D+ + K I L+RPAREL+IWS+LVGKL+MAELFW MEKE IAGALLAS+LLTSL NK+DDFTDKEDY++++K+F+ +AEGVLNECY EDE R QL+IN EL YYG+SSVI LAA+GQSIKFMAHPCCQDFLT+TW GNLS+KNS       +  G+ MPF+IPKII  K  ++ P+G+ +  +   +      E       +G  SI  +S   S+    +    +YF++I+ FY +PVIRF+YN++SY+TFL LFS  LL  FK+E    E I+  W+ TL +EEIKQA  SGISFSTY SDGWNKLD   + LF++GFILRLI   +  N+  L  ++++Y  ILTD     S+TC+  SLF FY R+MY FSFHIALGPKLIMI KM++NDLIPFMIIL+V M+GY V   + AYP GL       TKEN    T +       +I  +   SY+ MFG+F LD+LQG    C +Q     PTK +R L P+ LG +VLLTN+L+FNLLIAMF+KTYEEIES+S YYWNYQRYQMI+++V++SPLVPP II WHFYE Y  +  +  +  + +    +PFC+ F+ D+KKERE+VKWEHMKAMDYLR   EP+ K+   RG A+ R++VFR     G          +D K + +S+TE I  +L+KRFKE+D +  + N+++S++    + +  +   +  V      ++ +I  +P CQC     E +    G +  +  E+   TKLE+AV+SA+ A +  L+                  P++    IP  E + S  +E            GD   DPFT P+V +  TGR+IER++N HRLWR  PFNFE YPGMRM VP   ++W   Y DY A+DA +E+LL+PN++  D +N  +   ++N+YD   KL+RQS+LG+Y LDP T AP NP GRTGL G+GLLP WGPNHSI++  TRW+R   +G+ I R N+ ++QYIALER  R  IPW+L DH++ C+ + C  K   +F+ +R +A+   ++ + L KK+  A  TQIFKG+LDD LNAD+AW ETVVIN HE  S   +  D  LK
Sbjct: 1128 DEEQTKAIQLDRPARELLIWSILVGKLRMAELFWTMEKEPIAGALLASILLTSLGNKTDDFTDKEDYRSFAKNFQERAEGVLNECYREDEHRTQLIINHELTYYGRSSVIKLAAEGQSIKFMAHPCCQDFLTNTWSGNLSTKNSVFRYFLGIICGLTMPFLIPKIILAKP-KAQPVGEEEEATGHPETAPATTEEPSTTTLLGGGSIGKQSLRKSFHASTR----EYFQQIRDFYMAPVIRFVYNTISYVTFLALFSYLLLVDFKIEISVVEYIVIAWVITLFIEEIKQAVLSGISFSTYISDGWNKLDCAGLGLFIVGFILRLIVLVRTGNDQPLDSVHERY-YILTDPFLDVSRTCLAISLFVFYTRLMYTFSFHIALGPKLIMIGKMVTNDLIPFMIILTVIMVGYAVAAQSIAYPNGL------YTKENMTLGTDTKHMGFSDIIFAMYTTSYFQMFGDFSLDTLQGEDRMCQNQ---MCPTKTARWLVPIMLGFYVLLTNILMFNLLIAMFSKTYEEIESASTYYWNYQRYQMINDYVHRSPLVPPIIIFWHFYEAYRAIGNRCASLRSHENIKHNPFCVRFT-DIKKEREMVKWEHMKAMDYLR---EPSTKASGKRGVAESRAVVFR-----GGGAGPGQGPVMDLKSEMSSVTEGIGMELEKRFKEIDSQFQRFNDVDSRLNDVTQMLSNLSEVVRSVTETQQRIIKQISELPTCQCNELSDEVIPAAPGETGTASREVRKRTKLEIAVQSALEAAKDVLRPPTPPPPPPPPPPPPRESPVLLAAPIPGSEDDSSGSEE-----------GGDPKSDPFTVPDVTDNRTGRVIERVINAHRLWRIAPFNFEKYPGMRMNVPPEKMAWTTEYPDYFAYDACEEVLLFPNEEAHDGENEKLRSMNFNQYDPKAKLRRQSLLGRYRLDPTTGAPLNPMGRTGLLGKGLLPRWGPNHSIVVCITRWSRDARTGNQITRSNRSVLQYIALERNKRLCIPWYLTDHSNQCDFDVCVPKLISSFITRRARANLPERRVDRLLKKLDKADVTQIFKGYLDDQLNADSAWTETVVINIHEGGSKGAYLNDTFLK 2185          

HSP 2 Score: 318.161 bits (814), Expect = 1.609e-83
Identity = 175/267 (65.54%), Postives = 206/267 (77.15%), Query Frame = 3
Query:  972 VPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ 1772
            VP+CGLVVGGD  TLRQV+ S+I+N+CP+VV +G+SGAADV+A  +DA  K   EE  ++ E VPLE R+ESII E L  ++P+  ++ +E   L +I+ +   LVSVFDMEED DLDGY+ISSLL SA S +  +Q+NLEQLEITLTLNRADIA+EKIFLENKKWKKG LNDYM++ALMSDRHDFVKLFLEQGFSLEEFLTVY+LEKLYTDQLKNL S                    V LR+VGKVIK LVGDFYHPLYLSKEFQ
Sbjct:  398 VPMCGLVVGGDRFTLRQVYCSMIQNRCPIVVTKGTSGAADVIAFGLDAANKMATEEAVDDKEPVPLENRIESIIEEFLSDMHPDCSNYTEEVNMLSEIINDYSNLVSVFDMEEDSDLDGYVISSLLASAGSTVASDQINLEQLEITLTLNRADIAREKIFLENKKWKKGQLNDYMYHALMSDRHDFVKLFLEQGFSLEEFLTVYMLEKLYTDQLKNLQS------------------SKVALRDVGKVIKALVGDFYHPLYLSKEFQ 646          

HSP 3 Score: 187.578 bits (475), Expect = 1.354e-43
Identity = 110/218 (50.46%), Postives = 147/218 (67.43%), Query Frame = 3
Query:  348 GEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEE--------------ESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETS 959
            GEIEFTGLNQ+AKF +L  ST +  I+ +L+ KW L  PTL+I++FG DFEKKRKLKMI KKGLWKAAES GCWI+T G ++G+MKL GEAVRDYTDAYGGN+M+A G+A W+ V KN++LE +L++GT  A+YQSEE                    +  V+   +E++LD NH++F L D   S +   + + + R+RFE  IS W   T + + S
Sbjct:   57 GEIEFTGLNQTAKFCKLDGSTTDQVIRDLLKRKWGLKPPTLIITVFGTDFEKKRKLKMIFKKGLWKAAES-GCWIVTGGFHLGVMKLTGEAVRDYTDAYGGNRMMAFGVASWDCVTKNEILEAALHEGT--AVYQSEEDEEEQDESDRGVAGPGGATGNKTVRSDVEERALDPNHNFFILVDSGVSDQAKGK-EAELRARFERCISQWSCATPALDQS 270          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A068YIN2 (Transient receptor potential cation channel OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000986600 PE=4 SV=1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 525/1087 (48.30%), Postives = 714/1087 (65.69%), Query Frame = 3
Query: 2445 DDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYK-EDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ---ATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGA-DGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGS-----SRESDEEITKLELAVRSAILALRSELQPLMSDFSIP--------RKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADN----------PVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRT-NSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESD--KFHFTDDILK 5612
            ++ ++K I  +RPAREL+IWS+LVGKL+M+ELFW MEKE IA ALLAS+LL++L+NK+DDFTDKEDYK YSK F+ +AEGVLNECY EDE RAQL+IN EL YYG SSVI LAA+GQSIKFMAHPCCQDFLT+TW GNLSSKNS   ++  +  G+ MP  IPK++ Y+ ED     G+  +  T+Q     E   EDVE  +R ++ +S T S     +   ++++ +IK FY SP++RF+Y+++SY+ FL+LFS  LL  FKV     E I+  W+ TL +EEIKQ   +  SGISFSTY SDGWNKLD T + L+++GFILRLI   +  +     + +   ILTD +   S+ CM  SLF FY+R+MY FSFHIALGPKLIMI KM++NDLIPFMIIL+V M+GY V   + AYP G  +T + L+   +       D+ I ++   +Y+ MFG+F LD+LQG   +C +      PTK SR L P+ LG +VLLTN+L+FNLLIAMF+KTYEEIES+S YYWNYQRYQMI+++V +SPLVPP II WHFYE Y  L  +  +  + ++  ++PFC+ F +D+KKERE+VKWEHMKAMDYLR   EP+ KS   RG  + R++VFRG G+G       V   +D K + T++TE I  +L+KRFK++D    + NE+++++    + +  +G  +  V      ++ KI ++P CQC E V     +     S ES +  TKLE+AV+SA+ A +  L+P       P        ++ P  +    +E ES    D  GD + DP   P   +   GR ++R +  HRLWR+ PFNFE YPGMRM VP +  +W   Y DY A+D+S+E +LYP++   D +N           ++    +N YD+ N+++RQS+LG+Y LDP T AP NP GRTGL G+GLLPHWGPNHSI+++ T+W+R   SG+P+ R NK ++Q IALER  R+ +PWF  DH S C+ +EC       +  QR +A  S K+ + L +++  A  TQIFKG+LDD LNAD  W+ETVV+NFHE +     FTDDI K
Sbjct: 1015 EEARIKLIQFDRPARELLIWSVLVGKLRMSELFWTMEKEPIAAALLASILLSALSNKTDDFTDKEDYKNYSKSFQEKAEGVLNECYREDEHRAQLIINHELAYYGHSSVIKLAAEGQSIKFMAHPCCQDFLTNTWKGNLSSKNSMFRMMFGLMFGLTMPLFIPKVLLYEPEDRQSEAGEESNDSTEQKD---EELSEDVE--SRVMVKRSLTTSL----QVGAMEFWVKIKDFYMSPIVRFVYHTISYVLFLVLFSYLLLVDFKVRITGVEYIVLAWVITLFIEEIKQIAWSVLSGISFSTYISDGWNKLDCTGLILYIVGFILRLIVLARLGDSQLSHDTEAFHILTDPIMDPSRICMAFSLFVFYIRLMYSFSFHIALGPKLIMIGKMVTNDLIPFMIILTVIMVGYAVAAQSIAYPNGF-YTSEQLSINGTVQGMKFIDT-IFSMYTTAYFQMFGDFSLDTLQGEDRNCQN---GMCPTKTSRWLVPIMLGFYVLLTNILMFNLLIAMFSKTYEEIESASTYYWNYQRYQMIADYVRRSPLVPPLIIFWHFYEAYKALGNRCASIRSTEQIENNPFCVTF-KDVKKEREMVKWEHMKAMDYLR---EPSTKSGGKRGGVESRAVVFRGVGAGSGMGPGPV---MDLKSEMTAVTEGIGMELEKRFKDLDAHFQRFNEVDARLTEVTQTLTSLGEVVRQVTATQEAIMKKIADLPTCQCIELVDEPESADDKDKSGESPKRRTKLEVAVQSALEAAKDVLRPPTPPPPPPMAPPPPRDQEIPITTGAPGSEAESSGTEDSGGDPSADPVQIPPAVDSNAGRTLQRNIAGHRLWRFAPFNFEKYPGMRMNVPPDKTAWTTRYPDYFAYDSSEETVLYPDETAHDGENFQHGVSFGSSAILRSIPFNTYDSKNRIRRQSLLGRYRLDPNTGAPLNPMGRTGLLGKGLLPHWGPNHSIVIVVTQWSRNPKSGTPVLRGNKGVLQVIALERNKRFCLPWFFTDHESRCDYDECVPTVVRAYFAQRARAVCSEKRADRLLRRLDKADVTQIFKGYLDDQLNADGGWLETVVLNFHEGEGRGAQFTDDIFK 2080          

HSP 2 Score: 331.643 bits (849), Expect = 8.946e-88
Identity = 173/271 (63.84%), Postives = 221/271 (81.55%), Query Frame = 3
Query:  963 DTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQN 1775
            D R+P+CGLV+GGD  TLRQV+ SI++N+CP+VV +G+SGAADV+A  ++A  K + EE  E+ E + LE RL S++ + L +++P+  +F +E   L +I+T+   LV VFDMEED DLDGY+ISSLL SA +    +QLNLEQLEITLTLNRADIA+EKIFLENK+WKKG LNDYM+ ALM DRHDFVK+FLEQGFSLEEFLTVY+LE+LYTDQLKN++S++ IF+++W+ H++HR  K V LR+VGKVIK LVGDFYHPLYLSKEFQ 
Sbjct:  344 DIRIPMCGLVIGGDRFTLRQVYCSIMQNQCPMVVAKGTSGAADVIAFGLEAATKMETEEILEDKEAISLETRLGSVLEQFLREMHPDYFNFAEEVSMLAEIITDYVSLVLVFDMEEDSDLDGYMISSLLASAGTSTPPDQLNLEQLEITLTLNRADIAREKIFLENKRWKKGQLNDYMYQALMGDRHDFVKIFLEQGFSLEEFLTVYMLERLYTDQLKNMSSKVAIFNKMWEYHRSHRASK-VTLRDVGKVIKSLVGDFYHPLYLSKEFQQ 613          

HSP 3 Score: 189.119 bits (479), Expect = 4.644e-44
Identity = 107/215 (49.77%), Postives = 142/215 (66.05%), Query Frame = 3
Query:  348 GEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMV-----------------KDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQT 941
            GEIEFTGLNQ+A+F +L +S  +  I+ +LQ +W L  PTL+I++FG DFEKKRKLKMI KKGLWKAA+S GCWI+T G  +GIMKLAGEAVRDYTDAYGGN+M+A GI+ W  V KND+LE +L +GT  A+YQSEE+ +++ +                    +   +E +LD NH+YF   +  A +      +   R+RFE  IS W + T
Sbjct:   46 GEIEFTGLNQTARFAKLSSSMSDSAIRDLLQRRWGLKPPTLIITVFGTDFEKKRKLKMIFKKGLWKAADS-GCWIVTGGFQLGIMKLAGEAVRDYTDAYGGNRMLAFGISSWGCVKKNDILEAALEEGT--AVYQSEEDKDSDAEQSSTTETTTANATAASSTQKRTDVEELALDPNHNYFIFAET-AKTDHTKGREAGMRARFERCISLWSTST 256          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A068WHQ0 (Transient receptor potential cation channel OS=Echinococcus granulosus OX=6210 GN=EgrG_000986600 PE=4 SV=1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 524/1087 (48.21%), Postives = 715/1087 (65.78%), Query Frame = 3
Query: 2445 DDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYK-EDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ---ATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGA-DGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGS-----SRESDEEITKLELAVRSAILALRSELQPLMSDFSIP--------RKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADN----------PVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRT-NSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESD--KFHFTDDILK 5612
            ++ ++K I  +RPAREL+IWS+LVGKL+M+ELFW MEKE IA ALLAS+LL++L+NK+DDFTDKEDYK YSK F+ +AEGVLNECY EDE RAQL+IN EL YYG SSVI LAA+GQSIKFMAHPCCQDFLT+TW GNLSSKNS   ++  +  G+ MP  IPK++ Y+ ED+    G+  +  T+Q     E   EDVE  +R ++ +S T S     +   ++++ +IK FY SP++RF+Y+++SY+ FL+LFS  LL  FKV     E I+  W+ TL +EEIKQ   +  SGISFSTY SDGWNKLD T + L+++GFILRLI   +  +   + + +   ILTD +   S+ CM  SLF FY+R+MY FSFHIALGPKLIMI KM++NDLIPFMIIL+V M+GY V   + AYP G  +T + L+   +       D+ I ++   +Y+ MFG+F LD+LQG   +C +      PTK SR L P+ LG +VLLTN+L+FNLLIAMF+KTYEEIES+S YYWNYQRYQMI+++V +SPLVPP II WHFYE Y  L  +  +  + ++  ++PFC+ F +D K++RE+VKWEHMKAMDYLR   EP+ KS   RG  + R++VFRG G+G       V   +D K + T++TE I  +L+KRFK++D    + NE+++++    + +  +G  +  V      ++ KI ++P CQC E V     +     S ES +  TKLE+AV+SA+ A +  L+P       P        ++ P  +    +E ES    D  GD + DP   P   +   GR ++R +  HRLWR+ PFNFE YPGMRM VP +  +W   Y DY A+D+S+E +LYP++   D +N           ++    +N YD+ N ++RQS+LG+Y LDP T AP NP GRTGL G+GLLPHWGPNHSI+++ T+W+R   SG+P+ R NK ++Q IALER  R+ +PWF  DH S C+ +EC       +  QR +A  S K+ + L +++  A  TQIFKG+LDD LNAD  W+ETVV+NFHE +     FTDDILK
Sbjct: 1017 EEARIKLIQFDRPARELLIWSVLVGKLRMSELFWTMEKEPIAAALLASILLSALSNKTDDFTDKEDYKNYSKSFQEKAEGVLNECYREDEHRAQLIINHELAYYGHSSVIKLAAEGQSIKFMAHPCCQDFLTNTWKGNLSSKNSMFRMMFGLMFGLTMPLFIPKVLLYEPEDKQSEAGEESNDSTEQKD---EELSEDVE--SRVMVKRSLTTSL----QVGAMEFWVKIKDFYMSPIVRFVYHTISYVLFLVLFSYLLLVDFKVRITGVEYIVLAWVITLFIEEIKQIAWSVLSGISFSTYISDGWNKLDCTGLILYIVGFILRLIVLARLGDSQLNHDTEAFHILTDPIMDPSRICMAFSLFVFYIRLMYSFSFHIALGPKLIMIGKMVTNDLIPFMIILTVIMVGYAVAAQSIAYPNGF-YTSEQLSINGTVQGMKFIDT-IFSMYTTAYFQMFGDFSLDTLQGEDRNCQN---GMCPTKTSRWLVPIMLGFYVLLTNILMFNLLIAMFSKTYEEIESASTYYWNYQRYQMIADYVRRSPLVPPLIIFWHFYEAYKALGNRCASIRSTEQIENNPFCVTF-KDEKQKREMVKWEHMKAMDYLR---EPSTKSGGKRGGVESRAVVFRGVGAGSGMGPGPV---MDLKSEMTAVTEGIGMELEKRFKDLDAHFQRFNEVDARLTEVTQTLTSLGEVVRQVTATQEAIMKKIADLPTCQCIELVDEPESADGKDKSGESPKRRTKLEVAVQSALEAAKDVLRPPTPPPPPPMAPPPPRDQEIPITTGAPGSEAESSGTEDSGGDPSADPVQIPPAVDSNAGRTLQRNIAGHRLWRFAPFNFEKYPGMRMNVPPDKTAWTTRYPDYFAYDSSEETVLYPDETAHDGENFQHGVSFGSSAILRSIPFNTYDSKNHIRRQSLLGRYRLDPNTGAPLNPMGRTGLLGKGLLPHWGPNHSIVIVVTQWSRNPKSGTPVLRGNKGVLQVIALERNKRFCLPWFFTDHESRCDYDECVPTVVRAYFAQRARAVCSEKRADRLLRRLDKADVTQIFKGYLDDQLNADGGWLETVVLNFHEGEGRGAQFTDDILK 2082          

HSP 2 Score: 332.798 bits (852), Expect = 4.713e-88
Identity = 176/287 (61.32%), Postives = 228/287 (79.44%), Query Frame = 3
Query:  963 DTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVS--KTDRKRSTMTH 1817
            D R+P+CGLV+GGD  TLRQV+ SI++N+CP+VV +G+SGAADV+A  ++A  K + EE  E+ E + LE RL S++ + L +++P+  +F +E   L +I+T+   LV VFDMEED DLDGY+ISSLL SA +    +QLNLEQLEITLTLNRADIA+EKIFLENK+WKKG LNDYM+ ALM DRHDFVK+FLEQGFSLEEFLTVY+LE+LYTDQLKN++S++ IF+++W+ H++HR  K V LR+VGKVIK LVGDFYHPLYLSKEFQ  ++  K+D     + H
Sbjct:  344 DIRIPMCGLVIGGDRFTLRQVYCSIMQNQCPMVVAKGTSGAADVIAFGLEAATKMETEEILEDKEAISLETRLGSVMEQFLREMHPDYYNFAEEVSMLAEIITDYVSLVLVFDMEEDSDLDGYMISSLLASAGTSTPPDQLNLEQLEITLTLNRADIAREKIFLENKRWKKGQLNDYMYQALMGDRHDFVKIFLEQGFSLEEFLTVYMLERLYTDQLKNMSSKVAIFNKMWEYHRSHRASK-VTLRDVGKVIKSLVGDFYHPLYLSKEFQQKLAPEKSDLAVGIIQH 629          

HSP 3 Score: 189.504 bits (480), Expect = 3.343e-44
Identity = 108/215 (50.23%), Postives = 143/215 (66.51%), Query Frame = 3
Query:  348 GEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDD---------------GMVKDRN--KEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQT 941
            GEIEFTGLNQ+A+F +L +S  +  I+ +LQ +W L  PTL+I++FG DFEKKRKLKMI KKGLWKAA+S GCWI+T G  +GIMKLAGEAVRDYTDAYGGN+M+A GI+ W  V KND+LE +L +GT  A+YQSEE+ +++ +                  + R   +E +LD NH+YF   +  A +      +   R+RFE  IS W + T
Sbjct:   46 GEIEFTGLNQTARFAKLSSSMSDSAIRDLLQRRWSLKPPTLIITVFGTDFEKKRKLKMIFKKGLWKAADS-GCWIVTGGFQLGIMKLAGEAVRDYTDAYGGNRMLAFGISSWGCVKKNDILEAALEEGT--AVYQSEEDKDSDAEQSSTTETATANATAASSTQKRTDVEELALDPNHNYFIFAET-AKTDHTKGREAGMRARFERCISLWSTST 256          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 179.489 bits (454), Expect = 9.239e-45
Identity = 159/528 (30.11%), Postives = 265/528 (50.19%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGN---KMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEK-SLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKC-PVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPL-----------EARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDW--DLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXX-XRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKL----------YTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSK-EFQNLVS--KTDRKRSTM 1811
            PT+AFGE+EF G+++  + F+RL + TP     TIL   W L  P LV+S+ GG    + K KL+ ++++GL +AA+S G WI++ GL  GI +  GEAVRD+T A   +   K+VAIG+APW +V   D L N   +G+YPA Y             V + +++   LDTNH  F L D  ++ +   E   +FR+  E+ IS    Q +    S    +P+   +V G++  L ++  S+   KC P +V  GS G AD++          D+ E      ++P            +  L   + E + K  P   D  K   +L   V +   L+S++ +E++   D D  ++ +L+ ++   L+ +     +        NR DIA+ ++F  + +WK   L  +M +AL++D+  FV+LF+E G +++E++T   LE+L          YT   ++L+ R  +    W         K + L EV ++++ L+GD   P Y  K + Q + S  KT +K +T+
Sbjct:   86 PTDAFGEVEFGGVSKRHSNFLRLSSDTPPATAYTILTSNWGLPKPNLVLSVVGGVGRSKVKPKLREVLRQGLVRAAQSTGAWILSGGLREGIDRCLGEAVRDHTTAASSDSLTKVVAIGVAPWGLVNLRDELVNP--EGSYPAGY------------FVTNTSRDSYCLDTNHQAFLLVDDGSTGRRGGE--ARFRAGLENYIS---QQRTGKLGSGSMDIPVLCTLVSGELYMLERLDLSL--KKCIPWMVLAGSGGLADLVT---------DVLENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFPSEPDVDKLVDKLLN-VHKSQDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLSTEELKLAVTWNRVDIARSELFTGDIQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELYRSISDSSVAYTLLQRHLSERQGVAGTGWPAADP---AKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTV 579          

HSP 2 Score: 150.984 bits (380), Expect = 4.359e-36
Identity = 170/633 (26.86%), Postives = 294/633 (46.45%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKE----DESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSY------SKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCE----EIILTFWIGTLLLEEIKQATFSG-----ISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFG---LDSLQGISPSCSSQ----DLNYVPTKVSR--TLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDL--KKERELVKWEHMKAMDYLRKLNEPTQKSRQTR 4289
            P   L  W++L  + +MA  FW M  E +  AL A  LL  L    ++   K   K  +  FE+ A  V ++CY   E R+ +L+ K+   +  ++ + +A +  +  F +H   Q  L+  W+G++        L+ ++    I P     +IS++E    ++  P    K++D          S  D+    + I  K   L +      +K    K+     R K F+++PV  F+ N + Y  FLLLF+  LL  FK          E++L FW+ T++ EEI+   F G          Y  D W+K D  AITLF+IG   R+     ++                     ++  +      F +R+++IF+ H  LGPK+I++ KM+  D+  F+  L+V+M+ YGV   AN    GL ++ D            S D ++  +  + Y  +FG+     +DS    + +C++     D N  P + +R   +  + L +++L+TN+LL NLLIAMF+ T+ +++  S  YW +QR+++I E+ ++  L PPFII  HF++         F   N +K  S+     F+ DL  K    ++ WE+++  + L    +  ++S   R
Sbjct:  593 PWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKLLRELCKLENETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTL---FIPPLCYTSLISFREVEEAEDGTPEEAPKARDIDWLYAETVFSFADI----KRIQTKQEELRFTPKGNPTKKSPQKQCFLLSRWKQFWYAPVTAFLGNMLMYFLFLLLFAYVLLVDFKPPPPKGPSPMELLLYFWVFTIVCEEIRGTFFIGNMTVRQRIRQYTQDLWHKCDLIAITLFLIGLCCRMFRRSFWF---------------------ARAALCLDYMVFTLRLIHIFAIHKQLGPKIIIVGKMM-KDVFFFLFFLAVWMMAYGV---ANQ---GLIYSFD-----------PSADRILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFIIFSHFHQ---------FIKRNIRKVPSEKIH-QFAVDLIDKANNRMMTWENIQKENLLSAEGKKQRESEAER 1169          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 171.4 bits (433), Expect = 2.530e-42
Identity = 175/636 (27.52%), Postives = 296/636 (46.54%), Query Frame = 3
Query: 2475 ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF--------VCEEIILTFWIGTLLLEEIKQATFSGISFST------YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQG--ISPSCSSQDLNYVPTKVSRTLNP-----------XXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEI-YSLLKR---KLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTR 4289
            E P R+L +W++L  + +MA  FWAM  E +A AL    +L  +A+   +       K     +E  A  + +ECY   E RA  L+ ++   + +S+V+ LA +  +  F AH   Q  LT  W+G +++  S   L+ S       P +   +I +  DE +       Q  + + +  E +    +          +    S  Q + +    +R K F+ +PV  F+ N + Y  FL+LF+  LL    ++F           EIIL FW+ TL+LEEI+Q+ F+    +       Y  D WNK D  AI+LFV+G   R++                     ++ +   +T +      F +R+++IF+ H  LGPK+I++ +M+  D+  F+  LSV++I YGV   A  +P                 N    D +   +L + Y  +FG+  L+ +    + P   + DL  +   ++ TL P           L L +++L+TNVLL NLLIAMF+ T++ ++ ++  +W +QRY +I E+ ++  L PPFIII H  +I  SL K+   K+   E E  +  D             ++L+ WE ++  +YL +L     +S + R
Sbjct:  548 ENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEMAHLESEAESARSMK--EAKYEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTSISKLVLSF---FCPPLIWTNLIKFS-DEILQSRGGGEQFAELDSLDTEKALLLSDDDPDDSEAAGDPADQSCSQAWSQF-LLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLL----LDFRPPPPDGPSIAEIILYFWVFTLVLEEIRQSFFTDEDMNILKKCKLYVEDNWNKCDMVAISLFVVGVSCRMM---------------------ENTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMM-KDVFFFLFFLSVWLIAYGVATQALLHP-----------------NDPRLDWVFRRVLYRPYLHIFGQIPLEEIDAAKMQPDNCTMDLQDI---ITGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQGNTDIFWKFQRYNLIVEYHSRPALAPPFIIISHLSQILLSLCKKSESKIEHLERELPAGLD-------------QKLMTWETVQKENYLARLERRHLESSEER 1117          

HSP 2 Score: 167.162 bits (422), Expect = 4.872e-41
Identity = 150/490 (30.61%), Postives = 245/490 (50.00%), Query Frame = 3
Query:  345 FGEIEFTGLNQS-AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDF--EXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKM--VAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLV------------------KNVKLREVGKVIKILVGDFYH 1745
             G+I+F G +++  KF R+ + T  V I  +L  +W L  P LV+++ GGD   + K  L+  ++KGL +A +S G WI+T GL  GI K  G+AVRD++ A   +K+  VAIGIAPW ++   ++L  +  +   PA Y +E+       G V       SLD +HS+F L +     +  S      R +    IS    Q + Y       +P+  L+V G+   L++++ +I +N  P ++  GS G AD+L   I          G  + E+V  E  LE+        I   +K  +K        + E G+L++V D E+  DLD  I+ +L+ +  S   + Q  L++L++ +  NR DIAK +IF  + +W   DL + M +AL++D+ DFV+LF++ G +L EFLT   L++LY     +++ +  +F  L   H+  +++                      L EV KV+K    DF H
Sbjct:   68 LGDIDFIGSSRTRGKFARVSSMTDPVLIYQLLTEQWGLSPPHLVVALVGGDELDQMKPWLRDTVRKGLVRATQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVRVVAIGIAPWTMIHNKEMLLTA--KPDQPAAYPTEDLPH----GSVY------SLDCHHSHFILVE---EEQHRSGATGDMRVKLLKHISL---QRTGYGGPGSFEIPVLCLLVHGEPKILQRMYKTI-QNATPWLLLAGSGGVADILVTLI--------YRGCWDTEMVQ-ELLLETFTGLHSTDITSWVKVIQK--------ILENGHLLTVHDPEQTADLDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFNGDVEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELYC----SVSEKSLLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLK----DFLH 513          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 164.081 bits (414), Expect = 6.778e-40
Identity = 190/719 (26.43%), Postives = 331/719 (46.04%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS------DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSK-------PQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSL----QGISPSCS----SQDLNYVPTKVSRT-LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAM---------DYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQ---LDKRFKEVDVKLSKLNELESQIGSFAENIKEI 4514
            P  EL++W++L+ + +MA   W   +E +A AL+A  L  ++A++S      DD +  +D    SK F + A  +L++ Y  DE+ A  L+  ELK +  S+ + LA   +   F+AH C Q  LT  W G L   KN  + ++    +GII P   P I+         LG    Q   + ++     K+D    +R     +N  ++SK        +K KR+   ++I  FY +P  +F +N++SYL +L+L++  +L K +     +E I+  +I TL +E+++Q   S         S +  + WN  D  AI+ F++G +LR                     L    ++G    + C  + F+Y+RV+ IF  +  LGP ++MI KM+  D++ F++I+ V ++ +GV   A  +P                 +   T  +   I    Y+ ++GE   DS+      I+P C      +D   +P  +    L P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F ++  L PP II+ H Y    +L RK+     +KK           E  K  + ++  E +KA+         +Y R+ ++  Q S   R                     +  + V+N    +   EEIN +   +    + VD++L++L ++ S++ +  E +  I
Sbjct:  540 PFHELIVWAVLMRRQKMALFLWQRGEEAMAKALVACKLYKAMAHESSVSELVDDVS--QDLDNNSKEFGTLAYELLDQAYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRVGKNPGLKVI----IGIIFP---PSILLL----DFRLGDDAHQVDDREEV---KEKDDDNKSSRD----ANADTHSKKGDEEEGSKKMKRVPIGRKIYEFYNAPFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLR---------------------LQPEPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHP-----------------DEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPLIILSHLY----ILFRKICCRCGKKKEG------ELDEKDKGLKLILNAEELKALYEFEEQCVEEYFREKDDEQQNSNDER-------------------IRVTSERVEN---MSMRLEEINERENTMKASLQTVDLRLAQLEDIHSRMMNALEKLAGI 1167          

HSP 2 Score: 111.309 bits (277), Expect = 8.288e-24
Identity = 112/368 (30.43%), Postives = 184/368 (50.00%), Query Frame = 3
Query:  387 FVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVV-AKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIEN-KCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFL 1454
            ++R+   T   N+  ++   W L  PTL+IS+ GG  +F+ + KLK +  KGL KAA + G WI T G+N G+M+  G+A++D++    G K+ AIGIAPW ++ +K D++   + +      YQ+          M    +K   L+++HS+F L D     K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V  S+ E+   PVVVC GS  A+D+++ A          + S++  I+  +AR      + L  I       K +S Q+  ++ +      L++VF M  E   D++  I+++LL   N++A D         QL + L  NR DIA+ +IF+
Sbjct:    2 YIRVSYDTKPDNLLHLMVKDWHLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTAGINTGVMRHVGDALKDHSSKSRG-KVCAIGIAPWGILESKEDLIGRDVNKP-----YQA----------MSNPLSKLAVLNSSHSHFILCDNGTCGKYGAE--VKLRRQLEKHISLQKINTRLGQG-----VPLLCLIVEGGPNMITVVLESLREDPPVPVVVCDGSGRASDIISFA---------HKHSQKGGIIGDDAR-----DQLLVTIQKTFSYSKSQSQQIFLMIMDCMKKRELITVFRMGAEGQQDIEMAILTALLKGTNASAPD---------QLSLALAWNRVDIARNQIFV 323          

HSP 3 Score: 53.5286 bits (127), Expect = 3.166e-6
Identity = 35/101 (34.65%), Postives = 54/101 (53.47%), Query Frame = 3
Query: 1482 LNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKN--VKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            L   M +AL+ DR DFVKL +E G ++  FLT+  LE+LY  +L   N+   I   +    K   L  +  + L ++G V++ L+G  Y   Y  K F++L
Sbjct:  391 LEQAMMDALVLDRVDFVKLLIENGVNIHHFLTIPRLEELYNTKLGPANTLNVIVREV----KKGNLPPDYQITLIDIGLVVEYLIGGAYRCNYTRKSFRSL 487          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 163.696 bits (413), Expect = 9.588e-40
Identity = 190/719 (26.43%), Postives = 331/719 (46.04%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS------DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSK-------PQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSL----QGISPSCS----SQDLNYVPTKVSRT-LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAM---------DYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQ---LDKRFKEVDVKLSKLNELESQIGSFAENIKEI 4514
            P  EL++W++L+ + +MA   W   +E +A AL+A  L  ++A++S      DD +  +D    SK F + A  +L++ Y  DE+ A  L+  ELK +  S+ + LA   +   F+AH C Q  LT  W G L   KN  + ++    +GII P   P I+         LG    Q   + ++     K+D    +R     +N  ++SK        +K KR+   ++I  FY +P  +F +N++SYL +L+L++  +L K +     +E I+  +I TL +E+++Q   S         S +  + WN  D  AI+ F++G +LR                     L    ++G    + C  + F+Y+RV+ IF  +  LGP ++MI KM+  D++ F++I+ V ++ +GV   A  +P                 +   T  +   I    Y+ ++GE   DS+      I+P C      +D   +P  +    L P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F ++  L PP II+ H Y    +L RK+     +KK           E  K  + ++  E +KA+         +Y R+ ++  Q S   R                     +  + V+N    +   EEIN +   +    + VD++L++L ++ S++ +  E +  I
Sbjct:  640 PFHELIVWAVLMRRQKMALFLWQRGEEAMAKALVACKLYKAMAHESSVSELVDDVS--QDLDNNSKEFGTLAYELLDQAYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRVGKNPGLKVI----IGIIFP---PSILLL----DFRLGDDAHQVDDREEV---KEKDDDNKSSRD----ANADTHSKKGDEEEGSKKMKRVPIGRKIYEFYNAPFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLR---------------------LQPEPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHP-----------------DEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPLIILSHLY----ILFRKICCRCGKKKEG------ELDEKDKGLKLILNAEELKALYEFEEQCVEEYFREKDDEQQNSNDER-------------------IRVTSERVEN---MSMRLEEINERENTMKASLQTVDLRLAQLEDIHSRMMNALEKLAGI 1267          

HSP 2 Score: 125.176 bits (313), Expect = 4.510e-28
Identity = 122/390 (31.28%), Postives = 196/390 (50.26%), Query Frame = 3
Query:  327 TLPTNAFGEIEFTGLN--QSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVV-AKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIEN-KCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFL 1454
            T PT+A+G IEF G      A ++R+   T   N+  ++   W L  PTL+IS+ GG  +F+ + KLK +  KGL KAA + G WI T G+N G+M+  G+A++D++    G K+ AIGIAPW ++ +K D++   + +      YQ+          M    +K   L+++HS+F L D     K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V  S+ E+   PVVVC GS  A+D+++ A          + S++  I+  +AR      + L  I       K +S Q+  ++ +      L++VF M  E   D++  I+++LL   N++A D         QL + L  NR DIA+ +IF+
Sbjct:   80 TSPTDAYGTIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWHLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTAGINTGVMRHVGDALKDHSSKSRG-KVCAIGIAPWGILESKEDLIGRDVNKP-----YQA----------MSNPLSKLAVLNSSHSHFILCDNGTCGKYGAE--VKLRRQLEKHISLQKINTRLGQG-----VPLLCLIVEGGPNMITVVLESLREDPPVPVVVCDGSGRASDIISFA---------HKHSQKGGIIGDDAR-----DQLLVTIQKTFSYSKSQSQQIFLMIMDCMKKRELITVFRMGAEGQQDIEMAILTALLKGTNASAPD---------QLSLALAWNRVDIARNQIFV 423          

HSP 3 Score: 53.5286 bits (127), Expect = 2.962e-6
Identity = 35/101 (34.65%), Postives = 54/101 (53.47%), Query Frame = 3
Query: 1482 LNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKN--VKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            L   M +AL+ DR DFVKL +E G ++  FLT+  LE+LY  +L   N+   I   +    K   L  +  + L ++G V++ L+G  Y   Y  K F++L
Sbjct:  491 LEQAMMDALVLDRVDFVKLLIENGVNIHHFLTIPRLEELYNTKLGPANTLNVIVREV----KKGNLPPDYQITLIDIGLVVEYLIGGAYRCNYTRKSFRSL 587          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: trpm1b (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:103042575])

HSP 1 Score: 163.31 bits (412), Expect = 1.174e-39
Identity = 191/719 (26.56%), Postives = 332/719 (46.18%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS------DDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSK-------PQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSL----QGISPSCS----SQDLNYVPTKVSRT-LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAM---------DYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQ---LDKRFKEVDVKLSKLNELESQIGSFAENIKEI 4514
            P  EL++W++L+ + +MA   W   +E +A AL+A  L  ++A++S      DD +  +D    SK F + A  +L++ Y  DE+ A  L+  ELK +  S+ + LA   +   F+AH C Q  LT  W G L   KN  + ++    +GII P   P I+         LG    Q   + ++     K+D    +R     +N  ++SK        +K KR+   ++I  FY +P  +F +N++SYL +L+L++  +L K +     +E I+  +I TL +E+++Q   S         S +  + WN  D  AI+ F++G +LR                     L    ++G    + C  + F+Y+RV+ IF  +  LGP ++MI KM+  D++ F++I+ V ++ +GV   A  +P                 +   T  +   I    Y+ ++GE   DS+      I+P C      +D   +P  +    L P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F ++  L PP II+ H Y    +L RK+     +KK           E  K  + ++  E +KA+         +Y R+ ++  Q S   R         R           +  + V+N    +   EEIN +   +    + VD++L++L ++ S++ +  E +  I
Sbjct:  658 PFHELIVWAVLMRRQKMALFLWQRGEEAMAKALVACKLYKAMAHESSVSELVDDVS--QDLDNNSKEFGTLAYELLDQAYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRVGKNPGLKVI----IGIIFP---PSILLL----DFRLGDDAHQVDDREEV---KEKDDDNKSSRD----ANADTHSKKGDEEEGSKKMKRVPIGRKIYEFYNAPFTKFWFNTISYLAYLMLYNYIVLVKMERWPSMQEWIVISYILTLGVEKVRQILMSEPGKLKQKISVWLEEYWNITDLAAISTFILGVLLR---------------------LQPEPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMI-DMLYFVVIMLVVLMSFGVARQAILHP-----------------DEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPLIILSHLY----ILFRKICCRCGKKKEG------ELDEKDKGLKLILNAEELKALYEFEEQCVEEYFREKDDEQQNSNDER--------IR-----------VTSERVEN---MSMRLEEINERENTMKASLQTVDLRLAQLEDIHSRMMNALEKLAGI 1285          

HSP 2 Score: 125.176 bits (313), Expect = 4.933e-28
Identity = 122/390 (31.28%), Postives = 196/390 (50.26%), Query Frame = 3
Query:  327 TLPTNAFGEIEFTGLN--QSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVV-AKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIEN-KCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFL 1454
            T PT+A+G IEF G      A ++R+   T   N+  ++   W L  PTL+IS+ GG  +F+ + KLK +  KGL KAA + G WI T G+N G+M+  G+A++D++    G K+ AIGIAPW ++ +K D++   + +      YQ+          M    +K   L+++HS+F L D     K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V  S+ E+   PVVVC GS  A+D+++ A          + S++  I+  +AR      + L  I       K +S Q+  ++ +      L++VF M  E   D++  I+++LL   N++A D         QL + L  NR DIA+ +IF+
Sbjct:   98 TSPTDAYGTIEFQGGGFINKAMYIRVSYDTKPDNLLHLMVKDWHLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTAGINTGVMRHVGDALKDHSSKSRG-KVCAIGIAPWGILESKEDLIGRDVNKP-----YQA----------MSNPLSKLAVLNSSHSHFILCDNGTCGKYGAE--VKLRRQLEKHISLQKINTRLGQG-----VPLLCLIVEGGPNMITVVLESLREDPPVPVVVCDGSGRASDIISFA---------HKHSQKGGIIGDDAR-----DQLLVTIQKTFSYSKSQSQQIFLMIMDCMKKRELITVFRMGAEGQQDIEMAILTALLKGTNASAPD---------QLSLALAWNRVDIARNQIFV 441          

HSP 3 Score: 53.5286 bits (127), Expect = 2.704e-6
Identity = 35/101 (34.65%), Postives = 54/101 (53.47%), Query Frame = 3
Query: 1482 LNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKN--VKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            L   M +AL+ DR DFVKL +E G ++  FLT+  LE+LY  +L   N+   I   +    K   L  +  + L ++G V++ L+G  Y   Y  K F++L
Sbjct:  509 LEQAMMDALVLDRVDFVKLLIENGVNIHHFLTIPRLEELYNTKLGPANTLNVIVREV----KKGNLPPDYQITLIDIGLVVEYLIGGAYRCNYTRKSFRSL 605          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 166.392 bits (420), Expect = 1.603e-41
Identity = 181/683 (26.50%), Postives = 313/683 (45.83%), Query Frame = 3
Query: 2286 AIRRISSLDFHEID---RMLHAKSKSTLYS-ETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISL--ERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVI-PKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQA------TFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFG--LDSLQGISPSCSSQDLN----YVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYL-RKLNEPTQK 4274
            A +R++    + I    R L   S S LY  + S    L   ++N G+       E   +   E  L    P R+L IW++L+ + ++A  FW+  K+ +A AL+AS LL ++  + DD     D    + ++E  A G+L+ECY +DE RAQ L+ ++L  +G ++ + +A    +  F +H   Q  LT  W+G +S       ++    L II P +I  +II++                                  R +L          P +++          F+ +P+  F  N VSY  FL LF+  ++  F+      E +L  W+ +L+LEE++Q            +   Y  D WN++D  A+ LF IG I RLI         + +N        +S F   ++ +      F +R+M+IF+ +  LGPK+I++++M+  D+  F+ +L V+++ YGV             T  +L       N    D +   ++ + Y  +FG+F   +DS    + SC++  +N      P      L  L   L++L  N+LL NLLIAMF  T++ ++ ++   W +QRY++++E+ ++  L PP I+  H Y    L  R+    + + K   + F   FSE   +ERE + WE +    Y+  +L E +Q+
Sbjct:  478 APKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQEEDDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVI----LCIIFPLLIYTRIITF----------------------------------RWVLYAHT----CTPTRWRN---------FWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTPDWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILALLLFTIGVICRLIP--------NSIN--------ESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMV-KDIFFFLFLLGVWVVAYGVA------------TQGILI-----LNEQRLDWIFRGVVYQPYLLIFGQFPTRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPLIVFSHLY----LFVRRFILKKPQHK--HEDFKKGFSES--EEREFLAWESIMRESYVASQLTEKSQR 1067          

HSP 2 Score: 113.235 bits (282), Expect = 3.206e-25
Identity = 86/222 (38.74%), Postives = 118/222 (53.15%), Query Frame = 3
Query:  285 LSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQS-AKFVRLLNST-PEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAG---CWIITEGLNMGIMKLAGEAVRDYTDAYGG--NKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSIS 923
            L   ++P K   N   PTNAFG+I+FTGL Q   KFVR+ N T P V  + +++  W L  P L+IS+ GG  +F  K +L+ I + GL K A S G    WIIT G   G+MK  GE+VRD+  A G    K+VAIGIA W ++   + L ++  QG +PA Y  +E  +           +   LD NHS+F L D     +   E  +  R+R E  IS
Sbjct:   54 LGQKWEPAKHTANE--PTNAFGDIQFTGLGQRLGKFVRVGNDTEPSVLFKLMME-HWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSKEGKIVAIGIATWGIIHNKEHLIDA--QGKFPAEYPMDEAGQ----------GRLSCLDNNHSHFILVDNGTHGQYGVE--IVLRARLEQYIS 258          

HSP 3 Score: 60.8474 bits (146), Expect = 2.957e-9
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 1422 RADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
            R DIA  +IF +++KW+ GDL   M  AL+ +R +F+ LF+E G  L E+LT   LE LY
Sbjct:  382 RVDIATSEIFTDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLY 441          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 135.576 bits (340), Expect = 4.307e-32
Identity = 138/478 (28.87%), Postives = 223/478 (46.65%), Query Frame = 3
Query:  402 NSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGY---LVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKW----KKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYT----DQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            +S P++ +Q +++ +W++  P L+IS+ GG  +FE   KLK +  KGL KAA + G WI T G+N G++   G A++++  +   +K+  IGIAPW V+     L         P  YQ+          +    +K   L++ HS+F L D     K  +E   Q R   E  I+     T +        VP+ GLV  G    +  V   ++E    PVVVC+G+  AAD+LA     F   + ++  E           + +  E +  I         +++ L Q + E      L++VF    E+  D+D  I+++LL   N +++D     L  +         R DIAK  +F+  + W    +       M +AL+ DR DFVKL +E G S+ +FLT+  LE+LY      Q+ NL   +  F  L  ++K       + L +VG VI+ L+G  +  +Y  K F+ L
Sbjct:    8 DSRPDLLLQLMVK-EWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHA-SRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSP--YQT----------LSNPLSKLNLLNSLHSHFILVDDGTVGKYGAE--AQLRRELEKHIA-----TVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILA-----FLHKNTDDTGE---------LCDGLHDEIVGTIKKTFNFSHGQAMHLLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALLKGTNFSSADQLNLALAWD---------RVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILLHRFSHLPPDYK-------ITLIDVGLVIEFLMGGAFRSMYTRKRFRLL 434          

HSP 2 Score: 98.9821 bits (245), Expect = 7.806e-21
Identity = 127/560 (22.68%), Postives = 237/560 (42.32%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFW-----AMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKII-----SYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEM-------------------------GNRSILNKSNTLSYSKPQKFKR---LKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFS-----GISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQ 4031
            P  EL+ W++L+ + +MA  FW     ++ K  +A  L  S+   +  ++ D+   K  +    K F   A  +L++ + +DE+ A  L+  EL+ +   + + LA   +   F+AH C Q  L   W G L+ + ++      V L I+MP   P I+     S  E   IP  +   Q  Q+ +     +  D+ M                         GN S  +   +    +   + R   L   +RI  FY +P+++F +N+++Y+ FL+LF+  +L K +     +E  +  ++    +E +++   S     G     +    WN  DS  I LF +   LR              +Q +       L I ++      + F+YVR++ +F+ +  +GP ++MI KM+    +  MII+++ ++ +GV   A            +L KE        +  +   I+ + Y+ +FGE     +       ++ D  Y P      + P    +++ +  +++ NLLIA F   Y E ++ S   W + RY 
Sbjct:  479 PFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVK-FGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWF---KVILSILMP---PSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQEWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLDGYWNINDSLGILLFFVAVALR--------------SQSH-------LLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCM-LMIIMAIVLLSFGVARQA------------ILFKE-----ADPSWYLARNIVFQPYWMIFGEVYAPEID------NNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH 986          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 121.324 bits (303), Expect = 8.689e-28
Identity = 115/411 (27.98%), Postives = 182/411 (44.28%), Query Frame = 3
Query:  402 NSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIEN-KCPVVVCQGSSGAADVLALA---IDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSL--LNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKK---GDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
            +S P++ +Q +++ +W++  P L+IS+ GG  +FE   KLK +  KGL KAA + G WI T G+N G++   G A++++  +   +K+  IGIAPW V+     L         P  YQ+          +    +K   L++ HS+F L D     K  +E   Q R   E  I+  K  T +        VP+ GLV  G    +  V   ++E    PVVVC+G+  AAD+LA      D           +   +  L+  LE + R+ L      ++            ++    + ++  +       G   SS   LN A +                  +R DIAK  +F+  + W           M +AL+ DR DFVKL +E G S+ +FLT+  LE+LY
Sbjct:    7 DSRPDLLLQLMVK-EWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHA-SRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSP--YQT----------LSNPLSKLNLLNSLHSHFILVDDGTVGKYGAE--AQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGWAHTHRHGQAMHL--LQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNFSSADQLNLALA-----------------WDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELY 382          

HSP 2 Score: 108.997 bits (271), Expect = 6.517e-24
Identity = 134/551 (24.32%), Postives = 246/551 (44.65%), Query Frame = 3
Query: 2481 PARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKED----YKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKR---LKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQAT--------FSGI----------SFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGIS----PSC-----SSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQ 4031
            P  EL+ W++L+ + +MA  FW   +E +A AL+A  L  SLA ++      ED     K YS  F   A  +L++ + +DE+ A  L+  EL+ +   + + LA   +   F+AH C Q  L   W G L+ + ++      V L I+MP             SI + + KS+    +   I  S+E  +MGN S  +   +    +   + R   L   +RI  FY +P+++F +N+++Y+ FL+LF+  +L K +     +E  +  ++    +E +++ +         +G+              +    WN  DS  I LF +   LR              +Q +       L I ++      + F+YVR++ +F+ +  +GP ++MI KM++N +   +II+++ ++ +GV   A            +L KE        +  +   I+ + Y+ +FGE     + GI      +C     ++ D  Y P      + P    +++ +  +++ NLLIA F   Y E ++ S   W + RY 
Sbjct:  468 PFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWF---KVILSILMP------------PSILMLEYKSKAEMSH---IPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGILLFFVAVALR--------------SQSH-------LLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMAN-MFSIVIIMAIVLLSFGVARQA------------ILFKE-----ADPSWYLARNIVFQPYWMIFGEVYAPEIDGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH 961          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 50.0618 bits (118), Expect = 4.498e-6
Identity = 52/191 (27.23%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 3126 RIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVE--------FVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRI----ILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYG 3662
            R+  F   P I+FI ++ SYLTFL L         + +         + E +IL  WI  L+  EIKQ    G  FS Y  D WN +D    +L++    L+L+ Y KY    S   +Q+ +    ++ ++LF  +         F  +R++ +F+ +  LGP  I + +M+  D++ F+ I  + ++ + 
Sbjct:  216 RMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIARTDPNMQGPSPTLVEWMILP-WICRLIWAEIKQMWDGG--FSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSG--SKAREQWEMWHPTLVAEALFAIAN-------IFSSLRLISLFTANSHLGPLQISLGRMLL-DILKFLFIYCLVLLAFA 393          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 50.0618 bits (118), Expect = 5.028e-6
Identity = 52/191 (27.23%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 3126 RIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVE--------FVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRI----ILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYG 3662
            R+  F   P I+FI ++ SYLTFL L         + +         + E +IL  WI  L+  EIKQ    G  FS Y  D WN +D    +L++    L+L+ Y KY    S   +Q+ +    ++ ++LF  +         F  +R++ +F+ +  LGP  I + +M+  D++ F+ I  + ++ + 
Sbjct:  230 RMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIARTDPNMQGPSPTLVEWMILP-WICRLIWAEIKQMWDGG--FSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSG--SKAREQWEMWHPTLVAEALFAIAN-------IFSSLRLISLFTANSHLGPLQISLGRMLL-DILKFLFIYCLVLLAFA 407          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 201.06 bits (510), Expect = 1.151e-51
Identity = 174/590 (29.49%), Postives = 293/590 (49.66%), Query Frame = 3
Query: 2472 LERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDD---FTD-KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGI-IMPFV--IP----------------------KIISYKEDES---IPLGQTKSQDTQQN----QIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXX--------XXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISF-----STYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHF 4094
            L  P  ++ +W++L  + ++A + W   +E +A AL+AS LL  +A+++ +    TD   D   +++ FE +A GVL+EC+ E+E  +Q L+ +EL +Y + + + LA   +S  F+AH  CQ  LT  W G ++       +L  + L + I P +  +P                      K+ S+KE      +P+ ++K +    N    ++  EN +ED ++ +  I       S     + K+L +  RI  FY +P  +F+ N V YL F+ L++  +L         K        EI+L FW+ T+L+EEI+Q       +     S YFSD WN +D  ++T+F+I  ILR  T                      +F  S+  +   + FF VR + IFS +  LGPKL+MI+KM+  DL  F+IIL+VF I YG+  +A  +P     +  +  + N+          I +++   Y+ M+GE  LD +QG  P    ++   V     R L+PL L ++++ TN+LL NLLIA+F  T+E ++  S   W +QRY ++ E+ ++    PP +++ H 
Sbjct:  576 LPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLED-YIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFT-------------------NSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMM-QDLAQFIIILAVFTIAYGIALHAVMFP-----SPGIYARNNTWVT-------ITSVVQYPYWQMYGELFLDEIQGEKP----KEFGEVDPD-GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHI 1127          

HSP 2 Score: 187.193 bits (474), Expect = 2.099e-47
Identity = 157/481 (32.64%), Postives = 240/481 (49.90%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLN--QSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMV-AIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVF--DMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            PTNA+GEI+F G    + A ++R+ + T    + T++  +W L  P LVIS+ GG   F  K +L+ + ++GL KAA++ G WIIT G N G+MK  GEAV++    +G +  V  IGIA W +V K   L  S   G YPA+Y S E +  +   M         LD NHS+FFL D     K   E  +  RSR E +I   K +T S   +    VP+  LV+ G   T+  ++  +I+ K P VV  GS  AA V+  A +   K +++  +    I  ++ + E  +R  + ++    K   K    +K ++ E   ++SV+  D E   D+D  I+ +LL +  S                   R D+AK  IF E ++W    L+  M  AL+ D+ +F +LFL+ G S+ EFL++ IL KLY +   N   +      L       R VK + +  VG+VI+ L+GD +   Y
Sbjct:   91 PTNAYGEIDFEGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDL-ISEKNGKYPALY-SMEPTPGHQGAM---------LDPNHSHFFLVDDGTEGKYGVE--IGMRSRIEEAIM--KVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYE-LIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQT----INVIDPQYEDEVRAKVVEVFGA-KGADKTYSMIKDVL-EDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWN------RIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIK-----PLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYY 538          

HSP 3 Score: 97.8265 bits (242), Expect = 2.768e-21
Identity = 78/241 (32.37%), Postives = 130/241 (53.94%), Query Frame = 3
Query: 4923 YPG---MRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDS---YNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERA--NRYGIPWFLVDHNSGCELNECSNKTAITFLDQRL-QASYSGKKYEFLRKKI--VAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            YPG    R  V +NMV WQ+P+ DY   + +  ++L  N    D D   +       YN+ D+T  + R S  G Y +      P NP GRTG++GRGLL  +GPNH+   + TRW RT++G  + +  K++++++A++R   N++ IP  +V+          +      F ++ + + + S ++ E + K+I  +     +I+KG++DD  N DNAW+ETV +NFH+     F D  L+
Sbjct: 1282 YPGSTAKRFAVQDNMVDWQVPFPDYKPVNYTAPVVL-ANPVWADKDLMAMSPRPELPYNQMDHTCNVNRVSYNGTYVVK--DGLPLNPMGRTGMQGRGLLGRFGPNHAADPVVTRWKRTSAGVML-QGGKKVLEFVAIQRKDNNQWAIPGGMVEPG-----QLVTQALKAEFGEEAMAKLNVSQEEKERIAKQIERLFQQGQEIYKGYVDDPRNTDNAWMETVAVNFHDDKGDLFGDITLQ 1513          

HSP 4 Score: 24.2534 bits (51), Expect = 2.768e-21
Identity = 10/31 (32.26%), Postives = 19/31 (61.29%), Query Frame = 2
Query: 5633 VKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            V+W  ++ ++ L  SH  IL+ +++  DA F
Sbjct: 1521 VRWQRVSGNIPLYASHVSILEKVAKMRDAAF 1551          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 166.392 bits (420), Expect = 2.829e-41
Identity = 146/446 (32.74%), Postives = 224/446 (50.22%), Query Frame = 3
Query:  315 RKNYTLPTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGG-------NKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCP---VVVCQGSSGAADVLALA--IDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED-WDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLY 1601
            R   TLPT+AFGE+EF G  Q   AK++RL + T    +  +L  +W L  P L+IS+ GG  +F    K+K ++++GL KAA++ G W+IT G N G+M+  GEAV+ +T    G       +++  IGIA W +V   ++L N   +   P    S  +S            +   LD NHS+F L D     +   E  + FR+  E+ I+  K     +       VP+  LV+ G   T+R V  S+  ++CP   VV+ +GS  AAD+LA A    A    ++   ++  E   L  ++E    EC    +PE +    ++V LK +       V++F +++   ++D  I+ +LL S  S L          +      RADIAK +IF E++KW+   L   M  AL+ DR +FV L L+ G S+  FLTV  LE+LY
Sbjct:   10 RHTVTLPTDAFGELEFQGAGQPSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVE-VVPYQMTSSMQS------------RGACLDNNHSHFILVDNGTDGEYGGE--ISFRASLENLIASKKMAQKFHG------VPVVLLVLEGGPNTIRTVLESV--SRCPAVPVVIAEGSGRAADILAFAHRFIAPSNGEMSGVADVVEHRQLLHKIEKSFAEC----SPEDRLSIYQNV-LKCVAKR--EFVTIFCVDDGGLEVDKAILRALLKSQHSQLEDQLSLALVWD------RADIAKTEIFTEDQKWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELY 419          

HSP 2 Score: 125.561 bits (314), Expect = 1.153e-28
Identity = 135/501 (26.95%), Postives = 236/501 (47.11%), Query Frame = 3
Query: 2655 SKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSK-NSAMMLLASVGLGIIMPFVIPKI--ISYKEDESIPLGQTKSQDTQQNQIVIENSKE-------DVEMGNRSILNKSNTLSYSKPQKFKRLKYF---KRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQA------TFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSR---TLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWH 4091
            S+ F   A G+L+ECY  ++  AQ L+     Y+G  + + LA   +  +F+AH CCQ  LT  W G L +  N ++ +L    LGI+ P +I  +   S +E + +P     S D         + +E       D  +G+     K+   S ++ +    ++     KRI  FY +P+ +F  N + YL FL++FS  +L +       EE +L  ++ +L  EE++Q        FS    S + S+ WN  D  A+ LF +   LRL                       +L IG        +  + +R++ IFS    LGP ++MI +M + D++ F++I+ VF++ YGV   A  +P                 +   +  +I  I  + Y+ ++GE  ++    +  S +S++  +   K       L  + +  ++L+ N+LL NLLIA+F  T+ E++++S   W +QR+ ++ E+  +  LVPPFI+I H
Sbjct:  592 SREFYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVL----LGILFPPLIFALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVPSIEEWVLIGFVFSLCAEEVRQVRVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLRLNP--------------------GTLRIG-HLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRM-TIDMMYFLVIMVVFLLAYGVAQQAILFP-----------------HEKPSWELITKIFFRPYFQVYGELFIED---VDYSSNSRETAFSTPKFDEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPFILIAH 1046          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO31558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK7])

HSP 1 Score: 92.8189 bits (229), Expect = 5.480e-21
Identity = 73/237 (30.80%), Postives = 120/237 (50.63%), Query Frame = 3
Query: 4920 LYPG---MRMKVPNNMVSWQIPYQDYNAFDASQEILLY------PNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERAN--RYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFK-------GFLDDHLNADNAWVETVVINFHE 5576
            +YPG    R  VP+N+V+W+ P+ +Y   D +   +L       P+ +    D P+++    NK D    + R S  G Y +      P NP GRTGL+GRGLL  WGPNH+   + TRW R N G+ + +  K +++++A++R +   + IP  +VD           +  +IT   +  + + +  +     K  + A  T+ FK       G++DD  N DNAW+ET  +N+H+
Sbjct:   10 VYPGSNLQRFPVPDNLVTWKEPFPNYTPVDYTAPSVLKRPVWADPDTRQETVDPPLLF----NKLDKAYNVDRTSYTGMYEIK--NNVPLNPFGRTGLEGRGLLGRWGPNHAADPVVTRWKRDNKGNKVLQGGKPILEFVAIKRKDTGEWAIPGGMVD---------PGDTVSITLKKEFGEEAMNSMEVSQEEKDKLHAQLTECFKTGHNIYSGYVDDPRNTDNAWMETHAVNYHD 231          

HSP 2 Score: 28.4906 bits (62), Expect = 5.480e-21
Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 2
Query: 5633 VKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            V W  ++H +NL  SH  I++ +++   AFF
Sbjct:  251 VAWTPISHDLNLYASHADIVRQVAEYHHAFF 281          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO47659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT8])

HSP 1 Score: 83.1889 bits (204), Expect = 3.842e-17
Identity = 77/244 (31.56%), Postives = 123/244 (50.41%), Query Frame = 3
Query: 4935 RMKVPNNMVSWQIPYQDYNAFDASQEILLYPN---DQCFDADNPVIYKD--SYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRT-NSGSPIHRKNKRMMQYIALERAN--RYGIPWFLVDHNSGCELNECSNKT-AITFLDQRL---------QASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            R  VP+ +V WQ+P+  Y           +P+   D    A  P    D   +N  D+ + + R+S +G Y L      P NP GRTGL GRGLL  WGPNH+   + TRW R  ++G P+    KR+++++A++R++   + IP  ++      E+ +  +KT    F ++ L         +     K + F  + I      +++KG++DD  N DNAW+ETV +NFH+      T DIL+
Sbjct:   17 RYPVPDFLVDWQMPFPGY-----------FPDTYSDPSVAAQPPWADIDLLEFNSIDD-DGVDRRSHMGVYDL--FDGLPRNPMGRTGLIGRGLLGRWGPNHAADPIVTRWKRNPDTGQPLVLAGKRVLEFVAIQRSDTKEWAIPGGMM------EVGDTISKTLKKEFFEEALCSLEESEEEREKMEAKLHTFFSQGI------EVYKGYVDDPRNTDNAWIETVALNFHDE-----TGDILQ 229          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Match: EDO42032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N1])

HSP 1 Score: 56.6102 bits (135), Expect = 3.604e-11
Identity = 52/174 (29.89%), Postives = 81/174 (46.55%), Query Frame = 3
Query: 5103 LKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMM-QYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRK-----------KIVAATCTQ---IFKGFLDDHLNADNAWVETVVINFHES 5579
            + R+S +G Y  D I   P NP GRTG  GRG   HWGPNH+   + TR     S   I  +N +++ +++A++ A+            +   L E   K      +Q ++   S  K   L             + +  TC Q   ++ G++DD  N DNAW+ET V++FH+ 
Sbjct:   18 VDRRSHMGTY--DVINGLPRNPRGRTGFSGRGAFAHWGPNHTATFVITRLKLNPSDGHIVEENDQVVWEFLAVKEADE-----------TSWRLPEGEMKVTDYIPEQIIEDLLSLAKESILELSNGSLNLHDTLQHLCETCGQRVKLYSGYVDDPRNTDNAWLETNVVHFHDE 178          

HSP 2 Score: 31.187 bits (69), Expect = 3.604e-11
Identity = 12/33 (36.36%), Postives = 20/33 (60.61%), Query Frame = 2
Query: 5627 ETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            +++ WM L H  N+   H  +L+ +SQ+ D FF
Sbjct:  196 KSLTWMKLTHQANISAYHLNLLQKVSQQNDVFF 228          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 186.808 bits (473), Expect = 6.726e-47
Identity = 159/501 (31.74%), Postives = 256/501 (51.10%), Query Frame = 3
Query:  309 KIRKNYTLPTNAFGEIEFTGLNQS-AKFVRLLNST-PEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYG-GNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKI-NPEIKDFKKESV----QLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSA-ASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFL-TVYILEKLYTDQ-----LKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            K R    +PTNAFGEI+F GL Q+ AK+ R+ + T PEV +  +L  +W L  P L+IS+ GG  +F  K  L+ +  +GL K A++ G WIIT G N G+MK  G+AVRDY+ +     ++VAIG+A W V+   + L N   +G +PA+Y +++ S+           +   LD NH++F L D         E  ++ R+  E  IS    Q    ++S    +P+  +V+ G   TL  +FN++ +N  P V+ +G+   ADV+A                +   +PL+    ++I + + K    E K F + SV    +  Q +  + +L+++F + ED   D+D  I+ +LL ++ +S+         QLE+ +  NR DIAK +IF E+  W   DL+  MF+AL+ ++  FV L LE G SL +FL     L  LY +      L+ L  R+     L D++       N+ L  V   ++ L+G+    +Y
Sbjct:   81 KHRHVLDVPTNAFGEIQFDGLQQTTAKYARVSSETSPEV-LYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINE--EGCFPALYMTDKTSQ----------GRLSCLDKNHTHFLLVDDGTHGHYGVE--IELRTCLEKCIS--GKQLGKKDSS--VTIPVVCVVLEGGPGTLNTIFNAM-KNGTPCVIFEGTGRIADVIA----------------QVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSN-------NITLTHVSDEVRHLLGNATRHIY 538          

HSP 2 Score: 161.384 bits (407), Expect = 3.490e-39
Identity = 169/629 (26.87%), Postives = 287/629 (45.63%), Query Frame = 3
Query: 2451 RKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ--ATFSGISFST----YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFG---------EFGLDSLQ-----GISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKS 4277
            R   E++    + ++ +W++L     +AE+ W   ++ I  AL A+ +L  LA    D  + E+    + H+E  A GV +ECY  DE+RA  L+     ++G ++ + LA + +  +F+A    Q F+T  W G LS  N  + +L  +   +  P +    ++++ DE       K +  ++ + V  N+     +G             S P K   L  + R+ + Y SP ++F +N VSY  FL LF+  L+  F       E++L  W+ +L+ EE +Q      G  F      Y +D WN LD  +I LF++G   RL                     T  LF   +  +      F +R+M IF+    LGPK+I++R+M+  DL  FM +LS++++ YGV         G+   +D           +  D +    + + Y  +FG         +F LDS        + P C   + N+ P      L    L +++L  N+LL NLLIA+F  T++E++ ++   W +QRY++I E+ ++    PPFII  H     SLL R ++  ++  KS          +D  +  EL+ WE +    YL  + + T +S
Sbjct:  565 RPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICM---LFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLG-------------SAPDK--PLSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRL---------------------TSELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMM-KDLFFFMFLLSIWVVAYGVA------KQGILIHND-----------TRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPV-FPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHL----SLLIRSIWLCKSHCKSKD-------LKDQTEAMELLSWEALMKDRYLLSVKQETSRS 1124          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 186.037 bits (471), Expect = 1.020e-46
Identity = 159/501 (31.74%), Postives = 256/501 (51.10%), Query Frame = 3
Query:  309 KIRKNYTLPTNAFGEIEFTGLNQS-AKFVRLLNST-PEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYG-GNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKI-NPEIKDFKKESV----QLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNSA-ASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFL-TVYILEKLYTDQ-----LKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLY 1754
            K R    +PTNAFGEI+F GL Q+ AK+ R+ + T PEV +  +L  +W L  P L+IS+ GG  +F  K  L+ +  +GL K A++ G WIIT G N G+MK  G+AVRDY+ +     ++VAIG+A W V+   + L N   +G +PA+Y +++ S+           +   LD NH++F L D         E  ++ R+  E  IS    Q    ++S    +P+  +V+ G   TL  +FN++ +N  P V+ +G+   ADV+A                +   +PL+    ++I + + K    E K F + SV    +  Q +  + +L+++F + ED   D+D  I+ +LL ++ +S+         QLE+ +  NR DIAK +IF E+  W   DL+  MF+AL+ ++  FV L LE G SL +FL     L  LY +      L+ L  R+     L D++       N+ L  V   ++ L+G+    +Y
Sbjct:   81 KHRHVLDVPTNAFGEIQFDGLQQTTAKYARVSSETSPEV-LYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINE--EGCFPALYMTDKTSQ----------GRLSCLDKNHTHFLLVDDGTHGHYGVE--IELRTCLEKCIS--GKQLGKKDSS--VTIPVVCVVLEGGPGTLNTIFNAM-KNGTPCVIFEGTGRIADVIA----------------QVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSN-------NITLTHVSDEVRHLLGNATRHIY 538          

HSP 2 Score: 160.999 bits (406), Expect = 5.105e-39
Identity = 169/629 (26.87%), Postives = 287/629 (45.63%), Query Frame = 3
Query: 2451 RKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQ--ATFSGISFST----YFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFG---------EFGLDSLQ-----GISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKS 4277
            R   E++    + ++ +W++L     +AE+ W   ++ I  AL A+ +L  LA    D  + E+    + H+E  A GV +ECY  DE+RA  L+     ++G ++ + LA + +  +F+A    Q F+T  W G LS  N  + +L  +   +  P +    ++++ DE       K +  ++ + V  N+     +G             S P K   L  + R+ + Y SP ++F +N VSY  FL LF+  L+  F       E++L  W+ +L+ EE +Q      G  F      Y +D WN LD  +I LF++G   RL                     T  LF   +  +      F +R+M IF+    LGPK+I++R+M+  DL  FM +LS++++ YGV         G+   +D           +  D +    + + Y  +FG         +F LDS        + P C   + N+ P      L    L +++L  N+LL NLLIA+F  T++E++ ++   W +QRY++I E+ ++    PPFII  H     SLL R ++  ++  KS          +D  +  EL+ WE +    YL  + + T +S
Sbjct:  565 RPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICM---LFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLG-------------SAPDK--PLSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRL---------------------TSELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMM-KDLFFFMFLLSIWVVAYGVA------KQGILIHND-----------TRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPV-FPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHL----SLLIRSIWLCKSHCKSKD-------LKDQTEAMELLSWEALMKDRYLLSVKQETSRS 1124          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 176.022 bits (445), Expect = 1.412e-43
Identity = 159/497 (31.99%), Postives = 244/497 (49.09%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+   T    +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  I+      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:   94 PTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLVGKDVVRP-----YQT----------MSNPLSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGIIN-----ESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 541          

HSP 2 Score: 125.946 bits (315), Expect = 2.688e-28
Identity = 185/778 (23.78%), Postives = 344/778 (44.22%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKE------DVEMGNRS----------ILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSC----SSQDLNYVPTKVSRT---LNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIEN----IPRCQCTETVKVHGGSSRESDE 4640
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LG+++P  I  +    +DE   + Q +    Q+ +              D+E   RS          +L K  T +  K        + + +   ++I  FY +P+++F +++++Y+ +L+LF+  +L K  +    +E I+  +I T  +E++++   S           +  + WN  D  AI +F +G +LRL                      +  F+     + C ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A   P                 N   +  +   I    Y+ ++GE   D    I P C    ++ D   V     +T   + P  +  ++L+ N+LL NLLIA+F  T+ E++S S   W +QRYQ+I  F  +  L PP II  H   +   L  +   ++++++       I   ++LKK  +   +E     +Y R+ ++    S   R                     +  + V+N         E  H +    + VD++L+++ EL  +I    E +   G+  V V    +   S   +    + + +C +T  +   SS  S E
Sbjct:  583 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTVRSYCETQYNSVAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLRL---------------------QEPPFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNP-----------------NEDPSWMLARNIFFMPYWMIYGEVFADQ---IDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVLKHLCCRWRKHDDDERDYGLKLFIT-EDELKKVHD---FEEQCIEEYFREKDDRFHSSNDER-------------------IRVTSERVENMAMRLEEVNEREHFMKASLQTVDIRLAQMEELIGRIAVALERV--TGVERVEVGKARSRTSSDCTDSAYILRQAECQDTAYILRQSSFNSTE 1287          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 176.022 bits (445), Expect = 1.550e-43
Identity = 159/497 (31.99%), Postives = 244/497 (49.09%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+   T    +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  I+      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  105 PTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLVGKDVVRP-----YQT----------MSNPLSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGIIN-----ESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 552          

HSP 2 Score: 98.5969 bits (244), Expect = 6.077e-20
Identity = 114/450 (25.33%), Postives = 216/450 (48.00%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKE------DVEMGNRS----------ILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYP 3689
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LG+++P  I  +    +DE   + Q +    Q+ +              D+E   RS          +L K  T +  K        + + +   ++I  FY +P+++F +++++Y+ +L+LF+  +L K  +    +E I+  +I T  +E++++   S           +  + WN  D  AI +F +G +LRL                      +  F+     + C ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A   P
Sbjct:  594 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTVRSYCETQYNSVAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLRL---------------------QEPPFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNP 1015          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 176.022 bits (445), Expect = 1.631e-43
Identity = 159/497 (31.99%), Postives = 244/497 (49.09%), Query Frame = 3
Query:  333 PTNAFGEIEFTGLNQS--AKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGG--DFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVA-KNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENK-CPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTEL---GYLVSVFDM--EEDWDLDGYIISSLL---NSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVK-NVKLREVGKVIKILVGDFYHPLYLSKEFQNL 1778
            PT+AFG IEF G   S  A +VR+   T    +  ++  +W+L  P L+IS+ GG  +FE + KLK +  KGL KAA + G WI T G+N G+++  G+A++D+     G K+  IGIAPW +V  + D++   + +      YQ+          M    +K   L++ HS+F L D   + K  +E  V+ R + E  IS  K  T   +      VP+  L+V G    +  V   + +    PVVVC GS  A+D+LA       K+     SEE  I+      ES+  + L  I       + ++  L  I+ E      L++VF M  E   D+D  I+++LL   N++A D     L            R DIA+ +IF+  ++W  G L   M +AL+ DR DFVKL +E G S+  FLT+  LE+LY  +    N+   ++H + D  K +      + L ++G VI+ L+G  Y   Y  K F+ L
Sbjct:  143 PTDAFGTIEFQGGGHSNKAMYVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRG-KICTIGIAPWGIVENQEDLVGKDVVRP-----YQT----------MSNPLSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQG-----VPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFG----HKY-----SEEGGIIN-----ESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN---------RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNT---LYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTL 590          

HSP 2 Score: 98.2117 bits (243), Expect = 7.363e-20
Identity = 114/450 (25.33%), Postives = 216/450 (48.00%), Query Frame = 3
Query: 2439 ELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKS--DDFTD--KEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLS-SKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKE------DVEMGNRS----------ILNKSNTLSYSKP------QKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGIS-----FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGC-SLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYP 3689
            +LDD ++       P  ELM+W++L+ + +MA  FW   +E +A AL+A  L  ++A+++  +D  D   ++    S+ F   A  +L++ Y +DE+ A  L+  ELK +  ++ + LA   +   F+AH C Q  LT  W G L   KNS + ++    LG+++P  I  +    +DE   + Q +    Q+ +              D+E   RS          +L K  T +  K        + + +   ++I  FY +P+++F +++++Y+ +L+LF+  +L K  +    +E I+  +I T  +E++++   S           +  + WN  D  AI +F +G +LRL                      +  F+     + C ++ ++Y+R++ IF  +  LGP ++MI KM+  D++ F+II+ V ++ +GV   A   P
Sbjct:  632 DLDDPEINHFPF--PFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVI----LGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTVRSYCETQYNSVAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMDLWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLRL---------------------QEPPFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILNP 1053          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 3567.7 bits (9250), Expect = 0.000e+0
Identity = 1858/1859 (99.95%), Postives = 1859/1859 (100.00%), Query Frame = 3
Query:   36 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQXXXXXXXXXXXXXXXXYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFXXXXXXXXXXXXXYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNXXXXXXLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIPRKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFSLNKHSKSLLHLNYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIPRKEPE+STVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK
Sbjct:  196 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFSLNKHSKSLLHLNYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIPRKEPELSTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 2054          

HSP 2 Score: 82.8037 bits (203), Expect = 2.866e-15
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 2
Query: 5612 EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF
Sbjct: 2058 EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 2095          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 3488.35 bits (9044), Expect = 0.000e+0
Identity = 1821/1824 (99.84%), Postives = 1822/1824 (99.89%), Query Frame = 3
Query:   36 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQXXXXXXXXXXXXXXXXYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFXXXXXXXXXXXXXYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNXXXXXXLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIP-RKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIF 5504
            NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFSLNKHSKSLLHLNYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIP RKEPE+STVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQ F
Sbjct:  196 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFSLNKHSKSLLHLNYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIPSRKEPELSTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQAF 2019          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 1951.41 bits (5054), Expect = 0.000e+0
Identity = 1043/1093 (95.43%), Postives = 1044/1093 (95.52%), Query Frame = 3
Query:   36 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQXXXXXXXXXXXXXXXXYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKINSNNSYEKAFKSNLKATSFNEYKMLVFXXXXXXXXXXXXXYIDQMDIDATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNXXXXXXLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEFVCEEIILTFWIGTLLLEEIKQATF 3314
            NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKIN                                               ATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQ  +
Sbjct:  196 NKDSYWFPLNIQIFVCGFPEFVNNLNCANCSHNIKFHDVFVQNSKLKMISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISFWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQNQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEKIN-----------------------------------------------ATDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEFSFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENFQNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQTNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGALLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNSVSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQVKY 1241          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000078720.1 (SMESG000078720.1)

HSP 1 Score: 1336.63 bits (3458), Expect = 0.000e+0
Identity = 674/676 (99.70%), Postives = 675/676 (99.85%), Query Frame = 3
Query: 3588 MIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIP-RKEPEISTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 5612
            MIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIP RKEPE+STVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK
Sbjct:    1 MIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTILMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVLLTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSAILALRSELQPLMSDFSIPSRKEPELSTVDETEQESFVPNDDTGDYNKDPFTTPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIPYQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDILK 676          

HSP 2 Score: 82.4185 bits (202), Expect = 2.334e-15
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 2
Query: 5612 EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 5725
            EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF
Sbjct:  680 EINSPETVKWMDLAHSVNLRTSHDMILKTISQRMDAFF 717          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000041546.1 (SMESG000041546.1)

HSP 1 Score: 310.457 bits (794), Expect = 5.877e-85
Identity = 227/710 (31.97%), Postives = 387/710 (54.51%), Query Frame = 3
Query: 2466 ISLERPARELMIWSLLVGKLQMAELFWAMEKEQIXXXXXXXXXXXXXXNKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQLLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNSAMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENSKEDVEMGNRSILNKSNTLSYSKPQKFK-RLK-YFKRIKAFYFSPVIRFIYNSVSYXXXXXXXXXXXXXXXXVEF-----VCEEIILTFWIGTLLLEEIKQATFSGISFSTYFSDGWNKLDSTAITLFVI---GFILRLITYFKYYNELSDLNQQYRIILTDSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPFMIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIM-TILMKSYYPMFGEFGLDSLQGIS--PSCSSQDLNYVPTKVSRTLNPXXXXXXXXXXXXXXXXXXIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPFIIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEHMKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDNKPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISLVGVKTMNNEL 4556
            + L+RP REL IWSLL  +++MA+L W +EKE IA AL A+ LL S+ N ++  +DK+D   ++K FE++AEGV+ EC+ E+ +  +  + ++L YYG+S+ + +AA G SIKF+AH  CQ+ L   W G L     +M  +  + +G+I PF+IP I+++K    +P  +      +       ++++  E   +     SNT    + + F  +LK YFK++  FY +PVI+F Y    YL F+L F+   L  + +++     +   I+L FW  +LL+EE +QA  SGIS   Y +D WN +D  + + F++   G I+ L          S  +    + ++ +L   S+   G S+F F VR++  FS ++ LGP ++MIR M++NDL PF++IL   ++ YG+   +  + +    T        S+F      SMI+  + +  Y+ +FG   +D L+G +    C++ +L   P      L P+   ++++L+NVL+ NLL+A+F+ TYE I+SSS  YW  +RYQ++ +  ++ P+ PP II W  Y +++    +L T    K     PF I++S    KE++L++WE M+A DY+R  +E ++  R         +V RG  + G+            K DF S   EI     +R   V+ +L K++ +E  + +  + ++++G +L     +NNE+
Sbjct:  758 LPLKRPYRELFIWSLLTLRMEMAQLLWTLEKESIAAALFAANLLRSMKNLTNVISDKDDLDEWAKDFETKAEGVVEECFKENPEFTRDNLIRQLDYYGRSTYLEMAADGNSIKFIAHRSCQELLDFVWRGTLDDTTKSMNFIMYLIIGVICPFMIPFIVNFKSLFYLPESEIVEYKKKLKNKQKISTRQCSESEKKD----SNTKKIPRKRNFTFQLKTYFKKMYDFYNAPVIKFSYTIFFYLIFILYFTFLNLTAYHIKYSKNSNLWIYILLIFWTVSLLIEEARQAFGSGISIKEYLNDIWNIIDILSHSFFLLGTFGIIMTLSDPLAKSLLFSLFDITPMVSISVNLLRFSKFMYGFSIFLFTVRILQYFSINVKLGPIIVMIRNMLTNDLGPFIVILLTVLVSYGILLGSINFEVKPNLT-------MSEF------SMILYEMFLTGYFQLFGNLRIDVLRGENNLRQCANNNL-MCPDVWGVWLGPIIAAVYMVLSNVLMLNLLVAIFSNTYEIIQSSSTQYWTLERYQLMRQSSSRPPVAPPLIIFWQIYFVFA----RLIT---IKVGQKQPFKISYSSLPYKEKQLIQWERMRANDYIRSFDEQSKSKRNKTTL----IVNRGPAAIGSIGGM--------KKDFESTKNEILQSFSERISIVEFRLQKMDIIEENVNTIYDILRKLGPNL----PLNNEI 1426          

HSP 2 Score: 238.039 bits (606), Expect = 1.336e-62
Identity = 171/503 (34.00%), Postives = 282/503 (56.06%), Query Frame = 3
Query:  300 DPEKIRKNYTLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVISIFGGDFEXXXXXXXXXXXGLWKAA--ESAGCWIITEGLNMGIMKLAGEAVRDYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETNDDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSIS----FWKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGSSGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEIKDFKKESVQLKQIVTELGYLVSVFDMEED--WDLDGYIISSLLNS-AASDXXXXXXXXXXXXXXXXXXRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHDFVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFH---RLWDNHKTHRLVKNVKLREVGKVIKILVGDFYHPLYLSKEFQ 1772
            D E + K    PTN FGEIEF+GL +S  +VR+  +T      ++L  +W++  P+L+ISI+G DFE      ++ K G+ K+A       WIIT+G+   ++++ G+A+RD+TDAYG N+M    I PW++  + + L +  YQGT+PA Y      +T          K +  D NHS++   D P  +++  +  + +R  FE+ +S    F  +   ++E     +VP+CG++V G+   L+ +  S+++N  P V+ +GS G A+++   +   ++ + ++ S  FE +  +  L+ I+ E       EI D  +E V + Q + E  +L+ ++ +EE+   +LD  I+SSLL+    S    + LN+ QL + +++NR D+AKEKIF E KKWK  DL      ++  ++  FVKLF+E+GF L + +TV +LE LYT  + N      I +   RL    K +   K V L ++G V+K L+GD Y+PLYL+ EFQ
Sbjct:  280 DTENVEK----PTNFFGEIEFSGLYKSKPYVRMSINTKFETTASLLIDQWKITKPSLIISIYGSDFEGHAIKDILKK-GILKSAGNRETFVWIITDGIFTNLIEVIGKAIRDFTDAYGENQMYGFAITPWSIHNETEYLCSKDYQGTHPAEYNKISSKDT----------KSQKFDQNHSHYIFVDIP-RTEDTMKSFIDYRLTFENQVSKLNEFLANTKMNFE-----KVPLCGILVSGNRDDLKLLHGSLVKNGKPTVIIKGSGGLANIIGELVYEMKEKNRKKKS--FEEIMQKEYLKMIMTEIW-----EISDEYEEEVIMIQEIIENRHLIEIYSVEENNPNELDKNILSSLLSQDENSVKHPDHLNIYQLGVAISINRHDVAKEKIFTEGKKWKTEDLIPLATKSISENKVGFVKLFVEKGFFLGKIITVELLENLYTADISNGTKLARILNQGLRLIGFKKNN---KRVSLYDIGGVLKYLLGDLYYPLYLNPEFQ 751          

HSP 3 Score: 71.2478 bits (173), Expect = 8.659e-12
Identity = 57/210 (27.14%), Postives = 94/210 (44.76%), Query Frame = 3
Query: 5040 FDADNPVIYKDSYNKYDNTNKLKRQSMLGQYALDPITCAPFNPXXXXXXXXXXXXPHWGPNHSIIMLFTRWN--RTNSGSPIHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECS---------------NKTAI---TFLDQRLQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHESDKFHFTDDIL 5609
            F A+ PV +       ++ +K  +  +L +  ++     P NP       G+ LLP WG N  I +L +RW     +  + I+   K ++Q + +   N   +P+ +V HN+ CE N CS               NK      TFL+++   S +  KY+            ++++G+L D  N+DN+W+ET   N H  D   FT  IL
Sbjct: 1482 FTAEQPVEF------IEDDSKESQNEVLTEDLIEFPNGIPRNPHETLNKIGKPLLPFWGVNSCIHLLISRWKPWEKDDENDIY---KSILQVLGIRTTNHIELPFIIVQHNAECEQNLCSSSKLEQIIRDYFIEINKKKADNKTFLNEKEFESLNNSKYD------------KVYEGYLKDFRNSDNSWLETSAFNIHLEDNLEFTKPIL 1670          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM21.555e-4732.75transient receptor potential cation channel subfam... [more]
TRPM21.321e-4632.11transient receptor potential cation channel subfam... [more]
TRPM21.621e-4632.11transient receptor potential cation channel subfam... [more]
TRPM21.621e-4632.11transient receptor potential cation channel subfam... [more]
TRPM51.359e-4527.03transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gon-21.618e-4230.00Transient receptor potential channel [Source:UniP... [more]
gon-21.640e-4230.00Transient receptor potential channel [Source:UniP... [more]
gon-22.210e-4230.00Transient receptor potential channel [Source:UniP... [more]
gtl-12.952e-4231.71GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gon-21.611e-3629.66Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm2.344e-4228.50gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm3.403e-4131.65gene:FBgn0265194 transcript:FBtr0339078[more]
Trpm3.490e-4131.65gene:FBgn0265194 transcript:FBtr0339077[more]
Trpm3.941e-4131.65gene:FBgn0265194 transcript:FBtr0339081[more]
Trpm4.463e-4131.65gene:FBgn0265194 transcript:FBtr0339076[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm22.847e-4929.85transient receptor potential cation channel, subfa... [more]
trpm51.472e-4833.87transient receptor potential cation channel, subfa... [more]
trpm51.504e-4833.87transient receptor potential cation channel, subfa... [more]
trpm52.235e-4833.87transient receptor potential cation channel, subfa... [more]
hrc4.162e-4729.80histidine rich calcium binding protein [Source:ZFI... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shc21.809e-4932.45SHC (Src homology 2 domain containing) transformin... [more]
c8b4.596e-4932.60complement component 8, beta polypeptide [Source:X... [more]
shc24.361e-4730.99SHC (Src homology 2 domain containing) transformin... [more]
shc24.923e-4731.70SHC (Src homology 2 domain containing) transformin... [more]
shc25.126e-4731.70SHC (Src homology 2 domain containing) transformin... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm34.419e-4431.73transient receptor potential cation channel, subfa... [more]
Trpm34.556e-4431.73transient receptor potential cation channel, subfa... [more]
Trpm34.860e-4431.73transient receptor potential cation channel, subfa... [more]
Trpm34.995e-4431.73transient receptor potential cation channel, subfa... [more]
Trpm67.722e-4429.84transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE2.807e-5029.49Transient receptor potential cation channel subfam... [more]
sp|A0A0R4IMY7|TRPM2_DANRE2.149e-4829.85Transient receptor potential cation channel subfam... [more]
sp|O94759|TRPM2_HUMAN7.782e-4632.11Transient receptor potential cation channel subfam... [more]
sp|Q9BX84|TRPM6_HUMAN7.697e-4530.37Transient receptor potential cation channel subfam... [more]
sp|Q9NZQ8|TRPM5_HUMAN8.851e-4526.88Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GS137.854e-6944.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EZB12.538e-4744.85Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A183A5N41.609e-8348.86Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A068YIN28.946e-8848.30Transient receptor potential cation channel OS=Ech... [more]
A0A068WHQ04.713e-8848.21Transient receptor potential cation channel OS=Ech... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrc9.239e-4530.11transient receptor potential cation channel subfam... [more]
trpm52.530e-4227.52transient receptor potential cation channel subfam... [more]
trpm1b6.778e-4026.43transient receptor potential cation channel subfam... [more]
trpm1b9.588e-4026.43transient receptor potential cation channel subfam... [more]
trpm1b1.174e-3926.56transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.603e-4126.50transient receptor potential cation channel, subfa... [more]
trpm74.307e-3228.87transient receptor potential cation channel, subfa... [more]
trpm78.689e-2827.98transient receptor potential cation channel, subfa... [more]
trpc4b4.498e-627.23transient receptor potential cation channel, subfa... [more]
trpc4b5.028e-627.23transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO301351.151e-5129.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476582.829e-4132.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315585.480e-2130.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476593.842e-1731.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420323.604e-1129.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm26.726e-4731.74transient receptor potential cation channel subfam... [more]
trpm21.020e-4631.74transient receptor potential cation channel subfam... [more]
trpm31.412e-4331.99transient receptor potential cation channel subfam... [more]
trpm31.550e-4331.99transient receptor potential cation channel subfam... [more]
trpm31.631e-4331.99transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078720.12.866e-1599.95SMESG000078720.1[more]
SMESG000078720.10.000e+099.84SMESG000078720.1[more]
SMESG000078720.10.000e+095.43SMESG000078720.1[more]
SMESG000078720.12.334e-1599.70SMESG000078720.1[more]
SMESG000041546.15.877e-8531.97SMESG000041546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021821 ID=SMED30021821|Name=Transient receptor potential cation channel subfamily M member|organism=Schmidtea mediterranea sexual|type=transcript|length=5791bp
ATCTGTTATTTGGTGATTGTTAATGCAAATAATATAATAAAGATAGCTAT
TGGTTTCCGTTGAATATACAAATTTTTGTTTGCGGTTTTCCAGAATTCGT
AAATAATTTGAATTGTGCCAATTGTTCCCATAATATCAAGTTTCACGACG
TATTTGTCCAAAACAGCAAATTAAAGATGATTTCAATGAATTCCTCTAAG
AAAAGTAGTTACCGTGGACTCGGAGGTGCTAATCATGGTGAATTTGAAGG
AATTGCACAAATTCTTGAGGAAAGTAAAGGTCATTTGTCTACAAATTTTG
ATCCTGAAAAAATCCGTAAAAATTATACATTGCCTACAAATGCGTTTGGA
GAAATTGAATTTACTGGACTCAATCAAAGTGCAAAATTTGTTCGACTGCT
TAATTCAACCCCAGAAGTAAATATACAAACTATTCTACAAATCAAATGGG
AATTATATCATCCTACCCTCGTTATTAGCATTTTTGGTGGAGATTTCGAA
AAGAAACGAAAACTAAAAATGATTATTAAAAAAGGCCTCTGGAAAGCAGC
AGAAAGTGCTGGGTGTTGGATTATAACAGAAGGTTTAAATATGGGAATAA
TGAAACTTGCAGGAGAAGCTGTTCGAGATTATACTGACGCATATGGAGGA
AATAAAATGGTAGCGATAGGAATCGCACCATGGAACGTAGTGGCAAAGAA
TGACGTTTTAGAAAATTCTCTTTACCAAGGTACTTATCCAGCAATTTATC
AGTCGGAGGAAGAGTCGGAAACCAATGATGACGGGATGGTTAAGGATAGA
AATAAAGAAAAGTCACTTGACACGAATCATTCGTACTTCTTCTTGTATGA
TTGTCCAGCGTCGTCGAAGGAAATATCGGAACCTGATGTACAATTCAGAT
CACGATTTGAACATTCAATTTCGTTTTGGAAATCTCAGACTTCTAGCTAT
GAAACGTCAAATGATACGAGAGTTCCGATTTGTGGATTAGTGGTTGGTGG
AGACATTCTGACTCTTAGACAGGTTTTCAATTCAATAATAGAAAATAAAT
GCCCAGTCGTAGTATGCCAGGGATCGAGTGGAGCAGCTGACGTTTTAGCT
TTAGCTATAGATGCTTTTCAGAAGTTTGACCTGGAAGAAGGTTCTGAAGA
GTTTGAAATCGTCCCATTGGAGGCAAGATTGGAAAGCATTATCAGAGAGT
GCCTTTTCAAAATAAATCCAGAAATAAAGGATTTTAAAAAGGAGAGCGTA
CAACTTAAACAAATAGTAACTGAGTTAGGTTACTTGGTATCGGTGTTTGA
TATGGAAGAAGATTGGGATCTAGATGGATACATTATTTCTTCTCTCTTGA
ACAGCGCTGCATCCGATTTGACTCAAAATCAACTGAATCTTGAACAATTG
GAAATTACGTTGACACTAAACCGAGCAGACATAGCAAAGGAGAAAATATT
TTTAGAAAATAAAAAATGGAAGAAAGGAGATCTAAACGATTATATGTTCA
ACGCTCTCATGAGTGACAGACATGACTTTGTCAAATTATTTCTTGAACAA
GGTTTCAGTTTAGAGGAATTTCTTACTGTGTATATTTTGGAGAAATTGTA
TACAGATCAGTTAAAGAATTTAAATTCAAGAATAGAAATATTTCACCGGT
TGTGGGACAATCACAAAACTCACAGATTGGTTAAAAATGTCAAACTACGA
GAAGTTGGGAAAGTTATTAAAATTCTCGTGGGAGATTTCTATCATCCGCT
GTATCTCTCGAAAGAATTTCAAAATCTCGTTTCAAAAACAGATAGAAAAC
GTTCTACAATGACTCACTCAGAGAAAATAAATTCAAACAATTCTTATGAA
AAAGCATTTAAATCGAATTTGAAGGCAACTTCATTTAATGAATACAAAAT
GTTGGTTTTTTCGTTAAATAAACATTCGAAGTCTCTTCTTCATTTAAATT
ACATCGACCAAATGGACATCGACGCAACTGATAGAAAGACTAACTGCGAT
GATAGACAGAATCATTCTTATGAAAACAATGGAATGGACTCGGACACGAA
TGCTCAGCATGAAATAAAATTTTCCGAAATAATAGACATTAATAGACGCC
AAACCAACAAACCAGATGAAGAATTCAGTTTCAAAAAAAATCGCCGCCGA
TCTTCCTCGTTGGATATGATTAACATTCTTGGTCAAAACAGAGAAAATTT
CACTGGAACTACTGAAAATTATTTAAGTGTAGATTCCAATGAACCGAAAA
TCAACAATAAAATTCCCGAAAATTTTCAAAATTCTGCAATTAGACGAATT
TCCTCTCTCGATTTTCACGAAATAGATCGCATGCTTCATGCAAAATCTAA
ATCAACTCTCTATTCAGAAACATCGGAAAACGACCTATTAAAATATCAAA
ATGAAAATTTAGGGAACATTATTCAAACAAACTTTGACGAACTCGATGAT
CGAAAATTAAAAGAAATTTCTCTCGAGAGACCAGCAAGGGAATTGATGAT
TTGGTCATTACTGGTCGGCAAACTTCAAATGGCTGAACTCTTTTGGGCAA
TGGAGAAGGAGCAAATAGCAGGAGCTCTTTTAGCCTCTATGCTTTTGACA
TCTCTTGCCAACAAGTCAGATGATTTTACTGATAAAGAAGATTACAAAAC
TTATTCAAAACATTTTGAAAGTCAAGCAGAAGGAGTTCTGAATGAATGTT
ACATAGAAGATGAAAAACGCGCTCAGTTGCTAATTAATAAAGAACTTAAG
TATTATGGGCAAAGTTCAGTAATTCTTTTAGCTGCCCAAGGCCAGAGCAT
AAAGTTTATGGCCCATCCTTGTTGTCAAGATTTCCTTACCAGTACTTGGT
ATGGAAATCTTTCTAGTAAAAATTCAGCAATGATGTTACTTGCAAGTGTT
GGTCTAGGAATAATTATGCCATTTGTGATTCCAAAAATAATTTCGTACAA
AGAAGATGAATCTATTCCTTTAGGACAAACGAAATCTCAAGACACTCAAC
AAAATCAAATTGTCATTGAAAACTCAAAAGAGGATGTTGAAATGGGGAAT
AGGTCAATTTTAAACAAATCAAATACTTTATCATATTCCAAGCCTCAGAA
ATTTAAACGGTTGAAATACTTTAAAAGAATAAAAGCCTTTTATTTTTCAC
CAGTGATAAGATTTATTTATAATTCAGTTTCTTATCTTACATTTTTGCTA
CTGTTCAGTACATTTTTATTGTTTAAATTCAAAGTGGAATTCGTGTGTGA
AGAAATTATTCTAACGTTTTGGATTGGCACGCTTTTGTTAGAAGAAATCA
AGCAAGCTACATTTTCTGGAATCAGTTTTTCAACATATTTTTCTGACGGG
TGGAACAAACTGGATTCCACTGCAATAACTTTGTTTGTAATTGGGTTTAT
TTTACGTTTAATTACGTATTTTAAATATTATAACGAATTGTCGGATTTAA
ATCAGCAGTACCGAATAATTTTAACGGATTCTCTATTTATTGGTTCCCAA
ACTTGTATGGGCTGCAGCTTGTTTTTCTTCTACGTGAGAGTGATGTATAT
TTTCAGTTTTCACATCGCTTTGGGTCCCAAGTTAATTATGATTCGTAAGA
TGATTTCGAATGATTTGATTCCGTTTATGATTATTCTGTCTGTATTCATG
ATTGGGTACGGAGTAACGTTTTATGCAAATGCGTATCCGTTAGGATTACA
GTTTACTGACGACATGTTGACTAAAGAAAATTCTCAATTTAACACATCTA
GCACAGACTCTATGATAATGACAATTTTGATGAAATCATATTATCCCATG
TTTGGAGAATTCGGTTTAGACAGCCTTCAAGGAATCAGTCCATCATGCAG
TTCTCAAGATTTAAATTATGTTCCAACTAAAGTCAGTCGTACATTAAACC
CGTTGTTTTTGGGTCTGCACGTCTTGTTGACAAATGTACTGCTCTTCAAT
TTGCTCATTGCCATGTTTACAAAAACCTATGAAGAAATTGAAAGTTCTTC
CGTTTACTATTGGAATTATCAAAGATATCAAATGATTTCAGAATTCGTCA
ACAAATCGCCACTTGTACCCCCTTTTATCATTATTTGGCATTTTTATGAA
ATATATTCTTTATTAAAAAGAAAGTTATTTACAAATGAAAATGAAAAAAA
GTCCAACTCAGATCCTTTTTGTATTAATTTTTCAGAAGATTTAAAAAAGG
AAAGGGAATTAGTTAAATGGGAGCACATGAAAGCCATGGATTATCTGAGG
AAATTAAATGAGCCTACTCAAAAGTCTCGTCAAACCCGAGGTGCTGATGG
ACGGTCCTTGGTGTTTCGAGGATTCGGTTCAGGGGGAGCTGCAACTAACG
CTCTTGTACCTCAAGCCGTTGATAACAAACCAGATTTCACAAGTTTGACA
GAAGAAATAAATCACCAGCTGGACAAACGTTTCAAAGAAGTTGACGTCAA
ACTCAGTAAATTAAATGAACTCGAGTCTCAAATTGGATCTTTCGCGGAGA
ATATTAAAGAAATTGGAATATCTTTGGTTGGAGTTAAAACGATGAATAAT
GAGTTATTATCAAAGATAGAAAATATTCCAAGATGTCAGTGCACGGAGAC
AGTAAAAGTTCACGGAGGCAGTTCTCGAGAATCGGACGAAGAAATTACAA
AATTAGAATTGGCAGTCAGATCGGCTATATTAGCTTTGAGATCTGAATTG
CAGCCTTTGATGTCCGATTTTAGTATTCCCAGAAAAGAACCTGAAATTTC
AACTGTCGATGAAACTGAACAAGAAAGCTTTGTACCCAATGATGACACTG
GAGATTACAATAAAGACCCATTTACTACACCAAATGTTGAAAATTTAACT
ACAGGACGCTTAATTGAACGAATTGTCAACAATCATAGATTGTGGAGGTA
CCAACCATTCAATTTTGAATTATATCCGGGAATGCGAATGAAAGTTCCAA
ATAATATGGTCTCATGGCAGATTCCATATCAAGATTACAACGCTTTTGAT
GCAAGTCAAGAAATTTTACTTTATCCCAATGATCAGTGTTTTGATGCAGA
TAATCCGGTCATATATAAGGATTCCTATAATAAATATGATAACACTAACA
AATTGAAGCGTCAAAGCATGCTTGGGCAGTACGCGCTTGATCCAATTACC
TGTGCTCCATTTAATCCAACAGGCAGAACAGGACTCAAAGGACGAGGTTT
ACTTCCTCATTGGGGCCCAAACCATTCAATTATAATGTTGTTTACAAGAT
GGAATAGAACGAATTCTGGAAGTCCAATCCATAGGAAAAATAAAAGAATG
ATGCAATATATTGCGCTTGAAAGAGCCAACAGATATGGAATACCTTGGTT
TCTCGTTGATCATAACAGTGGATGTGAATTAAATGAATGTTCCAATAAAA
CTGCAATCACATTTCTAGATCAGAGACTTCAAGCCTCATATTCTGGAAAG
AAATATGAATTTCTTAGGAAGAAAATTGTAGCCGCTACATGTACTCAGAT
TTTTAAAGGCTTTCTTGATGATCACTTAAATGCCGACAACGCCTGGGTTG
AAACGGTGGTTATCAATTTCCATGAATCAGATAAATTTCATTTCACTGAT
GATATCTTAAAGAAATAAATTCGCCAGAAACTGTCAAATGGATGGATTTA
GCGCACAGTGTCAATTTAAGAACTAGCCATGACATGATCCTCAAGACTAT
TTCCCAAAGGATGGATGCTTTCTTTTAAGATTTATTGCATTGTTAGAGTA
ACAGAAATTTATGGATAATATAAATTAAATAAATAGTTCAC
back to top

protein sequence of SMED30021821-orf-1

>SMED30021821-orf-1 ID=SMED30021821-orf-1|Name=SMED30021821-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1814bp
MISMNSSKKSSYRGLGGANHGEFEGIAQILEESKGHLSTNFDPEKIRKNY
TLPTNAFGEIEFTGLNQSAKFVRLLNSTPEVNIQTILQIKWELYHPTLVI
SIFGGDFEKKRKLKMIIKKGLWKAAESAGCWIITEGLNMGIMKLAGEAVR
DYTDAYGGNKMVAIGIAPWNVVAKNDVLENSLYQGTYPAIYQSEEESETN
DDGMVKDRNKEKSLDTNHSYFFLYDCPASSKEISEPDVQFRSRFEHSISF
WKSQTSSYETSNDTRVPICGLVVGGDILTLRQVFNSIIENKCPVVVCQGS
SGAADVLALAIDAFQKFDLEEGSEEFEIVPLEARLESIIRECLFKINPEI
KDFKKESVQLKQIVTELGYLVSVFDMEEDWDLDGYIISSLLNSAASDLTQ
NQLNLEQLEITLTLNRADIAKEKIFLENKKWKKGDLNDYMFNALMSDRHD
FVKLFLEQGFSLEEFLTVYILEKLYTDQLKNLNSRIEIFHRLWDNHKTHR
LVKNVKLREVGKVIKILVGDFYHPLYLSKEFQNLVSKTDRKRSTMTHSEK
INSNNSYEKAFKSNLKATSFNEYKMLVFSLNKHSKSLLHLNYIDQMDIDA
TDRKTNCDDRQNHSYENNGMDSDTNAQHEIKFSEIIDINRRQTNKPDEEF
SFKKNRRRSSSLDMINILGQNRENFTGTTENYLSVDSNEPKINNKIPENF
QNSAIRRISSLDFHEIDRMLHAKSKSTLYSETSENDLLKYQNENLGNIIQ
TNFDELDDRKLKEISLERPARELMIWSLLVGKLQMAELFWAMEKEQIAGA
LLASMLLTSLANKSDDFTDKEDYKTYSKHFESQAEGVLNECYIEDEKRAQ
LLINKELKYYGQSSVILLAAQGQSIKFMAHPCCQDFLTSTWYGNLSSKNS
AMMLLASVGLGIIMPFVIPKIISYKEDESIPLGQTKSQDTQQNQIVIENS
KEDVEMGNRSILNKSNTLSYSKPQKFKRLKYFKRIKAFYFSPVIRFIYNS
VSYLTFLLLFSTFLLFKFKVEFVCEEIILTFWIGTLLLEEIKQATFSGIS
FSTYFSDGWNKLDSTAITLFVIGFILRLITYFKYYNELSDLNQQYRIILT
DSLFIGSQTCMGCSLFFFYVRVMYIFSFHIALGPKLIMIRKMISNDLIPF
MIILSVFMIGYGVTFYANAYPLGLQFTDDMLTKENSQFNTSSTDSMIMTI
LMKSYYPMFGEFGLDSLQGISPSCSSQDLNYVPTKVSRTLNPLFLGLHVL
LTNVLLFNLLIAMFTKTYEEIESSSVYYWNYQRYQMISEFVNKSPLVPPF
IIIWHFYEIYSLLKRKLFTNENEKKSNSDPFCINFSEDLKKERELVKWEH
MKAMDYLRKLNEPTQKSRQTRGADGRSLVFRGFGSGGAATNALVPQAVDN
KPDFTSLTEEINHQLDKRFKEVDVKLSKLNELESQIGSFAENIKEIGISL
VGVKTMNNELLSKIENIPRCQCTETVKVHGGSSRESDEEITKLELAVRSA
ILALRSELQPLMSDFSIPRKEPEISTVDETEQESFVPNDDTGDYNKDPFT
TPNVENLTTGRLIERIVNNHRLWRYQPFNFELYPGMRMKVPNNMVSWQIP
YQDYNAFDASQEILLYPNDQCFDADNPVIYKDSYNKYDNTNKLKRQSMLG
QYALDPITCAPFNPTGRTGLKGRGLLPHWGPNHSIIMLFTRWNRTNSGSP
IHRKNKRMMQYIALERANRYGIPWFLVDHNSGCELNECSNKTAITFLDQR
LQASYSGKKYEFLRKKIVAATCTQIFKGFLDDHLNADNAWVETVVINFHE
SDKFHFTDDILKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
IPR005821Ion_trans_dom
IPR030374PABS
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 69..316
e-value: 6.3E-46
score: 156.9
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 998..1274
e-value: 2.7E-13
score: 49.7
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 1683..1812
e-value: 2.5E-14
score: 55.4
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 49..1442
NoneNo IPR availableTMHMMTMhelixcoord: 1103..1125
NoneNo IPR availableTMHMMTMhelixcoord: 902..924
NoneNo IPR availableTMHMMTMhelixcoord: 987..1009
NoneNo IPR availableTMHMMTMhelixcoord: 1148..1170
NoneNo IPR availableTMHMMTMhelixcoord: 1065..1082
NoneNo IPR availableTMHMMTMhelixcoord: 1243..1265