Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30021820
Uniprot Best hitAtrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2 (E=3.19509e-55)
Length (bp)3650
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30021820) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30021820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30021820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30021820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30021820SMESG000056411.1 dd_Smed_v4_11767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 303/522 (58.05%), Postives = 389/522 (74.52%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKTA +KGNLVA+K +N   +IE+T ++L E+K ++D+ N+H+ RF+G C D P   I+ EYCP+GSL+D+L  E I LDWMF+YSL  DI +GM++LHN     HGNLKSSNC+VD RFVLKITD+GL S +    ++  E+ +  Y   LWTAPELL +++PPV G+  GDVYSF +I QEI  R+GVF +    +L+ KEI E+V   + PPFRP+L L     +++  L+Q+ W EDP  RP F  I+L +RK N+  ++ NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH+ E+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S  TK +L+ FG F +  RG +++KGKG   TYWL GE
Sbjct:  541 GSLLTTEGQFQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFR----DLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVE-GLDLSPKEIIERVTRGEQPPFRPSLALQSHL-EELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          

HSP 2 Score: 211.46 bits (537), Expect = 3.410e-55
Identity = 145/514 (28.21%), Postives = 245/514 (47.67%), Query Frame = 1
Query:  220 LLLPKNFSTFPW--ALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISA----GVMGAFVAIAI-IGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP   +++PW  A   P++++ L +V+   ++ P      +L   ++    C  T  PL    + + +  P V  GP C Y  AP+ R  A W  P++T GA    F      E+   TR G  +     G  ++ L  +  W +   + +  AY      +C     +LV+G    V++  + +  + H    ++D +    L+  +  K  +  +C+ PD  R +ML A        +Y+F ++DIF             RPW R D    ++  A++AF+    IT + P+  +Y EF  ++K  A  ++NFT E+ LVN+  +SFHD ++LY   + +TL+ GG + DGE + + MWNRSF+ +   + I   GDR  DFSL D++ + G F VV NY G  ++   V+ + ++W       P D P CG+D      P  N   +S      ++G+   + I I   FI+R+ + + EL +  W + W+D+E S   R   S G   
Sbjct:   39 VVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKW-EHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAGAPALGFGVK--DEYALTTRAGPSYAK--LGDFVAALHRRLGWERQALMLY--AYRPGDEEHC----FFLVEGLFMRVRD-RLNITVD-HLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGD---GQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNWPL--GYPPPDIPKCGFDNE---DPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRL 531          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 296/514 (57.59%), Postives = 379/514 (73.74%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  + I LDWMF+YSL+ D+ +GM +LHN+    HG+LKSSNC+VDSRFVLKITD+GL S +   +    ++ +  Y   LWTAPELL+ +  P  G  K DVYSF +I QEI  R+G F L    +L+ KEI +KVRN   P FRP++  T    ++++ L+++ W +DP  RPDF  IK  +R+ NK G T +ILDNLL RMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ EIARM++A L A+S F I HRP  +L LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TK+ LD  G F +  RG +++KGKG   TYWL GE
Sbjct:  533 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR---STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLE-GLDLSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 174.866 bits (442), Expect = 1.095e-43
Identity = 129/530 (24.34%), Postives = 237/530 (44.72%), Query Frame = 1
Query:  187 VRP--NRDYPLAMLLLPKNFS-TFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFS 1740
            VRP   R+  LA++L   N S  + W    P++ + +E + +   ++    + +    ++  C +   PL    +    + PD++ GP C Y  A +AR  + W  P++T GA+   FS+ +   + TL R G        G  +  L   + W     + + DA     P Y      + ++G  + ++   + V  +++  +        +     I     I  +C   +++ +I+L+A   N  NG+Y+F  +D+F             RPW + +R  E+ +  ++AF+T++ IT R+P   +Y+EF   +  RA+ ++       L+N     F+D ++LYA  LN+T+ +GG  EDG  +V+ M  R +  +   V +  + DR  DF L  +    +G F+  ++Y G +++      + I W  V    P D P C +DL    C K   +  AI A   G    +  +    I R+   + EL +M W I W++L+        F + + +H     R +
Sbjct:   17 VRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSE----LEGACSEYLAPLSAVDLKLYHD-PDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSA-KNDHYRTLVRTGPSA--PKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHY------FTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHF----IRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIW-WTGRPIPW--VKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ--------FGNSERYHKGAGSRLT 516          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 417.157 bits (1071), Expect = 4.516e-126
Identity = 228/483 (47.20%), Postives = 310/483 (64.18%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGT-FIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPV 3531
            D+ +++I   +G   D     IV E+C +GSLED+L  + +KLDWMFK SL+ D+ +GM YLH+    HG LKS NC+VD RFVLK+TD+G   +      +   E     +  LWTAPELL        G+  GDVYSFA+I QE++ R   F +    +L ++EI  ++  K  PP    ++  +    + L+L++Q W E    RP F  I    +  NKG  T NI+D++L  +EQY++NLE L+ +RTE+   EKQK E LL  MLP  VA  L K   V  E +D+VT++FSDIVGFT +SA S P+++++LLN LYT FD+II ++DVYKVETIGDAYMV SGLP+ NG+ H+ EIA MS+  L ++  F + H P+  + +RIG+HSGPV +GVVGL MPRYCLFGDTVNT+SRMES GLP +IH+S ST  IL      + +  RG  +LKGKG + T+WL G+    + PLPV
Sbjct:  600 DLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDIL---EMLRLSEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMM---DLPAQEIINRL--KKPPPVYRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKT-NIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGK-KGFMKPLPV 1072          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 409.453 bits (1051), Expect = 3.367e-123
Identity = 220/452 (48.67%), Postives = 298/452 (65.93%), Query Frame = 1
Query: 2149 IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGT-FIISERGHIDLKGKGLQLTYWLHGE 3501
            +V E+C +GSL+D+LA+ +IKLDWMFK SL+ D+ +G+ YLH+    HG LKS NC+VD RFVLKITD G   L      ++ E P    +  LWTAPELL        GT+ GDV+S A+I QE+V R+  +++     LT +E+ ++VR+   PP    L+  D    + + L++Q W E P  RP       L + +NKG  T NI+D++L  +EQY++NLE L+ +RTE+   EKQK + LL  MLP  VA  L     V  E ++ VT++FSDIVGFT +SA S P+++++LLN LYT FD+II ++DVYKVETIGDAYMV SGLPQ NG  H+ EIA MS+  L A+  F + H P+  + +RIG+HSGP  +GVVGL MPRYCLFGDTVNT+SRMES GLP +IH++ ST  IL    + + +  RG  +LKGKG + T+WL G 
Sbjct:  617 VVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLL-EAQKVLPEPPRA--EDQLWTAPELLRDPALERRGTLAGDVFSLAIIMQEVVCRSAPYAML---ELTPEEVVQRVRSP--PPLCRPLVSMDQAPVECILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKT-NIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGR 1059          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 380.563 bits (976), Expect = 6.419e-113
Identity = 212/472 (44.92%), Postives = 290/472 (61.44%), Query Frame = 1
Query: 2152 VYEYCPKGSLEDVLAK-----EQIKLDWMFKYSLMQDICRGMIYLHNNHGP-HGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDD--VLKLIQQAWDEDPTSRPDFATIKLLMRK---LNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILD-TFGTFIISERGHIDLKGKGLQLTYWLHG-EDSNIVDPLP 3528
            V EYC +GSL +VL       +   +DW FK S++ DI +GM YLH++    HG LKS+NC+VDSR V+KITDFG  S+   K +             LWTAPE L  +N     + KGDVYS+ +I QEI+ R   F  T      +++IF    +    PFRP L L      +  V  L++  W+EDP  RPDF  I+  + K   L       + +D L+ R++ Y+ NLE LV +RT+ Y  E+ +A+ L + +LP+ V   L +   V  E Y+ VTI+FSDIVGFT +   STPM+++++LN +Y +FD I++++DVYKVETIGDAYMV SGLP+ NGN H+ +IA+M++  L  +  F + H P   + +RIG+HSGP  +GVVG+KMPRYCLFGDTVNT+SRMES GLPL+IH+S ST  IL  T   F+   RG   LKG+G + TYWL G +D     P P
Sbjct:  560 VIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKD-------------LWTAPEHLRQANI----SQKGDVYSYGIIAQEIILRKETF-YTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTP 1013          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 460/1130 (40.71%), Postives = 661/1130 (58.50%), Query Frame = 1
Query:  394 SVINFVKEMPDVIFGPICDYVIAPIARLMAFWNR--PVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVK-NWPIKVYTELHPNDI---KNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNF-INGEYLFLNIDIFSSQDIIERPWYRK-DRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTD---ENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIH--RRTKFQAELNAMNWIIPWDDLE------------------------------TSEKRRRKFSDGDNFHPYTKKRFSNIMNK--------------NEMENLSLTKDDELKHES-----IENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLD----------------TIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXX----XXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKG-NKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVR---NKDSPPFRPTLMLT------DGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHG 3498
            +V   +++  D I G    Y +AP+AR+  +W    P+IT   L  +    R  E+  +TR+ S +  K     +S LF+ YKW +  ++F      S     C  L   L    RK+++       + E H  +I   +  +   N L       N I ILCA PD VR+IML A  L    +GEY+F+NID+ S+    E+PW R  D  NEENE AK+A+R L TI+LR+ + ++YK F   VK RA  +YN+T+   ++  +N+F+S+F+DAV+LYA+ LN+T+  G    +G  +   MW R+F  +   V+I  +GDRY+D+SL+DL+     F  V+ Y G   + K V    + W  V  K P D P CGYD S CP+ GY +      +MG+F+ I ++ G+FI   RR K + EL AM+W I W++L+                               S  R    SD  +    T ++ S ++++                 +N  LT +   K E+     I        ++  +         R+ NS ++D  N + KSL                 +   +   + +  Q++ KTA+FKG +VA+K +N++ K     +++   L+E+KK+KD+ +DHI RF G C+D P+  +V EYCPKGSLED+L  E+I+LD + KYSL+ D+ +G+ +LHN+    HG LKSSNC+VDSRFVLK+TDFGL  L    + N+     + YYK  LWTAPELL  SN P  GT KGD+YSFA+I  E+++R GVF+L  + +L+  EI ++VR   ++D  P RP +  T      D   D +L L+   W EDP  RP+ ++++  +R LN+  +T N++DNLL RMEQYANNLEGLV +RT++YL EK+K E+LL+ +LP  +A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + H+ +IA+MS++ L  +  F+I HRP ++L+LRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+SQ T +IL     F +  RG +++KGKG+Q TYWL G
Sbjct:  110 AVEQLLRKQIDCIIGYAYGYALAPVARMSPYWKNGIPIITPIGLTMSLDDKR--EYQLMTRINSPY--KVVSSAVSTLFNTYKWKRHIFMFHHAKAPSVAVGECFLLMASLQHPLRKVMEMQHNFFTFNEDHGANISKAERHNQFRNYLRASSNMANVI-ILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQ--LHW--VGGKPPTDLPICGYDKSKCPQ-GYPLHVYL--LMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQKKNEKKKAKKRKNHNDYLPESDPLLRSTSRSSVNSDKRSSSSGTTRKISAMIDRKLSIFTRKKSTPPSESQKNGGLTPNSLQKAENGDCSPINEVQFRLPLNDRRVSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALE-NEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1224          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 457/1125 (40.62%), Postives = 668/1125 (59.38%), Query Frame = 1
Query:  424 DVIFGPICDYVIAPIARLMAFWNR--PVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLG----IYLVKGARKIVKN-----WPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNF-INGEYLFLNIDIFSSQDIIERPWYRK-DRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTD---ENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIH--RRTKFQAELNAMNWIIPWDDLE------------------------------TSEKRRRKFSDGDNFHPYTKKRFSNIMNK--------------NEMENLSLTKDDELKHES-----IENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLD--------------TIIGINLDSMHK--VQLFAKTALFKGNLVALKPINVNGXX----XXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKG-NKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVR---NKDSPPFRPTLMLT------DGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHG 3498
            D I G    Y +AP+AR+  FW +  PV TT AL      DR  EF  LTR+   +  K  G L++ +  +++W   ++ FF   +N  +       G     + +   + ++ N     W +K+++E   + ++  +     L+ +    + + ILCA PD VR+IML A  L    +GEY+F+NID+ S+    E+PW R  D  NEENE AK+A+R L TI+LR+ + ++YK F   VK RA  +YN+T+   ++  +N+F+S+F+DAV+LYA+ LN+T+  G    +G  +   MW R+F  +   V+I  +GDRY+D+SL+DL+     F  V+ Y G   + K V    + W  V  K P D P CGYD S CP+ GY +      +MG+F+ I ++ G+FI   RR K + EL AM+W I W++L+                               S  R    SD  +    T ++ S ++++                 +N  LT +   K E+     I        ++  +         R+ NS ++D  N + KSL               +  G +++++ +   Q++ KTA+FKG +VA+K +N++ K     +++   L+E+KK+KD+ +DHI RF G C+D P+  +V EYCPKGSLED+L  E+I+LD + KYSL+ D+ +G+ +LHN+    HG LKSSNC+VDSRFVLK+TDFGL  L    + N+     + YYK  LWTAPELL  SN P  GT KGD+YSFA+I  E+++R GVF+L  + +L+  EI ++VR   ++D  P RP +  T      D   D +L L+   W EDP  RP+ ++++  +R LN+  +T N++DNLL RMEQYANNLEGLV +RT++YL EK+K E+LL+ +LP  +A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + H+ +IA+MS++ L  +  F+I HRP ++L+LRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+SQ T +IL     F +  RG +++KGKG+Q TYWL G
Sbjct:  103 DAIMGLPYVYALAPVARISKFWGQGVPVFTTTALVDELG-DR-NEFPLLTRMMGSY--KSLGKLVTRIAERFEW---QHYFF--MFNDEVARGPRNKGRSECYFSLSAIKNLIMNNKTSTWNVKMFSEFEADRLQYRA-----LLSEASVMSNLIILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQ--LHW--VGGKPPTDLPICGYDKSKCPQ-GYPLHVYL--LMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQKKNEKKKAKKRKNHNDYLPESDPLLRSTSRSSVNSDKRSSSSGTTRKISAMIDRKLSIFTRKKSTPPSESQKNGGLTPNSLQKAENGDCSPINEVQFRLPLNDRRVSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALE-NEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1203          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 554.288 bits (1427), Expect = 5.594e-176
Identity = 285/544 (52.39%), Postives = 389/544 (71.51%), Query Frame = 1
Query: 1918 SNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXX----XXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKG-NKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVR---NKDSPPFRPTLMLT------DGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHG 3498
            S  S++TI      + +  Q++ KTA+FKG +VA+K +N++ K     +++   L+E+KK+KD+ +DHI RF G C+D P+  +V EYCPKGSLED+L  E+I+LD + KYSL+ D+ +G+ +LHN+    HG LKSSNC+VDSRFVLK+TDFGL  L    + N+     + YYK  LWTAPELL  SN P  GT KGD+YSFA+I  E+++R GVF+L  + +L+  EI ++VR   ++D  P RP +  T      D   D +L L+   W EDP  RP+ ++++  +R LN+  +T N++DNLL RMEQYANNLEGLV +RT++YL EK+K E+LL+ +LP  +A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + H+ +IA+MS++ L  +  F+I HRP ++L+LRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+SQ T +IL     F +  RG +++KGKG+Q TYWL G
Sbjct:  727 SGGSVETI------AQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALE-NEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1262          

HSP 2 Score: 216.083 bits (549), Expect = 8.065e-57
Identity = 153/456 (33.55%), Postives = 237/456 (51.97%), Query Frame = 1
Query:  424 DVIFGPICDYVIAPIARLMAFWNR--PVITTGALYYAFSSDRIAEFHTLTRV-GSGHLDKYTGYLI-------SELFSKYKWNKGKYIFF----KDAYNSTIPM-----------YCH----GLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNF-INGEYLFLNIDIFSSQDIIERPWYRK-DRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTD---ENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIH--RRTKFQAELNAMNWIIPWDDLETSEKR 1683
            D I G   +Y +A + ++ A  N   P++TT  +    +S +  E+  LTR+ GS  L   + Y +       S   S    N    IFF    + A N  I             +C+     +  Y  + ++   + W +         D+  +       + +I  ++ + ILCA PD VR+IML A  L    +GEY+F+NID+ S+    E+PW R  D  NEENE AK+A+R L TI+LR+ + ++YK F   VK RA  +YN+T+   ++  +N+F+S+F+DAV+LYA+ LN+T+  G    +G  +   MW R+F  +   V+I  +GDRY+D+SL+DL+     F  V+ Y G   + K V    + W  V  K P D P CGYD S C  PGY +      +MG+F+ I ++ G+FI   RR K + EL AM+W I W++L+  E +
Sbjct:  120 DAILGFADNYGLATVTKVTAGLNGGIPILTTSGMPSLLNSKK--EYPFLTRMQGSYRLLADSMYQLIAYHDEDSVSKSNSSLNYLNLIFFYHDKRRAVNRVIAQDESQETGATSSHCYFSLYAIKRYFTEKSKTFKREWALNTPQFPFDEDLVIERETFKQWLREISLQSNVIILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQ--LHW--VGGKPPTDLPICGYDKSKC--PGYPLHVYL--LMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 564          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 506.523 bits (1303), Expect = 1.819e-165
Identity = 269/541 (49.72%), Postives = 374/541 (69.13%), Query Frame = 1
Query: 1918 SNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXX----XXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKG-NKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVR---NKDSPPFRPTLMLT------DGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGT-----FIISERGHIDLKGKGL 3474
            S  S++TI      + +  Q++ KTA+FKG +VA+K +N++ K     +++   L+E+KK+KD+ +DHI RF G C+D P+  +V EYCPKGSLED+L  E+I+LD + KYSL+ D+ +G+ +LHN+    HG LKSSNC+VDSRFVLK+TDFGL  L    + N+     + YYK  LWTAPELL  SN P  GT KGD+YSFA+I  E+++R GVF+L  + +L+  EI ++VR   ++D  P RP +  T      D   D +L L+   W EDP  RP+ ++++  +R LN+  +T N++DNLL RMEQYANNLEGLV +RT++YL EK+K E+LL+ +LP  +A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + H+ +IA+MS++ L  +  F+I HRP ++L+LRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGL +  + S         F       F+ +E+  I+ +GK +
Sbjct:  100 SGGSVETI------AQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALE-NEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLRMFWNFSLYKIYKFKVFKNKIELDFLKNEKESIEFEGKKM 632          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-22 (Receptor-type guanylate cyclase gcy-22 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY1])

HSP 1 Score: 430.254 bits (1105), Expect = 9.497e-132
Identity = 212/475 (44.63%), Postives = 317/475 (66.74%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHPYIV--YEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHIS-QSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            ++ ND++C+FIG+ LD P ++  + YC +GSL+DV+AK  +++DW FKYSLM+D+   + YLH++  GPHG L SS CLVD R+ +K++ FGL ++K  +            + FL TAPE +  +N P+  T + D+YSFA+IC E++ +   + L  +     +E+  K++     P RP+L   D     +  L++  W+E+P  RP    IK LM+ +N    + N++D++ + +EQYA+NLE  V  R ++  EEK++++ LLY MLPK VA +L   Q+V  E++D VTIFFSD+V FT L++  TP+Q++ LLN LYTTFD+IIE +DVYKVETIGD Y+  SGLP  NGN H++EI+ MS + L+AI  F +PH P +++ +R+G+H+GPV +GVVG+ MPRYCLFGD+VNT+SRMESNG P ++HIS +  K + +  G +    RG + +KGKG   T+WL  +D
Sbjct:  581 NVDNDNLCKFIGLSLDSPTLISIWRYCSRGSLQDVIAKGSLQMDWFFKYSLMRDVADAIYYLHHSPIGPHGWLSSSTCLVDERWQVKVSFFGLSAIKQYEVKEQ--------RDFLHTAPEHIRDTNLPI--TKEMDIYSFAIICSELITKKSAWDLE-NETFDIEELVYKIKKGGRSPPRPSLETEDEHNGSMSLLVRDCWNENPDQRPTSEQIKTLMKSMNHN-RSSNLMDHVFNVLEQYASNLEDEVQARMKELTEEKKRSDVLLYRMLPKQVAEKLKLGQSVEPETFDCVTIFFSDVVSFTTLASRCTPLQVVNLLNDLYTTFDAIIEQHDVYKVETIGDGYLCVSGLPHRNGNEHAKEISSMSFSLLKAIKTFRVPHLPKERINIRVGLHTGPVVTGVVGMTMPRYCLFGDSVNTASRMESNGKPGRVHISTECMKFLTEVIGGYQTEPRGEVIVKGKGAVQTHWLLTDD 1043          

HSP 2 Score: 59.3066 bits (142), Expect = 1.730e-8
Identity = 96/435 (22.07%), Postives = 167/435 (38.39%), Query Frame = 1
Query:  394 SVINFVKEMPDVIFGPIC---DYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFING-EYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKY-------KEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKII-------DWGTVNNKIPLDTPTCGYDLSGCPKPGYN------IGAISAGVMGAFVAIAIIGGVFIHRRTKFQAE 1626
            SVIN+ +    V+ GP C     V   +A+ + F   P+I  G     F S  + +F   T   +     Y    +  L   YKW +   I++  A +  IP         L+     +V N      T      +  +++    L   +     + I+C + D  R+ ++ + S N ++G EY+++  +   +       W   D    +N++A +A R  + +     + +KY       +E  A   R      N T+ +  V S V    DA++LYA  LN +++ G     G    +      F      V I+ +  R   F + +L+       V+           PV   I         W T    +PL TP CG+  + CPK   +      +G  +A ++   + IA+I  +    R+K Q E
Sbjct:   89 SVINYAEGHAHVVLGPPCVRPAQVAGSVAKYLDF---PLILWGP---PFDSSLLNQFEYPTIASTTSSTLYQATSLIRLLEYYKWTEIALIYYV-ARSDLIPRCTP-----LISDFEGLVNNNDNLTITYRRQMSVITNTSYATAL-RNLKELARVVIVCLESDEARRNLMISISENGMDGDEYVYIMAESRRA-GFASSFWNGTD---GKNDLALRAARKFLVM-----DNQKYNDTTTFVQEVRAAFSRPPFSCPNCTNIDPTV-SQVGPLGDALLLYAYALNRSIATGNPNPTGTEFCEVAKGMEFLGFTGKVIINQNSTRTPLFVVYNLDSTDKEMIVMQITEDLDDSKDPVASSITLVATPAQIWDTWGGTVPLSTPICGFTGTDCPKSFTDQYLAIILGCTAAALV---LIIAVISTIVFLVRSKRQEE 497          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 449/1105 (40.63%), Postives = 650/1105 (58.82%), Query Frame = 1
Query:  265 IPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDV--IFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFIN-GEYLFLNIDIFSS-QDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFT-DENELVNSFVSSFHDAVILYALGLNDTLSKGGKIE----DGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPK---PGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINV-NGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDH--PYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPN----MYYKSFLWTAPELLNLS-NPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTS-KEIFEKVR----NKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            +P +++ +  V++M            L   D+ C   + P+         + P+V  +FG  C+YV+API+R    W  PV+TTG     F+  +   + TLTR+    ++   G ++  + + + W +   I+     N    +  + +    +      ++     VY           + I  ML + +  ++ I I+CADP  +R+IML A  LN I+ GEY+F+NI++FS  Q +  +PWY K+  +  NE A+KA+  ++T+T ++P   +Y   S E+K  A  +YN+T  +NE +++FV+SF D V+LYA  LN+++ +   +     +G  +V+ MWNRSF  +   VTI  +GDR + +SL+D+N  TG FE+V++++  + +++   +K I W     + P D P CGYD + CP    PGY I +I   V+G  V +  +   F +R    +AE+N+M+W +  +D+   +   R      +FH   K          +   L+L  +D                                                 ++ IN D     Q+F    +F+ + VA+KP+ V N +  +T  L++E+K++KD+ +DH+ +F G CLD    +++ EYCPKGSL+D+L  EQ +LDWMF+ SLM DI RGM +LH++    HGNLKSSNC+VDSRFVLKITDFGL +L+  + ++  +  N     Y+   LWTAPELL +  N P  GT KGDVY+F +I  EI  R G F L       S +EI E V+    ++   PFRP L        D+  +I++ W EDP  RPDF T+K ++R+ NK  +TGNI+DNLL RME YANNLE LV +RT+ Y EEK+K E LLY +LP+ VA QLI  Q V+AE++D VTI+FSDIVGFTA+SAESTPMQ+++ LN LYT FDSI+EN+DVYKVETIGDAYMV SGLP  NGN H+REIAR+++A L+A+  F I HRP+ +L+LRIG+H+G   +GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIHIS++TKE LD FGTF+ + RG + +KGKG  LTYWL GE
Sbjct:  109 LPVLELAIRHVQRM-GFVGGSHFDIQLISRDTFCSSKYGPI--GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNK-KSESYSTLTRLKGAQVNNL-GNVVRAILNSFNWTRTALIY----QNENAKVKGNSVCFLCLAAIHDTIEEH--SVYQLGFDTSTWTKADITRML-KNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFEA--NKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSI---VLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRG--SFHSLVK----------QSSQLTLMSED-------------------------------------------------MVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 449/1105 (40.63%), Postives = 650/1105 (58.82%), Query Frame = 1
Query:  265 IPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDV--IFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFIN-GEYLFLNIDIFSS-QDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFT-DENELVNSFVSSFHDAVILYALGLNDTLSKGGKIE----DGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPK---PGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINV-NGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDH--PYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPN----MYYKSFLWTAPELLNLS-NPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTS-KEIFEKVR----NKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            +P +++ +  V++M            L   D+ C   + P+         + P+V  +FG  C+YV+API+R    W  PV+TTG     F+  +   + TLTR+    ++   G ++  + + + W +   I+     N    +  + +    +      ++     VY           + I  ML + +  ++ I I+CADP  +R+IML A  LN I+ GEY+F+NI++FS  Q +  +PWY K+  +  NE A+KA+  ++T+T ++P   +Y   S E+K  A  +YN+T  +NE +++FV+SF D V+LYA  LN+++ +   +     +G  +V+ MWNRSF  +   VTI  +GDR + +SL+D+N  TG FE+V++++  + +++   +K I W     + P D P CGYD + CP    PGY I +I   V+G  V +  +   F +R    +AE+N+M+W +  +D+   +   R      +FH   K          +   L+L  +D                                                 ++ IN D     Q+F    +F+ + VA+KP+ V N +  +T  L++E+K++KD+ +DH+ +F G CLD    +++ EYCPKGSL+D+L  EQ +LDWMF+ SLM DI RGM +LH++    HGNLKSSNC+VDSRFVLKITDFGL +L+  + ++  +  N     Y+   LWTAPELL +  N P  GT KGDVY+F +I  EI  R G F L       S +EI E V+    ++   PFRP L        D+  +I++ W EDP  RPDF T+K ++R+ NK  +TGNI+DNLL RME YANNLE LV +RT+ Y EEK+K E LLY +LP+ VA QLI  Q V+AE++D VTI+FSDIVGFTA+SAESTPMQ+++ LN LYT FDSI+EN+DVYKVETIGDAYMV SGLP  NGN H+REIAR+++A L+A+  F I HRP+ +L+LRIG+H+G   +GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIHIS++TKE LD FGTF+ + RG + +KGKG  LTYWL GE
Sbjct:  109 LPVLELAIRHVQRM-GFVGGSHFDIQLISRDTFCSSKYGPI--GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNK-KSESYSTLTRLKGAQVNNL-GNVVRAILNSFNWTRTALIY----QNENAKVKGNSVCFLCLAAIHDTIEEH--SVYQLGFDTSTWTKADITRML-KNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFEA--NKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSI---VLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDAAERGLRG--SFHSLVK----------QSSQLTLMSED-------------------------------------------------MVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 488.419 bits (1256), Expect = 1.436e-151
Identity = 270/521 (51.82%), Postives = 349/521 (66.99%), Query Frame = 1
Query: 1978 LFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGP---HGNLKSSNCLVDSRFVLKITDFGLPSLKG----NKTNMMHEEPNMYYKSFLWTAPELLNLS-NPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDS--PPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            +F    L+KG L A+K +     ++IT E+  E+K ++D  +D+IC FIG C D P   I+ EYC +GSL+D+L  E +KLD MF  S++ DI RG+IYLH++  P   HG L +SNCLVDSR+V+K+TDFGL + K     + T+M H          L+ APELL    +  V GT +GD YSF ++  E+  R G F  T    LT  +  +KV        P+RP+L   +   D V + +++ W E P  RPDF TI+  +R L KG    NI DN+++ ME+YANNLE LV  RT+Q  EEK+K + LL+ MLP+ VA QL K   V  E Y+ V+I+FSDIVGFTA+SAE TP+Q+++ LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LH+ EIA MS+  L A+S F I HRP  +L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+PLKIH S   +++LD  G +  +ERG I +KGKG Q TYWL GED
Sbjct:  575 IFTPIGLYKGQLYAIKKVR-KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTDMQHMSAKCL--KLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGET---GLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGED 1086          

HSP 2 Score: 68.1662 bits (165), Expect = 5.033e-11
Identity = 96/478 (20.08%), Postives = 186/478 (38.91%), Query Frame = 1
Query:  469 ARLMAFWNRPVITTGALYYAFSSD--RIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGAR-KIVKNWPIKVYTELHPNDIKNDSTIDN---MLIEQIGNKNAINILCADPDIVRKIMLRAASLNFIN-GEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEV-KRRAKMEYNFTDE------NELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFES-LGTTVTISPDGDRYADFSLM-------DLNQQTGMFEVVSNYIGRKRKYKPVNDKI--------IDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESI 1812
             R+ A +N P+I+    YY    D    A+F T  R      D      +  L   + W +  +++  DA     P+    L      G   + ++ W          N I +   +DN    L+EQ      I ++         +M+       ++ G+Y  + IDI          + R     +   +A +AF++ + I         +  F+ EV K   +  +NF +        + +++  +  +DAV LYA  L + L  GG+  +G  +V  +    + S +G  V I  +GD   +++++         NQ       V  +I R      ++  +        IDW  V    P   P CG+    C       G ISA + G  + +  +  + ++R  +++ EL+++ W I + +++  E  R + S         + R ++ + +    +LS   D + ++ +I
Sbjct:  128 GRMAAAFNLPMIS----YYCTHRDPSNKADFPTFARTRPP--DTQISKSVVALLLAFNWTQVSFLYLDDASGQYQPVAETILSTLTDAGVSIRDIRTW----------NTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLLEDVEPLAVQAFQSYLGIV--PTASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN---YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQ-------KQTRSTHPLIRTSQVSLSSNPDADFRYTTI 575          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304791)

HSP 1 Score: 488.034 bits (1255), Expect = 1.697e-151
Identity = 270/521 (51.82%), Postives = 349/521 (66.99%), Query Frame = 1
Query: 1978 LFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGP---HGNLKSSNCLVDSRFVLKITDFGLPSLKG----NKTNMMHEEPNMYYKSFLWTAPELLNLS-NPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDS--PPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            +F    L+KG L A+K +     ++IT E+  E+K ++D  +D+IC FIG C D P   I+ EYC +GSL+D+L  E +KLD MF  S++ DI RG+IYLH++  P   HG L +SNCLVDSR+V+K+TDFGL + K     + T+M H          L+ APELL    +  V GT +GD YSF ++  E+  R G F  T    LT  +  +KV        P+RP+L   +   D V + +++ W E P  RPDF TI+  +R L KG    NI DN+++ ME+YANNLE LV  RT+Q  EEK+K + LL+ MLP+ VA QL K   V  E Y+ V+I+FSDIVGFTA+SAE TP+Q+++ LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LH+ EIA MS+  L A+S F I HRP  +L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+PLKIH S   +++LD  G +  +ERG I +KGKG Q TYWL GED
Sbjct:  577 IFTPIGLYKGQLYAIKKVR-KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTDMQHMSAKCL--KLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGET---GLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGED 1088          

HSP 2 Score: 67.3958 bits (163), Expect = 8.369e-11
Identity = 96/480 (20.00%), Postives = 186/480 (38.75%), Query Frame = 1
Query:  469 ARLMAFWNRPVITTGALYYAFSSD--RIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGAR-KIVKNWPIKVYTELHPNDIKNDSTIDN---MLIEQIGNKNAINILCADPDIVRKIMLRAASLNFIN-GEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEV-KRRAKMEYNFTDE------NELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFES-LGTTVTISPDGDRYADFSLM-------DLNQQTGMFEVVSNYIGRKRKYKPVNDKI----------IDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESI 1812
             R+ A +N P+I+    YY    D    A+F T  R      D      +  L   + W +  +++  DA     P+    L      G   + ++ W          N I +   +DN    L+EQ      I ++         +M+       ++ G+Y  + IDI          + R     +   +A +AF++ + I         +  F+ EV K   +  +NF +        + +++  +  +DAV LYA  L + L  GG+  +G  +V  +    + S +G  V I  +GD   +++++         NQ       V  +I R      ++  +          IDW  V    P   P CG+    C       G ISA + G  + +  +  + ++R  +++ EL+++ W I + +++  E  R + S         + R ++ + +    +LS   D + ++ +I
Sbjct:  128 GRMAAAFNLPMIS----YYCTHRDPSNKADFPTFARTRPP--DTQISKSVVALLLAFNWTQVSFLYLDDASGQYQPVAETILSTLTDAGVSIRDIRTW----------NTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLLEDVEPLAVQAFQSYLGIV--PTASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPHQNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN---YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQ-------KQTRSTHPLIRTSQVSLSSNPDADFRYTTI 577          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302487)

HSP 1 Score: 488.034 bits (1255), Expect = 2.777e-151
Identity = 270/521 (51.82%), Postives = 349/521 (66.99%), Query Frame = 1
Query: 1978 LFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGP---HGNLKSSNCLVDSRFVLKITDFGLPSLKG----NKTNMMHEEPNMYYKSFLWTAPELLNLS-NPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDS--PPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            +F    L+KG L A+K +     ++IT E+  E+K ++D  +D+IC FIG C D P   I+ EYC +GSL+D+L  E +KLD MF  S++ DI RG+IYLH++  P   HG L +SNCLVDSR+V+K+TDFGL + K     + T+M H          L+ APELL    +  V GT +GD YSF ++  E+  R G F  T    LT  +  +KV        P+RP+L   +   D V + +++ W E P  RPDF TI+  +R L KG    NI DN+++ ME+YANNLE LV  RT+Q  EEK+K + LL+ MLP+ VA QL K   V  E Y+ V+I+FSDIVGFTA+SAE TP+Q+++ LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LH+ EIA MS+  L A+S F I HRP  +L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+PLKIH S   +++LD  G +  +ERG I +KGKG Q TYWL GED
Sbjct:  588 IFTPIGLYKGQLYAIKKVR-KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTDMQHMSAKCL--KLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGET---GLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGED 1099          

HSP 2 Score: 68.5514 bits (166), Expect = 3.690e-11
Identity = 92/446 (20.63%), Postives = 172/446 (38.57%), Query Frame = 1
Query:  469 ARLMAFWNRPVITTGALYYAFSSD--RIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGAR-KIVKNWPIKVYTELHPNDIKNDSTIDN---MLIEQIGNKNAINILCADPDIVRKIMLRAASLNFIN-GEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEV-KRRAKMEYNFTDE------NELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFES-LGTTVTISPDGDRYADFSLM-------DLNQQTGMFEVVSNYIGRKRKYKPVNDKI--------IDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFH 1716
             R+ A +N P+I+    YY    D    A+F T  R      D      +  L   + W +  +++  DA     P+    L      G   + ++ W          N I +   +DN    L+EQ      I ++         +M+       ++ G+Y  + IDI          + R     +   +A +AF++ + I         +  F+ EV K   +  +NF +        + +++  +  +DAV LYA  L + L  GG+  +G  +V  +    + S +G  V I  +GD   +++++         NQ       V  +I R      ++  +        IDW  V    P   P CG+    C       G ISA + G  + +  +  + ++R  +++ EL+++ W I + +++  E  R + S     H
Sbjct:  128 GRMAAAFNLPMIS----YYCTHRDPSNKADFPTFARTRPP--DTQISKSVVALLLAFNWTQVSFLYLDDASGQYQPVAETILSTLTDAGVSIRDIRTW----------NTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLLEDVEPLAVQAFQSYLGIV--PTASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN---YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQKQTRH 550          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 301/512 (58.79%), Postives = 386/512 (75.39%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            Q+FAKT  FKGN+VA+K IN   ++E+T ++L E+K ++D+ N+H+ RFIG C+D P   IV EYCP+GSL+++L  + I LDWMFKYSL+ DI +GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S++   T    E+ + YY   LW APEL  +   P  GT KGDVYSF +I QE+  R GVF L  D  L+ KEI ++V   + P  RP+L      ++++ +L+Q+ W E+P+ RP+F+ I +L+RK N+   + NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARMS+A L+A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S +T+ +L  F  F +  RG +++KGKG   TYWL GE
Sbjct:  308 QVFAKTGYFKGNIVAIKYIN-RRRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIR---TESDTEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEGDL-LSPKEIVDRVALGEWPYLRPSLN-PQAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNREHRS-NILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 812          

HSP 2 Score: 155.992 bits (393), Expect = 3.087e-38
Identity = 92/287 (32.06%), Postives = 153/287 (53.31%), Query Frame = 1
Query:  859 LCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDG 1704
            +C  PD+ R++++          EY+F  IDIF  S +    +PW R D    ++  AK+AF+++  +T  +P+ ++YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++LS   +   GE V K MWNR++  +   V I  +GDR  DF+L D+    TG F++V+ Y G +++   +    I W     K+P+D PTCG+  +   C      +  + + V+   + I     VFI+R+ K + EL A  W I WDD++ S   +   S G
Sbjct:    4 VCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPWARGD---SDDVFAKEAFQSVKILTYLEPQNQEYKDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNESLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWP--GGKVPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDIQMSHLEKALRSTG 285          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 303/518 (58.49%), Postives = 382/518 (73.75%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNI 3513
            K QLFAKT  FKGNLVA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMF+YSL+ DI +GM YLHN++ G HGNLKSSNC+VDSRFVLKITD+GL S + +  N   E+ +  Y   LWTAPELL     P  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT   +  C +++  L++  W EDP  RPDF+ IK+ + K NK       L   LSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIA MS+A L+ +  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMES G  L+IH+S +TKE+LD FG F +  RG +++KGKG   TYWL GE +++
Sbjct:  540 KYQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEN---EDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVE-GMDLSPKEIIQKVRNGQKPYFRPTTDNSRHC-EELTILMEGCWSEDPAERPDFSHIKVFIAKFNKQHQYSQYL---LSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGEKTDV 1048          

HSP 2 Score: 152.91 bits (385), Expect = 5.694e-37
Identity = 129/491 (26.27%), Postives = 211/491 (42.97%), Query Frame = 1
Query:  220 LLLPKNFSTFPWA--LTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD--CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKI-VKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLE 1668
            ++LP+N   + WA    +P+I+M  EK++K   +     N+      DS   C +    +  +V   +   PD   GP C Y +A + R  + W  P+IT G   Y F  D+  EF T+ R G     K  G  ++ L  ++ W+    + F D      P Y    GIY V     I V  +P   Y +    + K+       +I  I +   I  +C       +IM           +Y    +D+F  S    +  PW   D    +     K F+++  +T ++P+  +Y  F  E+ +RA  ++N   E  +++     FHD  +LYA  L++ L+ G    DG  +   M NR    +   V+I     R+ DFSL  + N ++G + +V +Y G  ++      + I W       PLD P CG+  S C +    +  I A   G  + I  I    I+R+ K + EL  M W I W++L+
Sbjct:   40 VMLPENLK-YSWASPRVLPAIRMAQEKIQKSGLLRGHTINLLNFSTEDSSGSCSENEAQII-AVDTKLYHKPDAFIGPGCTYSVASVGRFASHWKLPLITAGGPAYGF--DKWEEFKTIVRTGP--TTKKLGDFVNYLHGQFNWSSRALMIFHDLKQDDRPHYFLSEGIYTVLREENITVLAFP---YEDEQTYNYKD-------MITFIKDNGRIVYICGPLPTFFQIMKLFEDEVKSPEDYAIFYLDVFAESLSGDVPMPWQGSDIQWND---PIKLFQSVFVVTYQEPDSPEYTAFRKELHKRAIQDFNVQLEPSMMDFIAGCFHDGFVLYAKALSEALADGVSQNDGINITARMQNRRLWGVTGLVSIDQKNARFTDFSLWAMTNLKSGQYAIVGHYNGTSKEILWSPTEKIQWP--KGCPPLDYPPCGF--SPCKEDHLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQ 507          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 300/515 (58.25%), Postives = 384/515 (74.56%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q++AKT  +KGN+ A+K +N   +IE+T ++L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D++  E I LDWMF+YSL+ DI +GM +LHN+    HGNLKSSNC+VDSRFVLKITD+GL S   + +N+  ++ + +Y   LWTAPELL   NPP  GT KGDVYSF +I QE+    GVF L   P L+ KEI E+V     P  RP L+     ++++ +L+ + W ED   RPDF+ IK+L+RK N  G   NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S++T+ +L  F  F +  RG +++KGKG   TYWL GE S+
Sbjct:  557 QIYAKTGYYKGNITAIKYVN-KKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKD-SNL--DDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLE-GPCLSPKEIIERVVEGRWPYLRP-LLCPQSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEISS 1064          

HSP 2 Score: 203.371 bits (516), Expect = 9.761e-53
Identity = 143/508 (28.15%), Postives = 240/508 (47.24%), Query Frame = 1
Query:  220 LLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNM---------LIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRR 1686
            ++LP + + +PWA     P++   LEKV    N+        +    ++    C  +  PL    + F    P    GP CDY  +P+AR    W  P+IT+GA    F+      + ++T +G  H  K  G  +  +   + W+K   + F D  N   P Y      + V+G            YT++  ++I  D  + N          L+  I +K  +  +C   +  RK+M+      F   EY F  ID+F  S Q    RPW R D    ++  AK+AF+++  +T R+P+  +YK+F +++K  A   +NF  E+ L+N    SFHD V+LY+  LNDT+ + G    G++V K MWNR++  +   V +  +GDR  DF+L D+ + +TG +++VS Y G +++        + W  +  + P D P CG+  D   C      +  + + V+     I +   VFI+R+ K + EL A  W + W+D++ S   +
Sbjct:   51 VILPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLVFNSSENKEGLCSDSVAPLVAVDLKFSYN-PWAFIGPGCDYSSSPVARFTTHWEVPMITSGARALGFNL-----YSSITNIGPTH--KKLGEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCY------FAVEGP-----------YTQMREDNITADDLVFNEDEEPLRYDELLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPWARGD---ADDNAAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHW--LKGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEK 528          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 300/515 (58.25%), Postives = 384/515 (74.56%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q++AKT  +KGN+ A+K +N   +IE+T ++L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D++  E I LDWMF+YSL+ DI +GM +LHN+    HGNLKSSNC+VDSRFVLKITD+GL S   + +N+  ++ + +Y   LWTAPELL   NPP  GT KGDVYSF +I QE+    GVF L   P L+ KEI E+V     P  RP L+     ++++ +L+ + W ED   RPDF+ IK+L+RK N  G   NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S++T+ +L  F  F +  RG +++KGKG   TYWL GE S+
Sbjct:  557 QIYAKTGYYKGNITAIKYVN-KKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKD-SNL--DDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLE-GPCLSPKEIIERVVEGRWPYLRP-LLCPQSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEISS 1064          

HSP 2 Score: 203.371 bits (516), Expect = 9.761e-53
Identity = 143/508 (28.15%), Postives = 240/508 (47.24%), Query Frame = 1
Query:  220 LLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNM---------LIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRR 1686
            ++LP + + +PWA     P++   LEKV    N+        +    ++    C  +  PL    + F    P    GP CDY  +P+AR    W  P+IT+GA    F+      + ++T +G  H  K  G  +  +   + W+K   + F D  N   P Y      + V+G            YT++  ++I  D  + N          L+  I +K  +  +C   +  RK+M+      F   EY F  ID+F  S Q    RPW R D    ++  AK+AF+++  +T R+P+  +YK+F +++K  A   +NF  E+ L+N    SFHD V+LY+  LNDT+ + G    G++V K MWNR++  +   V +  +GDR  DF+L D+ + +TG +++VS Y G +++        + W  +  + P D P CG+  D   C      +  + + V+     I +   VFI+R+ K + EL A  W + W+D++ S   +
Sbjct:   51 VILPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLVFNSSENKEGLCSDSVAPLVAVDLKFSYN-PWAFIGPGCDYSSSPVARFTTHWEVPMITSGARALGFNL-----YSSITNIGPTH--KKLGEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCY------FAVEGP-----------YTQMREDNITADDLVFNEDEEPLRYDELLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPWARGD---ADDNAAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHW--LKGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEK 528          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 556.599 bits (1433), Expect = 6.407e-179
Identity = 291/512 (56.84%), Postives = 378/512 (73.83%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            Q+FAKT  FKGN+VA+K IN   ++E+T ++L E+K ++D+ N+H+ RFIG C+D P   IV EYCP+GSL+++L  + I LDWMFKYSL+ DI +GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S++   T    E+ + YY   LW APEL  +   P  GT KGDVYSF +I QE+  R GVF L  D  L+ KEI ++V   + P  RP+L      ++++ +L+Q+ W E+P+ RP+F+ I +L+RK N+     +I+      + QYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARMS+A L+A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S +T+ +L  F  F +  RG +++KGKG   TYWL GE
Sbjct:  561 QVFAKTGYFKGNIVAIKYIN-RRRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIR---TESDTEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEGDL-LSPKEIVDRVALGEWPYLRPSLN-PQAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNRSVPHYSIV------LSQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 1060          

HSP 2 Score: 200.675 bits (509), Expect = 6.599e-52
Identity = 143/517 (27.66%), Postives = 245/517 (47.39%), Query Frame = 1
Query:  220 LLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLY---PIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDI--------KNDSTID-NMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP++ +++PWA     P++   + +V    N+ P  +   +       D  C ++  PL    + F +  P    GP CDY  +P+    A W  P+IT GA   AF    I  + ++T  G  H  K  G     L+  + WN+   + F D        Y      + ++G           +YTE+H  +I        +N   ++ + L+ +I     +  +C  PD+ R++++          EY+F  IDIF  S +    +PW R D    ++  AK+AF+++  +T  +P+ ++YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++LS   +   GE V K MWNR++  +   V I  +GDR  DF+L D+    TG F++V+ Y G +++   +    I W     K+P+D PTCG+  +   C      +  + + V+   + I     VFI+R+ K + EL A  W I WDD++ S   +   S G   
Sbjct:   52 VILPQHNTSYPWAWPRVGPALDRAIARVNANPNLLPRHRVRHVFANSEDRDGICSESMAPLMAVDLKF-EHNPWAFIGPGCDYTSSPVGLFTAHWGLPMITAGAPAVAFLQMEI--YTSITNTGPTH--KKLGEYALHLYRHFGWNQHSLLMFSDTKMGERACY------FALEG-----------LYTEMHEENITTMDLVFEENKGPVNYSELLHKIQGDGRVVFVCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPWARGD---SDDVFAKEAFQSVKILTYLEPQNQEYKDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNESLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWP--GGKVPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDIQMSHLEKALRSTGSKL 541          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 303/520 (58.27%), Postives = 382/520 (73.46%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLK-LIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGK------GLQLTYWLHG 3498
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RF+G C+D P   IV EYCP+GSL+D+L  E I LDWMF+ SL+ DI +GM +LH +  G HGNLKSSNC+VDSRFVLKITD+GL S +   ++   ++    Y   LWTAPELL ++ PP  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT+ ++  C  + L  L+ + W E+P  RPDF  IK  + K NK G T +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IHIS +TKE+LD F  F +  RG I++K K      GL L    HG
Sbjct:   52 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFR---SSCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQ-GMDLSPKEIVQKVRNGQRPYFRPTVDIS--CHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEGST-SILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVKIPLVATGLGLHTRCHG 563          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 305/543 (56.17%), Postives = 392/543 (72.19%), Query Frame = 1
Query: 1882 RYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLK-LIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHG 3498
            R+   +   S   +K+  +  G  + +  K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RF+G C+D P   IV EYCP+GSL+D+L  E I LDWMF+ SL+ DI +GM +LH +  G HGNLKSSNC+VDSRFVLKITD+GL S +   ++   ++    Y   LWTAPELL ++ PP  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT+ ++  C  + L  L+ + W E+P  RPDF  IK  + K NK G T +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IHIS +TKE+LD F  F +  RG I++K K + L    HG
Sbjct:   76 RWEELQFGNSERYHKTRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFR---SSCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQ-GMDLSPKEIVQKVRNGQRPYFRPTVDIS--CHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEGST-SILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK-IPLVSLSHG 609          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 298/504 (59.13%), Postives = 377/504 (74.80%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLK-LIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGK 3468
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RF+G C+D P   IV EYCP+GSL+D+L  E I LDWMF+ SL+ DI +GM +LH +  G HGNLKSSNC+VDSRFVLKITD+GL S +   ++   ++    Y   LWTAPELL ++ PP  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT+ ++  C  + L  L+ + W E+P  RPDF  IK  + K NK G T +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IHIS +TKE+LD F  F +  RG I++K K
Sbjct:  137 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFR---SSCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQ-GMDLSPKEIVQKVRNGQRPYFRPTVDIS--CHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEGST-SILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 632          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 298/504 (59.13%), Postives = 377/504 (74.80%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLK-LIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGK 3468
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RF+G C+D P   IV EYCP+GSL+D+L  E I LDWMF+ SL+ DI +GM +LH +  G HGNLKSSNC+VDSRFVLKITD+GL S +   ++   ++    Y   LWTAPELL ++ PP  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT+ ++  C  + L  L+ + W E+P  RPDF  IK  + K NK G T +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IHIS +TKE+LD F  F +  RG I++K K
Sbjct:  182 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFR---SSCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQ-GMDLSPKEIVQKVRNGQRPYFRPTVDIS--CHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEGST-SILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 677          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 298/504 (59.13%), Postives = 377/504 (74.80%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLK-LIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGK 3468
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RF+G C+D P   IV EYCP+GSL+D+L  E I LDWMF+ SL+ DI +GM +LH +  G HGNLKSSNC+VDSRFVLKITD+GL S +   ++   ++    Y   LWTAPELL ++ PP  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT+ ++  C  + L  L+ + W E+P  RPDF  IK  + K NK G T +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L+A+  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IHIS +TKE+LD F  F +  RG I++K K
Sbjct:  210 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFR---SSCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQ-GMDLSPKEIVQKVRNGQRPYFRPTVDIS--CHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEGST-SILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 705          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 389/522 (74.52%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKTA +KGNLVA+K +N   +IE+T ++L E+K ++D+ N+H+ RF+G C D P   I+ EYCP+GSL+D+L  E I LDWMF+YSL  DI +GM++LHN   G HGNLKSSNC+VD RFVLKITD+GL S +  +     E+ +  +   LWTAPELL +++PP  G+  GDVYSF +I QEI  R+GVF +    +L+ KEI E+V   + PPFRP++ L     +++ +L+Q+ W EDP  RP F  I+L +RK NK  ++ NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH+RE+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IH+S  TK +L+ F  F +  RG +++KGKG   TYWL GE
Sbjct:  537 GSLLTTEGQFQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVE-GLDLSPKEIIERVTRGEQPPFRPSMDLQSHL-EELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 213.772 bits (543), Expect = 4.568e-56
Identity = 141/512 (27.54%), Postives = 242/512 (47.27%), Query Frame = 1
Query:  220 LLLPKNFSTFPW--ALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYL-VKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF------SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP   +++PW  A   P++++ L +V+   ++ P      +L   ++    C  T  PL    + + +  P V  GP C Y  AP+ R  A W  P++T GA   A       E+   TR G  H+    G  ++ L  +  W     + + D      P +    G+Y+ V+    I  N         H   ++ D      L+  +  K  +  +C+ PD  R +ML A        +Y+F ++D+F      +   +  +PW R D    ++  A++AF+    IT ++P+  +Y EF  ++K  A  ++NFT E+ L N   +SFHD ++LY   + +TL++GG + DGE + + MWNRSF+ +   + I  +GDR  DFSL D++ +TG F VV N+ G  ++   V++  + W       P D P CG+D     C +  ++   + A V    +   +I   FI+R+ + + EL +  W + W+DL+ S   R   S G   
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKW-EHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGA--PALGIGVKDEYALTTRTGPSHVK--LGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVN---------HQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDD---GQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPL--GYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRL 527          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 298/515 (57.86%), Postives = 380/515 (73.79%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  + I LDWMF+YSL+ D+ +GM +LHN+    HG+LKSSNC+VDSRFVLKITD+GL S +        ++ +  Y   LWTAPELL+ +  P  G  K DVYSFA+I QEI  R+G F L    +L+ KEI +KVRN   P FRP++  T    ++++ L+++ W +DPT RPDF  IK  +R+ NK G T +ILDNLL RMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ EIARM++A L A+S F I HRP  +L LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TK+ LD  G F +  RG +++KGKG   TYWL GE 
Sbjct:   99 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEP---DDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLE-GLDLSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 606          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 298/514 (57.98%), Postives = 381/514 (74.12%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  + I LDWMF+YSL+ D+ +GM +LHN+    HG+LKSSNC+VDSRFVLKITD+GL S +   +    ++ +  Y   LWTAPELL+ +  P  G  K DVYSFA+I QEI  R+G F L    +L+ KEI +KVRN   P FRP++  T    ++++ L+++ W +DPT RPDF  IK  +R+ NK G T +ILDNLL RMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ EIARM++A L A+S F I HRP  +L LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TK+ LD  G F +  RG +++KGKG   TYWL GE
Sbjct:  533 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR---STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLE-GLDLSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 181.8 bits (460), Expect = 5.487e-46
Identity = 131/530 (24.72%), Postives = 238/530 (44.91%), Query Frame = 1
Query:  187 VRP--NRDYPLAMLLLPKNFS-TFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFS 1740
            VRP   R+  LA++L   N S  + W    P++ + +E + +   ++    + +    +D  C +   PL    +    + PD++ GP C Y  A +AR  + W  P++T GA+   F++ +   + TL R G        G  +  L   + W     + + DA     P Y      + ++G  + ++   + V  +++  +        +     I     I  +C   +++ +I+L+A   N  NG+Y+F  +D+F             RPW + +R  E+ +  ++AF+T++ IT R+P   +Y+EF   +  RA+ ++       L+N     F+D ++LYA  LN+T+ +GG  EDG  +V+ M  R +  +   V +  + DR  DF L  +    +G F+  ++Y G +++      + I W  V    PLD P C +DL    C K   +  AI A   G    +  +    I R+   + EL +M W I W++L+        F + D +H     R +
Sbjct:   17 VRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSE----LDGACSEYLAPLRAVDLKLYHD-PDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFAA-KNEHYRTLVRTGPSA--PKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHY------FTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHF----IRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIW-WTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ--------FGNSDRYHKGAGSRLT 516          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 459.914 bits (1182), Expect = 9.285e-143
Identity = 246/438 (56.16%), Postives = 319/438 (72.83%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSG 3273
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  + I LDWMF+YSL+ D+ +GM +LHN+    HG+LKSSNC+VDSRFVLKITD+GL S +        ++ +  Y   LWTAPELL+ +  P  G  K DVYSFA+I QEI  R+G F L    +L+ KEI +KVRN   P FRP++  T    ++++ L+++ W +DPT RPDF  IK  +R+ NK G T +ILDNLL RMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ EIARM++A L A+S F I HRP  +L LRIG+H+G
Sbjct:  533 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEP---DDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLE-GLDLSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG 963          

HSP 2 Score: 181.8 bits (460), Expect = 5.036e-46
Identity = 131/530 (24.72%), Postives = 238/530 (44.91%), Query Frame = 1
Query:  187 VRP--NRDYPLAMLLLPKNFS-TFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFS 1740
            VRP   R+  LA++L   N S  + W    P++ + +E + +   ++    + +    +D  C +   PL    +    + PD++ GP C Y  A +AR  + W  P++T GA+   F++ +   + TL R G        G  +  L   + W     + + DA     P Y      + ++G  + ++   + V  +++  +        +     I     I  +C   +++ +I+L+A   N  NG+Y+F  +D+F             RPW + +R  E+ +  ++AF+T++ IT R+P   +Y+EF   +  RA+ ++       L+N     F+D ++LYA  LN+T+ +GG  EDG  +V+ M  R +  +   V +  + DR  DF L  +    +G F+  ++Y G +++      + I W  V    PLD P C +DL    C K   +  AI A   G    +  +    I R+   + EL +M W I W++L+        F + D +H     R +
Sbjct:   17 VRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSE----LDGACSEYLAPLRAVDLKLYHD-PDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFAA-KNEHYRTLVRTGPS--APKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHY------FTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHF----IRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIW-WTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ--------FGNSDRYHKGAGSRLT 516          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2g (guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:106025])

HSP 1 Score: 439.499 bits (1129), Expect = 1.599e-134
Identity = 240/541 (44.36%), Postives = 347/541 (64.14%), Query Frame = 1
Query: 1978 LFAKTALFKGNLVALKPINVNGXX-XXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYR--NGVFSLTPDPNLTSKEIFEKVRNKDSP-PFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD*IY*NFTNTDSRIQE 3579
             FA   L++GN VAL  I    +       +  E+  + ++ +++I  F GVC + P   IV +YC KGSL+DV+     ++DW+FK S   DI  G+++LH +    HGNLK SNCLVDS   LK++ FGL   K   T   + +    +    WTAPELL L   P +GT +GDVYSFA++ ++++++  +G F    D     +EI  ++++  +P P RP+L L D     ++ L+++ WDE P  RP F +IK  +R+ +  G   +ILD+++ ++E YAN+LE +V +RT + + EK+K E LL +MLP FV  QLI  ++V  E ++ VTIFFSDIVGFT L + S+P+Q+++LLN LY+ FD  I+++DVYKVETIGDAYMV SGLP  NG  H+ EIA M++  L   + F I H P+++L+LRIG+H+GPV +GVVG+ MPRYCLFGDTVN +SRMES+ LPL+IH+SQST   L   G + + +RG I +KGKG Q T+WL G+D   V PLP       FT  ++++ E
Sbjct:  570 FFAPVGLYQGNQVALCYIGDEAEAWVKKPTVRREVCLMCELKHENIVPFFGVCTEPPNICIVTQYCKKGSLQDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFKHGSTWRSYNQEATDHSELYWTAPELLRLRESPCSGTPQGDVYSFAILLRDLIHQQAHGPFE---DLEAAPEEIISRIKDPRAPVPLRPSL-LEDKGDGRIVALVRECWDESPELRPIFPSIKKTLREASPRGHV-SILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWLKGKDGFPV-PLP------EFTEEEAKVSE 1098          

HSP 2 Score: 53.5286 bits (127), Expect = 2.073e-6
Identity = 63/311 (20.26%), Postives = 129/311 (41.48%), Query Frame = 1
Query:  790 IKNDSTIDNMLIEQIGN----KNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTT--VTISPDGDRYADFSLMDLNQQTG---MFEVVSNYIGRKRKYKPV-NDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMG--------AFVAIAIIGGVFIHR-RTKFQAELNAMNWIIPWDDL 1665
            ++ +S+  ++L E + N       I ++C+  D  R+I+  A  L    GE++F+ +     +D   +    KD+     ++ +  F    +        + +++  ++  RR   + + T E++ V+ + +  HDA++LYA  + +         DG  ++  +        G T  V +   G R+ D+S+  L Q++G   +F    +Y   ++  +P  ND    W   +  +P   P CG+    C      +  ++  V             + A I G+ + R R K Q+      W I +D +
Sbjct:  222 MRYNSSSSDLLQEGLRNMSYVARVIILICSSED-ARRILQAAVDLGLDTGEFVFILLQQL--EDSFWKEVLTKDKVIRFPKVYESVFLIAPSAYGGGIGDDGFRKQVSQELRRPPFQSSITSEDQ-VSPYSAYLHDALLLYAQTVEEMRKAEKDFRDGRQLISTLRAGQVTLQGITGPVLLDSQGKRHVDYSVYAL-QESGNRSLFLPFLHYDSFQKVIRPWRNDSNTSWP--HGSLPEYKPGCGFHNDLCKTKPPTVAGMTVTVTAVIPTVTFLVLASAAAITGLMLWRLRGKVQSHPGDTWWQIRYDSI 525          
BLAST of Guanylate cyclase vs. UniProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 389/522 (74.52%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKTA +KGNLVA+K +N   +IE+T ++L E+K ++D+ N+H+ RF+G C D P   I+ EYCP+GSL+D+L  E I LDWMF+YSL  DI +GM++LHN   G HGNLKSSNC+VD RFVLKITD+GL S +  +     E+ +  +   LWTAPELL +++PP  G+  GDVYSF +I QEI  R+GVF +    +L+ KEI E+V   + PPFRP++ L     +++ +L+Q+ W EDP  RP F  I+L +RK NK  ++ NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH+RE+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  L+IH+S  TK +L+ F  F +  RG +++KGKG   TYWL GE
Sbjct:  537 GSLLTTEGQFQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVE-GLDLSPKEIIERVTRGEQPPFRPSMDLQSHL-EELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 213.772 bits (543), Expect = 3.195e-55
Identity = 141/512 (27.54%), Postives = 242/512 (47.27%), Query Frame = 1
Query:  220 LLLPKNFSTFPW--ALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYL-VKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF------SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP   +++PW  A   P++++ L +V+   ++ P      +L   ++    C  T  PL    + + +  P V  GP C Y  AP+ R  A W  P++T GA   A       E+   TR G  H+    G  ++ L  +  W     + + D      P +    G+Y+ V+    I  N         H   ++ D      L+  +  K  +  +C+ PD  R +ML A        +Y+F ++D+F      +   +  +PW R D    ++  A++AF+    IT ++P+  +Y EF  ++K  A  ++NFT E+ L N   +SFHD ++LY   + +TL++GG + DGE + + MWNRSF+ +   + I  +GDR  DFSL D++ +TG F VV N+ G  ++   V++  + W       P D P CG+D     C +  ++   + A V    +   +I   FI+R+ + + EL +  W + W+DL+ S   R   S G   
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKW-EHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGA--PALGIGVKDEYALTTRTGPSHVK--LGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVN---------HQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDD---GQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPL--GYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRL 527          
BLAST of Guanylate cyclase vs. UniProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 303/522 (58.05%), Postives = 389/522 (74.52%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKTA +KGNLVA+K +N   +IE+T ++L E+K ++D+ N+H+ RF+G C D P   I+ EYCP+GSL+D+L  E I LDWMF+YSL  DI +GM++LHN     HGNLKSSNC+VD RFVLKITD+GL S +    ++  E+ +  Y   LWTAPELL +++PPV G+  GDVYSF +I QEI  R+GVF +    +L+ KEI E+V   + PPFRP+L L     +++  L+Q+ W EDP  RP F  I+L +RK N+  ++ NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH+ E+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S  TK +L+ FG F +  RG +++KGKG   TYWL GE
Sbjct:  541 GSLLTTEGQFQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFR----DLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVE-GLDLSPKEIIERVTRGEQPPFRPSLALQSHL-EELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          

HSP 2 Score: 211.46 bits (537), Expect = 1.637e-54
Identity = 145/514 (28.21%), Postives = 245/514 (47.67%), Query Frame = 1
Query:  220 LLLPKNFSTFPW--ALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISA----GVMGAFVAIAI-IGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP   +++PW  A   P++++ L +V+   ++ P      +L   ++    C  T  PL    + + +  P V  GP C Y  AP+ R  A W  P++T GA    F      E+   TR G  +     G  ++ L  +  W +   + +  AY      +C     +LV+G    V++  + +  + H    ++D +    L+  +  K  +  +C+ PD  R +ML A        +Y+F ++DIF             RPW R D    ++  A++AF+    IT + P+  +Y EF  ++K  A  ++NFT E+ LVN+  +SFHD ++LY   + +TL+ GG + DGE + + MWNRSF+ +   + I   GDR  DFSL D++ + G F VV NY G  ++   V+ + ++W       P D P CG+D      P  N   +S      ++G+   + I I   FI+R+ + + EL +  W + W+D+E S   R   S G   
Sbjct:   39 VVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKW-EHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAGAPALGFGVK--DEYALTTRAGPSYAK--LGDFVAALHRRLGWERQALMLY--AYRPGDEEHC----FFLVEGLFMRVRD-RLNITVD-HLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGD---GQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNWPL--GYPPPDIPKCGFDNE---DPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRL 531          
BLAST of Guanylate cyclase vs. UniProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 301/522 (57.66%), Postives = 388/522 (74.33%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKTA +KGNLVA+K +N   +IE+T ++L E+K ++D+ N+H+ RF+G C D P   I+ EYCP+GSL+D+L  E I LDWMF+YSL  DI +GM++LHN     HGNLKSSNC+VD RFVLKITD+GL S +  +     E+ +  +   LWTAPELL +++PP  G+  GDVYSF +I QEI  R+GVF +    +L+ KEI E+V   + PPFRP++ L     +++ +L+Q+ W EDP  RP F  I+L +RK NK  ++ NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH+RE+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S  TK +L+ F  F +  RG +++KGKG   TYWL GE
Sbjct:  537 GSLLTTEGQFQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVE-GLDLSPKEIIERVTRGEQPPFRPSMDLQSHL-EELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 218.009 bits (554), Expect = 1.322e-56
Identity = 144/512 (28.12%), Postives = 247/512 (48.24%), Query Frame = 1
Query:  220 LLLPKNFSTFPW--ALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYL-VKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF-----SSQDII-ERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNF 1713
            ++LP   +++PW  A   P++++ L +V+   ++ P      +L   ++    C  T  PL    + + +  P V  GP C Y  AP+ R  A W  P++T GA   A       E+   TR G  H+    G  ++ L  +  W     + + D      P +    G+Y+ V+    I  N         H   ++ D      L+  +  K  +  +C+ PD  R +ML A +      +Y+F ++D+F     S+Q ++ ++PW R D    ++  A++AF+    IT ++P+  +Y EF  ++K  A  ++NFT E+ L N   +SFHD ++LY   + +TL++GG + DGE + + MWNRSF+ +   + I  +GDR  DFSL D++ +TG F VV NY G  ++   V++  + W       P D P CG+D     C +  ++   + A V    +   +I   FI+R+ + + EL +  W + W+DL+ S   R   S G   
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKW-EHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGA--PALGIGVKDEYALTTRTGPSHVK--LGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVN---------HQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGD---GQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPL--GYPPPDVPKCGFDNEDPACNQDHFSTLEVLALVGSLSLISFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRL 527          
BLAST of Guanylate cyclase vs. UniProt
Match: sp|P55202|ANPRB_ANGJA (Atrial natriuretic peptide receptor 2 OS=Anguilla japonica OX=7937 GN=npr2 PE=2 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 307/518 (59.27%), Postives = 388/518 (74.90%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNI 3513
            K QLFAKT  FKGNLVA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMF+YSL+ DI +GM +LHN++ G HGNLKSSNC+VDSRFVLKITD+GL S + +  N   E+ +  Y   LWTAPELL     P  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT   T   ++++  L++  W EDP  RPDF+ IK+ + KLNK G T +IL+NLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV S     NG LH+REIA MS+A L+ +  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TKE+LD FG F +  RG +++KGKG   TYWL GE +++
Sbjct:  537 KYQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEN---EDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVD-GMDLSPKEIVQKVRNGQKPYFRPTTD-TSCHSEELSILMEGCWAEDPADRPDFSYIKIFVMKLNKEGST-SILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSDSQSRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSATKEVLDEFGYFDLQLRGDVEMKGKGKMRTYWLLGEKTDV 1047          

HSP 2 Score: 162.925 bits (411), Expect = 2.936e-39
Identity = 131/497 (26.36%), Postives = 219/497 (44.06%), Query Frame = 1
Query:  214 AMLLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVG--SGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ--DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSG--CPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLE 1668
             +++LP N   + +A     P+I+M  + ++K   +        + +  +S    C ++   +  +V   + E PD  FGP C Y +A + R +  W  P+IT  A  + F S    E+ T+ R G  +  L ++  YL     S + W    ++ F D      P Y    G++LV     I          E  P D + +S    M I  + +   I  +C   D   + M    +      +Y    +D+F+    D   +PW   D  N  + I  K F+++  IT ++P+  +YK F  E+  RAK E++   E  L +     F+D  +LYA  LN+TL++GG   DG  + + M NR F  +   V+   + DR  DF+L  + N +TG + +V+ Y G  ++      + I W       PLD P C + +    C +    +  I A   G  + I  I    I+R+ K + EL  M W I W++L+
Sbjct:   29 VVVMLPDNHLKYSFAFPRVFPAIRMAHDDIQKKGKLLRGYTINLLNHSTESQGAGCSESQAQIM-AVDTKLYEKPDAFFGPGCVYSVASVGRFVNHWKLPLITAWAPAFGFDSKE--EYRTIVRTGLSTTKLGEFAHYL----HSHFNWTTRAFMLFHDLKVDDRPYYFISEGVFLVLRRENIT--------VEAVPYDDQKNSDYREM-ISSLKSNGRIVYICGPLDTFLEFMRIFQNEGLPPEDYAIFYLDMFAKSILDKDYKPWESSD-INWTDPI--KLFKSVFVITAKEPDNPEYKAFQRELHARAKQEFSVQLEPSLEDIIAGCFYDGFMLYAQALNETLAEGGSQNDGINITQKMQNRRFWGVTGLVSTDKNNDRDIDFNLWAMTNHKTGQYGIVAYYNGTNKEIVWSETEKIQWP--KGSPPLDNPPCVFSMDEPFCNEDQLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQ 504          
BLAST of Guanylate cyclase vs. UniProt
Match: sp|P16067|ANPRB_RAT (Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 298/514 (57.98%), Postives = 380/514 (73.93%), Query Frame = 1
Query: 1969 KVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            K Q+FA T  FKGN+VA+K +N   +IE+T ++L E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  + I LDWMF+YSL+ D+ +GM +LHN+    HG+LKSSNC+VDSRFVLKITD+GL S +        ++ +  Y   LWTAPELL+ +  P  G  K DVYSFA+I QEI  R+G F L    +L+ KEI +KVRN   P FRP++  T    ++++ L+++ W +DPT RPDF  IK  +R+ NK G T +ILDNLL RMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ EIARM++A L A+S F I HRP  +L LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TK+ LD  G F +  RG +++KGKG   TYWL GE
Sbjct:  533 KYQIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEP---DDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLE-GLDLSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 182.956 bits (463), Expect = 1.437e-45
Identity = 136/531 (25.61%), Postives = 243/531 (45.76%), Query Frame = 1
Query:  187 VRP--NRDYPLAMLLLPKNFS-TFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIY-LVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ------DIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLS--GCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFS 1740
            VRP   R+  LA++L   N S  + W    P++ + +E + +   ++    + +    +D  C +   PL    +    + PD++ GP C Y  A +AR  + W+ P++T GA+   F++ +   + TL R G        G  +  L   + W     + + DA     P Y    G++  ++G+   V++   +VYT   P   +  +         I     I  +C   +++ +I+L+A   N  NG+Y+F  +D+F             RPW + +R  E+ +  ++AF+T++ IT R+P   +Y+EF   +  RA+ ++       L+N     F+D ++LYA  LN+T+ +GG  EDG  +V+ M  R +  +   V +  + DR  DF L  +   ++G F+  ++Y G +++      + I W  V    PLD P C +DL    C K   +  AI A   G    +  +    I R+   + EL +M W I W++L+        F + D +H     R +
Sbjct:   17 VRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSE----LDGACSEYLAPLRAVDLKLYHD-PDLLLGPGCVYPAASVARFASHWHLPLLTAGAVASGFAA-KNEHYRTLVRTGPS--APKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH---QVYTR-EPGGPEQATHF-------IRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLESGDFQPAAHYSGAEKQIW-WTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ--------FGNSDRYHKGAGSRLT 516          
BLAST of Guanylate cyclase vs. TrEMBL
Match: gnl|BL_ORD_ID|22839004 (tr|G4V651|G4V651_SCHMA Guanylate cyclase OS=Schistosoma mansoni OX=6183 GN=Smp_142620 PE=3 SV=1)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 523/1043 (50.14%), Postives = 687/1043 (65.87%), Query Frame = 1
Query:  424 DVIFGPICDYVIAPIARL-MAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARK--IVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGY-NIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPY--IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPV--NGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 3528
            +VIFGP+ D+ +A  AR   A +N P++      +  S D++ E+  LTRV   + D    ++       Y W   +           +      +G   + G  +  I++ + +K   +L    + ++  + +  ++++ +   I ILC DP++VR IML A  LN +NG+Y F N+D+ SSQ  ++RPWYR+    EENE A++A+R LMT+TL KP+  +Y+ F+ EV+ RA  +Y+F+  +  V  F+ +FHDAV LYAL LND L+KGG I +G L+ + MWNR+F+ +   V I  +GDR AD+SL+D+N  TG FEVV NY G  +    V  + IDW   +N+ PL TP CG+D S C    + +IG + A V    + ++++ G+  +RR KFQAEL AMNWIIPWD L+ +EK  R++           +R S+I + N+         D L+  S E                                        T    N     +   + K+      +VALKP+    ++E +  L IE+KK+KD++ DHICR IGVCL+ P+  IVYEYCPKGSL+DVL  EQIKLDWMFK+SLMQDICRG++YLH   GPHGNLKSSNCLVDSRFVLKITDFGLP ++G           +++++ LWTAPELL   +  +    +IKGDVYSFA++CQEIVYR GVF +    N     I ++V+    PPFRPTL   +GC++D+++LI QAWD+DP+ RPDF +IKL MRKLNK GD+ N+LDNLLSRMEQYANNLE LV +RT QYLEEK+K EDLLYSMLP+ VA QL +NQ V AES++MVTI+FSDIVGFT+LSAESTPMQ++ELLNRLYT FD IIEN+D YKVETIGDAYMV SGLPQ NGN H+RE+ARMSIAFL+AI  F IPHRP+K+LELRIGIHSGPVC+GVVG KMPRYCLFGDTVNTSSRMESNGLPLKIHISQ T ++L TF +FI++ERG +++KGKG Q TYWLHGED  IVDP+P
Sbjct:  146 NVIFGPLNDFTLANAARFSTAMYNVPIVAPAGFAHQLS-DKL-EYGMLTRVLFTYSD--LEWVFGNTLKHYGWLPDQQTPIAIVTTRNVRRREGVVGHTGMAGVFQHLILQKFLVKAAYKLLSVTLDDEFDVTDRFLKRLPDSARIIILCTDPEVVRDIMLEAHKLNMVNGDYAFFNMDLLSSQTKLKRPWYRETSSPEENERARQAYRALMTVTLLKPDSPEYRTFTEEVRARALRDYDFSYRDSEVTPFIGTFHDAVKLYALALNDALAKGGTITNGTLITQEMWNRTFKGVTGVVRIDANGDRNADYSLLDMNPVTGDFEVVVNYFGNDKSLSTVLGRTIDWINTDNQPPLHTPPCGFDGSECHNSHFIHIGIVGAVVFILLMTMSLVLGIIFYRRAKFQAELRAMNWIIPWDALQVTEKHLRRY-----------RRESDIRSPNQ-------SSDPLRKISSETC--------------------------------------TAAAANSQMFARTAFYMKS------IVALKPLRRQTRMEPSKALSIEVKKVKDLNCDHICRLIGVCLEVPHQCIVYEYCPKGSLQDVLENEQIKLDWMFKFSLMQDICRGVMYLHQIFGPHGNLKSSNCLVDSRFVLKITDFGLPHIRGPPPLESEVGSFIFHRNLLWTAPELLPDGDTTIYPRESIKGDVYSFAIVCQEIVYRKGVFYIQNFKNCEPDFIVKEVKAHRKPPFRPTLDSLEGCSEDLVQLICQAWDDDPSVRPDFQSIKLSMRKLNKAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQVVELLNRLYTLFDGIIENFDAYKVETIGDAYMVASGLPQRNGNKHAREVARMSIAFLKAIFEFQIPHRPEKRLELRIGIHSGPVCAGVVGQKMPRYCLFGDTVNTSSRMESNGLPLKIHISQQTFDVLKTFKSFIMTERGLVEMKGKGRQKTYWLHGEDCYIVDPIP 1122          
BLAST of Guanylate cyclase vs. TrEMBL
Match: gnl|BL_ORD_ID|23493829 (tr|A0A210PTL8|A0A210PTL8_MIZYE Guanylate cyclase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22877 PE=3 SV=1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 518/1074 (48.23%), Postives = 677/1074 (63.04%), Query Frame = 1
Query:  355 DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKD----------AYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAK-MEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPK----PGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDD-----LETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMY--YKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            DS+C +T  PL +++  +V    DV FGP+CDY +APIAR   +WN PVI+ GA   AF  D   E+  LTR+   +        + E+   + W      F ++           Y +  P++      Y +K   K    +  + + E  PN+          L+ +      I +LCA  D VR IM++A  LNF NGEY+FLNID+FSS++  E+PWYR+D   E NE A+KA+  LMT+TLRKP   +YK FS EVK+RA+  + NFT   E VNSFV +FHDAVILYA+ LN+TL++   I +G  + K MWNR+F+ +  TV+I  +GDR AD+SL+D+N + G FEVV+NY G  ++YKP  DK I W    N  P DTPTCG+D S CP     P Y I  I   V+G+ + I ++   FI+R  K +AEL  MNW + W+D     +E  +K +R+ S                       ++SL +   L   +         +DT                     S++  + L T  G      +K  + A  ++ K +L   KP+ +             +K+IKD+ NDHI RFIG C+D P   I+ EYC KGSL+DVL  EQIKLDWMF+YSLMQDI RGM YL N+    HGN+KS+NC+VD RFVLKITDFGL +L+G   ++   E  MY  Y++ LWTAPELL +   P  GT KGDVYSFA+ICQEIVYR+GVF L  + +L+ +EI +KV+N   P FRPTL   D   D++ ++I++ W EDP  RPDF  +K  +RKLNK GD GNILDNLLSRMEQYANNLE LV +RT  YLE+K+KAEDLLY MLPK VA  L++ +   AE+Y+ VTI+FSDI GFTA+S+ESTPMQ+++LLN LYT FDS+IEN+DVYKVETIGDAYMV SGLP  NGNLH+REIARMSI+ L A   F I HRP+++L+LRIGIH+GPV +GVVGLKMPRYCLFGDTVNT+SRMESNGLPL+IH+S  TKE+LDTF TF +  RG +++KGKG  +TYWL GE
Sbjct:   92 DSECSETIGPL-KAIDLYVDRDVDVFFGPVCDYAVAPIARFSGYWNIPVISAGATVKAF--DNKTEYRLLTRIQGAYAK--NAEFVLEVAKAFNWTNVGLFFHENMGGGRKGKSNCYFTVEPIF------YKLKNQLKFQPKY--EQFDENFPNEYDFGE-----LLLKASTYTRIVVLCASADSVRDIMIKAHELNFDNGEYVFLNIDLFSSKNESEKPWYREDDTAERNEKARKAYEALMTVTLRKPTSPEYKHFSEEVKKRAESKDRNFTYGEEEVNSFVGAFHDAVILYAIALNETLTRNLSITNGTEITKLMWNRTFDGITGTVSIDDNGDRNADYSLLDMNPKNGKFEVVANYYGNNKEYKPEPDKKIYWAGGRNSPPPDTPTCGFDGSKCPPSEPFPEYGIVII---VLGSLLVIVLVTAFFIYRHIKLEAELAEMNWRVRWEDIMFGSMENDKKLKRQGS-----------------------SVSLNRKMSLASST-------CSVDTIAVHL----------------SDVGQRQLFTKTG-----YYKGAIMAIKSIHKTSLTVNKPLLIE------------VKRIKDLQNDHIVRFIGACIDPPNMCILTEYCQKGSLQDVLENEQIKLDWMFRYSLMQDILRGMTYLFNSDIRSHGNMKSTNCVVDGRFVLKITDFGLHALRGPPDDV---EEGMYAFYRTQLWTAPELLRMHYRPPEGTQKGDVYSFAIICQEIVYRSGVFYLA-NLDLSPEEIHQKVKNGLKPYFRPTLEEADCPCDELAEVIRKCWSEDPMERPDFQALKSTIRKLNKDGDKGNILDNLLSRMEQYANNLEALVEERTSDYLEQKKKAEDLLYMMLPKSVACNLMRGEICHAETYNCVTIYFSDICGFTAMSSESTPMQVVQLLNDLYTAFDSVIENFDVYKVETIGDAYMVVSGLPMRNGNLHAREIARMSISLLNATMSFKIRHRPNEQLKLRIGIHTGPVVAGVVGLKMPRYCLFGDTVNTTSRMESNGLPLRIHVSPCTKEVLDTFTTFDLELRGPVEMKGKGTVITYWLKGE 1077          
BLAST of Guanylate cyclase vs. TrEMBL
Match: gnl|BL_ORD_ID|18327937 (tr|A0A1I8HCY1|A0A1I8HCY1_9PLAT Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 514/1104 (46.56%), Postives = 715/1104 (64.76%), Query Frame = 1
Query:  355 DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARL--MAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGY--LISELFSKYKWNKG--KYIFFKDAYNSTIP--------------MYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGG--KIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEK---RRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESN------ISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINV-NGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMY-YKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLT----PDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDD--------VLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPL 3525
            DS C  +  P+   ++  +++  D++ GP C + +A +AR   M  + RP++TTG +  A      AE+  L RVG      + G   ++  +F ++ W     + I F +  +  +               + CHG+  + V+  + IV+    ++  E+H    K  S I  ++ ++I     + +LCADPD VR+IM++A  L FINGEY+F NID+FSS+ +  +PW R++  +E NE A +A+R LMTITLRKP   +Y+ FS +VK  AK +YNFT   E VNSFV +FHDAVILYAL +NDT+ + G   I +G L+ + M NR+FE +  TV+I+ +GDR AD+SL+D+++ T  F VV++Y G ++KY+ V  K IDW   +N  P D P CG+D S C +    +   +  V+   + +  +    I+R+ + ++EL+AMNW IPW +LE  E+    RR    G +     ++   +  +++        +  + + +S+   +       S  +     K R    +++D+ +      +S  S+DTI G+ L  +   QLF KTA +KG LVALKP+++ N +IE+T +LL+E+K++KD+++D++ RFIG CLD P   +V EYCPKGSL+DVL  + + LDWMFK+SLM DICRGMIYLH+N G HGNLKSSNCLVDSRF LKI DFGL SL+G K     E+     Y++ LWTAPELL    PP  GT +GDVYSFA+ICQEI+YR GVF ++    P+P    +EI EKV+   +  +RPTL   D  T+D        ++  ++  W EDP +RP F +IK  + + NK  ++GNILDNLL RMEQY+NNLE LVAKRT+ YLEEK+KAE+LLY MLPK VA  L++ ++V AE +D VTI+FSDI GFTALS+ESTP++++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NG LH+REI+RM+++FLQ I  F I H+PD +L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T EIL+  G F+ + RG +++KGKG QLTYWLHGE  +IVDP+
Sbjct:   34 DSKCDYSVAPVLGVLL--LQQKIDLMLGPYCSFALAAVARYNRMPHYRRPILTTGGVASALRDK--AEYFNLIRVGPS----FDGVEKMLYLVFQRFNWKPRDVQTILFIELPDEDVKEKRTRDEIGVTQSRILCHGIEKHFVQ-EKYIVR----RLQYEMHNAQFK--SEIFRVMRDEI----RLVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIAVIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHR---GQSHQKRTDSVRILF-----GNSHNEGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRNKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEP----QEIVEKVKEISNQMYRPTL---DAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPV 1103          
BLAST of Guanylate cyclase vs. TrEMBL
Match: gnl|BL_ORD_ID|18266331 (tr|A0A1I8JDN4|A0A1I8JDN4_9PLAT Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 506/1074 (47.11%), Postives = 694/1074 (64.62%), Query Frame = 1
Query:  436 GPICDYVIAPIARLMAFW--NRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKW----NKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKN---WPIKVYTELHPNDIKN---DSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGG--KIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAI-AIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEK---RRRKFSD---------GDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINV-NGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSF---LWTAPELL-NLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLT----PDPNLTSKEIFEKVRNK--DSPPFRPTLM-----LTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDP 3522
            GP C + +A +AR   ++   +P+IT+GA   A + +   E++ L RVG  + D     ++  +F +Y W     +   I +     + +        +   +  R  ++N      +    + P    N    S +   + E++     + +LCADPD VR+IM++A  L FINGEY+F NID+FSS+ +  RPWYRK   NE N  A  A+R LMTITLRKP   +Y++FS +VK  AK  Y+F    E VNSFV +FHDAV+LYAL +NDTL+  G   I +G L+   M +R+F+ +  TV+I+ +GDR AD+SL+D+++ T  F VV++Y G  ++Y+ V+ K+IDW + +N  P D P CG+D S C K    +   +  V+   + + +++ GV I+R+ + ++EL+AMNW I W +LE +E+   RRR  +           D+    T+   ++     E + L+ T +++ +           D D +              + K  +   SN S++TI G+ L  +   QLFAKTA +KGNLVALK I + N ++E+  ++L+EIK++KD+++D+I RFIG CLD P   +V EYCPKGSL+D+L  + + LDWMFK+SLM DICRGMIYLH++ G HGNLKSSNCLVDSRF LKI DFGL SL+G+K   + E  +  Y S+   LWTAPELL N S  P  GT +GDVYSF +I QEI+YR GVF ++    P+P    ++I EK+R      PPFRP+L      L       +L +++  W EDP +RP+F  +K  + + NK  ++GNILDNLL RMEQY+NNLE LVA+RT+QYLEEK+KAE+LLY MLPK VA  L+K ++V AE +D VTI+FSDI GFTALS+ESTPM+++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NGNLH+REIARMS++FL+ I  F I H+PD +L+LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T  IL+  G F+ +ERG +++KGKGLQ TYWLHGE+ NIVDP
Sbjct:   37 GPFCTFCLAAVARYNRYYLYQKPIITSGA---AANLEDKEEYYNLIRVGPMNFD--IENMLLAIFQRYNWLPRQQQNLLIIYVPDDETQLHKQRDETRVTFSRLLRTTIENRFSHQHRYILRVKPYSATNKHFQSEVFRCMREEV----RLVVLCADPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFSDKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSLITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVLIGV-IYRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTFGNHQQEGEEAQPLNPTPNEQQQQ----------DEDPAI-------------APKGSDVVSSNDSVETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKE--LKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEP----QDIIEKIRQPVGSQPPFRPSLSQELVDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVDP 1071          
BLAST of Guanylate cyclase vs. TrEMBL
Match: gnl|BL_ORD_ID|18243152 (tr|A0A267FJR9|A0A267FJR9_9PLAT Guanylate cyclase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025214g3 PE=3 SV=1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 508/1085 (46.82%), Postives = 693/1085 (63.87%), Query Frame = 1
Query:  421 PDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHP------------------NDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGG--KIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAI-AIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEK---RRRKFSD---------GDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINV-NGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSF---LWTAPELL-NLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLT----PDPNLTSKEIFEKVRNK--DSPPFRPTLM-----LTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDP 3522
            P  I G  C Y +  + + M      V++TGA+     S  +       R+G+   + Y   L + + +  +W+   Y+   +     +P Y      YL     K+++   +  + +L P                  ND    S    +L E++  K ++ +LCADPD VR+IM++A  L FINGEY+F NID+FSS+ +  RPWYRK   NE N  A  A+R LMTITLRKP   +Y++FS +VK  AK  Y+F    E VNSFV +FHDAV+LYAL +NDTL+  G   I +G L+   M +R+F+ +  TV+I+ +GDR AD+SL+D+++ T  F VV++Y G  ++Y+ V+ K+IDW + +N  P D P CG+D S C K    +   +  V+   + + +++ GV I+R+ + ++EL+AMNW I W +LE +E+   RRR  +           D+    T+   ++     E + L+ T +++ +           D D +              + K  +   SN S++TI G+ L  +   QLFAKTA +KGNLVALK I + N ++E+  ++L+EIK++KD+++D+I RFIG CLD P   +V EYCPKGSL+D+L  + + LDWMFK+SLM DICRGMIYLH++ G HGNLKSSNCLVDSRF LKI DFGL SL+G+K   + E  +  Y S+   LWTAPELL N S  P  GT +GDVYSF +I QEI+YR GVF ++    P+P    ++I EK+R      PPFRP+L      L       +L +++  W EDP +RP+F  +K  + + NK  ++GNILDNLL RMEQY+NNLE LVA+RT+QYLEEK+KAE+LLY MLPK VA  L+K ++V AE +D VTI+FSDI GFTALS+ESTPM+++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NGNLH+REIARMS++FL+ I  F I H+PD +L+LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T  IL+  G F+ +ERG +++KGKGLQ TYWLHGE+ NIVDP
Sbjct:  122 PRFIVGVPCSYPMNNVQQYMLQPTDAVVSTGAI-----SSNLVNMKQTIRIGTTADEIYKA-LRAFIRNLGRWSGMFYVTMNNVMTKRLPHY------YLDFVQCKLIQQ-ALDHHLKLEPSFRYEYVYVDSLIEEGRQNDSSTSSLYRRILHERVSTKFSVVVLCADPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFSDKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSLITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVLIGV-IYRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTFGNHQQEGEEAQPLNPTPNEQQQQ----------DEDPAI-------------APKGSDVVSSNDSVETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKE--LKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEP----QDIIEKIRQPVGSQPPFRPSLSQELVDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVDP 1163          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 308/515 (59.81%), Postives = 393/515 (76.31%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q+FAKTA FKGN+VA+K +N   +IE+T ++L E+K ++D+ NDH+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMFKYSL+ DI +GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S +   T    E+ + YY   LW AP+LL +SNPP  GT KGD+YSF +I QE+  R GVF +  D +L+ KEI ++V   + P  RPT+  T   ++++ +L+Q+ W E+P  RP+F+ IK+L+RK N+   + +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ +IL  F  F +  RG +++KGKG   TYWL GE  +
Sbjct:  563 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFR---TESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGD-SLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESKS 1070          

HSP 2 Score: 197.593 bits (501), Expect = 4.327e-51
Identity = 144/541 (26.62%), Postives = 255/541 (47.13%), Query Frame = 1
Query:  136 CREGSEALEKTNQGCDLVRPNRDYPLAML--LLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPI-------DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNML------------IEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF----SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            C   +    K++   +  R N ++ +  L  +LPK  +++PWA   P +   ++   K+ N NP +     L  +       D  C ++  PL    + F  E P    GP CDY  +P+      W  P+IT GA    FS DR   + ++T  G  H  K  G     +   + W++   + F D+       Y      + V+G           +YTEL   +I   +T+D +             +++I  +  +  +C  PDI R++M+     N    E++F+ ID+F    +SQ +  +PW R D    ++E+AKKA++++  +T R+P+  +YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++L++       + + + MWNR++  +   V I   GDR  DF+L D+ +  + +F++V+ Y G +++ + +      W      IP D P CG+  D   C      +  + + V+   + I     VFI+R+ K + EL A  W I W+D++ S
Sbjct:   23 CCPTTHTHAKSSHTHESHRHNHNHEIIKLAVILPKTNTSYPWAW--PRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHE-PWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGFS-DRSDAYTSITNTGPTH--KKLGEFALHICRHFGWSQHALLMFGDSKMGERECY------FAVEG-----------LYTELKEVNI---TTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPV--QPWARGD---ADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 530          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 308/515 (59.81%), Postives = 393/515 (76.31%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q+FAKTA FKGN+VA+K +N   +IE+T ++L E+K ++D+ NDH+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMFKYSL+ DI +GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S +   T    E+ + YY   LW AP+LL +SNPP  GT KGD+YSF +I QE+  R GVF +  D +L+ KEI ++V   + P  RPT+  T   ++++ +L+Q+ W E+P  RP+F+ IK+L+RK N+   + +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ +IL  F  F +  RG +++KGKG   TYWL GE  +
Sbjct:  563 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFR---TESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGD-SLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESKS 1070          

HSP 2 Score: 197.593 bits (501), Expect = 4.327e-51
Identity = 144/541 (26.62%), Postives = 255/541 (47.13%), Query Frame = 1
Query:  136 CREGSEALEKTNQGCDLVRPNRDYPLAML--LLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPI-------DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNML------------IEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF----SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            C   +    K++   +  R N ++ +  L  +LPK  +++PWA   P +   ++   K+ N NP +     L  +       D  C ++  PL    + F  E P    GP CDY  +P+      W  P+IT GA    FS DR   + ++T  G  H  K  G     +   + W++   + F D+       Y      + V+G           +YTEL   +I   +T+D +             +++I  +  +  +C  PDI R++M+     N    E++F+ ID+F    +SQ +  +PW R D    ++E+AKKA++++  +T R+P+  +YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++L++       + + + MWNR++  +   V I   GDR  DF+L D+ +  + +F++V+ Y G +++ + +      W      IP D P CG+  D   C      +  + + V+   + I     VFI+R+ K + EL A  W I W+D++ S
Sbjct:   23 CCPTTHTHAKSSHTHESHRHNHNHEIIKLAVILPKTNTSYPWAW--PRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHE-PWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGFS-DRSDAYTSITNTGPTH--KKLGEFALHICRHFGWSQHALLMFGDSKMGERECY------FAVEG-----------LYTELKEVNI---TTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPV--QPWARGD---ADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 530          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 299/516 (57.95%), Postives = 382/516 (74.03%), Query Frame = 1
Query: 1972 VQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            VQ++AKT  +KGN+ A+K +N   +IE+T ++L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D++  E I LDWMF+YSL+ DI +GM +LHN+    HGNLKSSNCLVDSRFVLKITD+GL S +  K + + E+ + YY   LWTAPEL+   N    GT KGDVYSF +I QE+    GVF L   P  + KEI E V     P  RP L+ T   ++++ +L+Q+ W ED   RPDF  IK+++ K N+G  + NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTA+SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+ EIARMS+A L+A+  F I HRPD +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S++T+ +L  F  F +  RG I++KGKG   TYWL GE ++
Sbjct:  542 VQIYAKTCYYKGNITAIKYVN-KKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR--KESYL-EDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFYLD-SPPFSPKEIVEHVAEGRWPYLRP-LLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLGESTS 1050          

HSP 2 Score: 180.644 bits (457), Expect = 9.093e-46
Identity = 142/525 (27.05%), Postives = 236/525 (44.95%), Query Frame = 1
Query:  220 LLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSD---CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNM---------LIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF--SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEV---VSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGC-P---KPGYNIGAISAGVMGAFVAI----------AIIGGVFIH------RRTKFQAELNAMNWIIPWDDLETS 1674
            ++LPK  + +PWA     P++   LEKV     + P      +    ++    C  +  PL    + F  + P    GP CDY  +P+AR    W  P++T GA    F+      + ++T  G  H  K  G  +  +   + W+K   + F D  N   P Y      + V+G            YTE+  ++I     + N          LI  I  +  +  +C   D  RK+M++         EY+F  ID+F  S +    +PW R D    ++E AK+AF+++  +T R+P+  +YK F +++KR AK E+NF+ E+ L+N     FHD V+LY+  LN+++ + G    G +V K MWNR+F  +   V +  +GDR  DF+L D+ + ++G++EV   +  Y  +K               + N   +  P C Y  + C P    P     + S  V+  F+++          A  G V +       R+ K + EL A  W + W+D++ S
Sbjct:   29 IILPKQNTEYPWAWPRVGPALNWALEKVNSDPTLLPGYHMQLVFSSSENKEGLCSDSVAPLVAVDLKFAHD-PWAFIGPGCDYASSPVARFTTHWEVPMVTAGAPALGFNM-----YSSITNTGPTH--KKLGEFVVRMHHNFGWHKYAMVMFHDKKNDDRPCY------FAVEGP-----------YTEMTADNITAKDMVFNEDDEPLSYADLINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPWARGD---ADDEAAKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYEVFIYIHFYTVKK--------------IIFNTTIILLPVC-YTYAVCFPLFFSPLSTFISYSFLVLPFFLSLIVLLRFLFSFAFTGSVPLTPCVLSVRKVKLENELAAQLWRVYWEDIQIS 510          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 551.977 bits (1421), Expect = 1.027e-177
Identity = 293/515 (56.89%), Postives = 375/515 (72.82%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q+FAKTA FKGN+VA+K +N   +IE+T ++L E+K ++D+ NDH+ RFIG C+D P   IV EYCP+GSL                      +  GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S +   T    E+ + YY   LW AP+LL +SNPP  GT KGD+YSF +I QE+  R GVF +  D +L+ KEI ++V   + P  RPT+  T   ++++ +L+Q+ W E+P  RP+F+ IK+L+RK N+   + +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIARMS+A L A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ +IL  F  F +  RG +++KGKG   TYWL GE  +
Sbjct:  543 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSL----------------------VLSGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFR---TESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGD-SLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESKS 1028          

HSP 2 Score: 197.208 bits (500), Expect = 5.912e-51
Identity = 139/511 (27.20%), Postives = 244/511 (47.75%), Query Frame = 1
Query:  220 LLLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPI-------DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNML------------IEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF----SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            ++LPK  +++PWA   P +   ++   K+ N NP +     L  +       D  C ++  PL    + F  E P    GP CDY  +P+      W  P+IT GA    FS DR   + ++T  G  H  K  G     +   + W++   + F D+       Y      + V+G           +YTEL   +I   +T+D +             +++I  +  +  +C  PDI R++M+     N    E++F+ ID+F    +SQ +  +PW R D    ++E+AKKA++++  +T R+P+  +YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++L++       + + + MWNR++  +   V I   GDR  DF+L D+ +  + +F++V+ Y G +++ + +      W      IP D P CG+  D   C      +  + + V+   + I     VFI+R+ K + EL A  W I W+D++ S
Sbjct:   33 VILPKTNTSYPWAW--PRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHE-PWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGFS-DRSDAYTSITNTGPTH--KKLGEFALHICRHFGWSQHALLMFGDSKMGERECY------FAVEG-----------LYTELKEVNI---TTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPV--QPWARGD---ADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 510          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 551.592 bits (1420), Expect = 4.836e-177
Identity = 293/515 (56.89%), Postives = 373/515 (72.43%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            Q+FAKTA FKGN+VA+K +N   +IE+T ++L E+K ++D+ NDH+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMFKYSL+ DI +GM +LHN+    HGNLKSSNC+VD+RFVLKITD+GL S +   T    E+ + YY   LW AP+LL +SNPP  GT KGD+YSF +I QE+  R GVF +  D +L+ KEI ++V   + P  RPT+  T   ++++ +L+Q+ W E+P  RP+F+ IK+L+RK N+   + +ILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ                       VETIGDAYMV SGLP  NG LH+REIARMS+A L A+  F I HRPD++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ +IL  F  F +  RG +++KGKG   TYWL GE  +
Sbjct:  582 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFR---TESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEGD-SLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNRE-VSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQ-----------------------VETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESKS 1066          

HSP 2 Score: 197.593 bits (501), Expect = 4.615e-51
Identity = 144/541 (26.62%), Postives = 255/541 (47.13%), Query Frame = 1
Query:  136 CREGSEALEKTNQGCDLVRPNRDYPLAML--LLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPI-------DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNML------------IEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIF----SSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            C   +    K++   +  R N ++ +  L  +LPK  +++PWA   P +   ++   K+ N NP +     L  +       D  C ++  PL    + F  E P    GP CDY  +P+      W  P+IT GA    FS DR   + ++T  G  H  K  G     +   + W++   + F D+       Y      + V+G           +YTEL   +I   +T+D +             +++I  +  +  +C  PDI R++M+     N    E++F+ ID+F    +SQ +  +PW R D    ++E+AKKA++++  +T R+P+  +YK+F  ++K  AK  +NFT ++ L+N     F+D ++LY   LN++L++       + + + MWNR++  +   V I   GDR  DF+L D+ +  + +F++V+ Y G +++ + +      W      IP D P CG+  D   C      +  + + V+   + I     VFI+R+ K + EL A  W I W+D++ S
Sbjct:   42 CCPTTHTHAKSSHTHESHRHNHNHEIIKLAVILPKTNTSYPWAW--PRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLMAVDLKFAHE-PWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGFS-DRSDAYTSITNTGPTH--KKLGEFALHICRHFGWSQHALLMFGDSKMGERECY------FAVEG-----------LYTELKEVNI---TTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPV--QPWARGD---ADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 549          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 315/525 (60.00%), Postives = 397/525 (75.62%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLE-DVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKG-NKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLI-QQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            G  L +  + Q+FAKT  ++GNLVA+KPIN   KIE+T E+L E+K ++D+ N+H+ RF+G C+D P   IV EYCP+GSL+ D+L  E I LDW+F+YSL+ DI +GM++LHN+  G HG+LKSSNC+VDSRFVLKITD+GL S +  ++   MH   ++Y K  LWTAPELL L +PP  GT KGDVYS  +I QEI  RNG F +    +L+ KEI +KV+N   P FRP+    + C  + L L+ Q+ W EDP  RPDF+ IK+L+ K NK   T NILDNLLSRMEQYANNLE LV +RT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG L+++EIARMS+A L A+  F I HR + KL+LRIGIH+GPVC+GVVGLKMPR+CLFGDTVNT+SRMESNG  LKIH+SQ+TKE+LD FG F +  RG +++KGKG   TYWL GE
Sbjct:  305 GSLLTTQGRNQMFAKTGYYRGNLVAIKPIN-KKKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSCSECEDMH---SLYAKK-LWTAPELLRLEHPPPQGTQKGDVYSLGIILQEIALRNGTFYV-EGMDLSPKEIVQKVKNGQRPYFRPST--DESCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNKENST-NILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGE 820          

HSP 2 Score: 186.037 bits (471), Expect = 1.418e-48
Identity = 101/286 (35.31%), Postives = 158/286 (55.24%), Query Frame = 1
Query:  859 LCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQ----DIIE--RPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS--EKRRR 1689
             C    + R+ M++A +     G+Y+F  +D FS      ++ E  +PW R D   E +E AK+A++ +M I+ R+P+  +YK+F  ++K+RAK ++NFT E+ L+N    SF+DA+++Y   LN TLS GG + DG  + K+MWNR++  +    TI  +GDR  DFSL DL +  TG F VV +Y G   K   V    I W      IP D P CG++   C   G++   +   V    + I  +    I+R+ K + EL +M W + W++++ S  EK RR
Sbjct:    9 FCCSAAVFRQTMVQAHAEGMTAGDYVFFYVDPFSESLSESNVSESRKPWKRGD---EFDEQAKEAYKAVMIISYREPQNIEYKDFVVKLKKRAKEQFNFTIEDTLMNLIAGSFYDAIMMYTAALNKTLSSGGGVHDGHAITKHMWNRTYRGVTGEFTIDRNGDRETDFSLWDLTDMNTGEFNVVLSYDGASSKLIEVPGLEIQWP--GGSIPKDVPLCGFENEACISGGFSTMEVLMIVFSLILLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKARR 289          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 274/480 (57.08%), Postives = 352/480 (73.33%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGD------TGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            D+ N+H+ RF+G C+D P   I+ EYCP+GSL+D+L  E I LDWMF+YSLM DI +GM+YLH++  G HGNLKSSNC+VDSRFVLKITD+GL S++ +      +    Y++  LWTAPELL L      GT KGDVYSFA+I QEI  R+G F L  + +LT+KEI ++V+  + P  RPT+    G ++++  L+Q+ W E+ T RPDF  IK+L++K +   D         ILDNLLSRMEQYANNLE LV +RT+ YLEEK KAE LLY +LP  VA QL + + V AE++D VTI+ SDIVGFTA+SA+STPMQ++  LN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  H+ E+ARM++A L A+  F I HRP ++L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRME+ G   +IH+S +TK ILD +G F++   G +D+KGKG   TYWL GE+
Sbjct:   30 DVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSKA---DSSANYFEKRLWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLEAN-HLTAKEIVQRVKLGEWPYLRPTVD-PGGHSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.891 bits (1143), Expect = 1.525e-141
Identity = 240/476 (50.42%), Postives = 319/476 (67.02%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNM--YYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDS-PPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            +M ++++  F GVC++ P   IV +YC KGSL+DVL     +LDWMFK S   DI  GMI+LH +    HGNLK S CL+DSR  +K+T FG+   +  K     +  N+  ++    WTAPELL + + PVNGT KGDV+SFA++ +E++Y           +L  K+I ++VR+  + PP RP  +LT+ C   +  LI+Q WDE    RPDF+++  ++R  +  GD  NILDN++S++E+YAN+LE +V  RT Q   EK+K + LL S+LP  V  QL   + V  E Y++VTIFF DIVGFTA+SA STP+++I LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EIA MS+ FL +I  F I H P ++L+LRIGI+SGPV +GVVG  MPRYCLFGDTVN +SRMES G PL IH+S++T  +L   G + + ERG I+LKGKG QLTYWL G+
Sbjct:  246 EMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINNLGSFFIELYWTAPELLRMEDLPVNGTPKGDVFSFAILMREVIYHEDEGPYV-GIHLEPKDIIDQVRDGIAVPPLRP--LLTERCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGDM-NILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          

HSP 2 Score: 61.2326 bits (147), Expect = 1.345e-9
Identity = 41/176 (23.30%), Postives = 84/176 (47.73%), Query Frame = 1
Query: 1177 FHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRS---FESLGTTVTISPDGDRYADFSLMDLNQQ---TGMFEVVSN--YIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGV-----FIHRRTKFQAELNAMNWIIPWDDL 1665
             HDA ILYA+ + + L +GG   DG  V++ +   +   F      V+I  +G+R+ D+++ DL ++   TG   + S   +  +   + P   K+   G  + + P D P CG+    C +   +   ++  ++G+ +++ +IG V      + +    Q  ++   W I ++D+
Sbjct:    4 LHDAGILYAMAVRELLRQGGNPRDGRAVIRTIRGSNKIKFYGASGQVSIDVNGERFLDYAVFDLQKKQTATGEMRIASKRYFTFQTINFTPEYQKM---GWPDGRPPSDMPECGFTGELCQEAPISEPDLALVLVGSILSLIVIGTVAFLTYLVVQSRSLQESMDTTWWKINFEDI 176          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 436.802 bits (1122), Expect = 1.287e-139
Identity = 239/480 (49.79%), Postives = 315/480 (65.62%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNK------TNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDS-PPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            +M ++++  F GVC++ P   IV +YC KGSL+DVL     +LDWMFK S   DI  GMI+LH +    HGNLK S CL+DSR  +K+T FG+   +  K       N   +   +  K   WTAPELL + + PVNGT KGDV+SFA++ +E   R    + T    +   +I ++VR+  + PP RP  +LT+ C   +  LI+Q WDE    RPDF+++  ++R  +  G   NILDN++S++E+YAN+LE +V  RT Q   EK+K + LL S+LP  V  QL   + V  E Y++VTIFF DIVGFTA+SA STP+++I LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EIA MS+ FL +I  F I H P ++L+LRIGI+SGPV +GVVG  MPRYCLFGDTVN +SRMES G PL IH+S++T  +L   G + + ERG I+LKGKG QLTYWL G+
Sbjct:  152 EMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWP-TATRANRVPFPDIIDQVRDGIAVPPLRP--LLTERCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 436.417 bits (1121), Expect = 2.289e-134
Identity = 246/520 (47.31%), Postives = 336/520 (64.62%), Query Frame = 1
Query: 1975 QLFAKTALFKGNLVALKPIN-VNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRN------GVFSLTPDPNLTSKEIFEKVR-NKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            ++F    +++GN VALK +         +  LL E++ ++++ ++++  F GVC++ P   IV +YC KGSL+DVL     +LD MFK S   DI  GMI+LH +    HGNLK S CL+DSR  +K+T FG+   +  K   + +  N       WT+PELL +   PVNGT KGDV+SF V+ +E++Y        GV       ++  KEI ++VR  K SPP RP  +LT+ C   +  LIQ+ WDE P  RPDF +I  ++R  +  G   +ILDN++S++E+YAN+LE +V  RT Q   EK+K + LL S+LP  V  QL   + V  E ++ VTIFF DIVGFTA+SA S+P+++I LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EI+ MS+ FL +I  F I H P ++L++RIG++SG V +GVVG  MPRYCLFGDTVN +SRMES G PL+IH+S+ST  +L + G + + ERG I LKGKG QLTYWL+G+
Sbjct:  543 KMFTPLGIYQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRHGKKGKIMDVNNQDIAELFWTSPELLRMEIFPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGV-------DMEPKEIIDQVREGKCSPPLRP--LLTERCEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHR-SILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGK 1052          

HSP 2 Score: 87.0409 bits (214), Expect = 1.934e-17
Identity = 92/421 (21.85%), Postives = 171/421 (40.62%), Query Frame = 1
Query:  358 SDCLQTHKPLYESVINFVKEMPDV-IFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRR---AKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRS---FESLGTTVTISPDGDRYADFSLMDLNQQTGMFE----VVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIG 1587
            +DC    K   +S +  V+E   + + GP+C         L A WN P++  G + +    D  A + T  R+ S    +  G ++      + W +   +    A NST             + AR +     IK  T        +D  +    +  I  K  I IL    +  R+++L A SL    G+++FL +  F      E  +++       +    +A   +M  T++      Y+ F  EV+RR        N + + E V+ + +  HDA ILYA+ + + L  GG   DG  +V+ +   +   F  +   V I  +G+R+ D+++ +L ++    +    +V +       + P   K++ W       P D P CG+    C +  Y+   +   +    +A+ ++G
Sbjct:   64 ADCACDAKVSLDSFVTQVREKGIIALLGPVCAEASEVTGLLAAQWNVPML--GFVGHTQRMDSSAVYDTYVRIMSPL--QRMGQMLEATMRHFGWTRAA-MLGGTAQNSTWANIDELWASVERELARSVTITARIKYDT--------SDKVLHRQNLLDISTKARIVILICGSEEAREVLLEAQSLGLATGKFIFLVVQQF------EDSFWKSVAAERLDTQTLQALEPVMLFTIKAYGSSDYELFLQEVRRRLLGPPFYSNLSSDKE-VSPYAAYLHDAAILYAMAVRELLRHGGNPRDGRAIVRTIKGSTKVKFYGVSGQVNIDVNGERFLDYAVFNLQKKGNSSQFLPVMVFDTFQGSISFTPEYQKMV-WP--EGGPPNDMPICGFLGELCQEIPYSGVVLKPALDEPDLALVLVG 461          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 63.929 bits (154), Expect = 1.491e-10
Identity = 43/139 (30.94%), Postives = 72/139 (51.80%), Query Frame = 1
Query: 2107 HICRFIGVCL--DHPYIVYEYCPKGSLED-VLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVI 2514
            HICR   +C   +H Y+++EY   G L D ++    I+     K++  + I   +IYLH N+  H +LK  N ++     +KI DFGL ++  ++  +     + +  S  + APELL  +NP     +  DV+SF V+
Sbjct:  205 HICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFA--RGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQL-----HTFCGSLYFAAPELLK-ANPYTGPEV--DVWSFGVV 333          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 62.3882 bits (150), Expect = 3.053e-10
Identity = 59/218 (27.06%), Postives = 100/218 (45.87%), Query Frame = 1
Query: 2095 MSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHE---EPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKD--SPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATI 2727
            MS+ +I +FI    D    YI+ E CP GSL ++L + ++  +   ++   Q IC  + Y+H+    H +LK  N   DS + LKI DFGL ++  N++   +     PN       + APE+L   +     + + D++S  V+   ++     F    D N     I+E+++ +D   P  +P        +D+   LI+     DP  RP    I
Sbjct:  136 MSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQ-ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPN-------YIAPEVLMGKHS--GHSFEVDIWSLGVMLYALLIGKPPFQAR-DVNT----IYERIKCRDFSFPRDKP-------ISDEGKILIRDILSLDPIERPSLTEI 331          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 58.151 bits (139), Expect = 8.307e-9
Identity = 42/144 (29.17%), Postives = 72/144 (50.00%), Query Frame = 1
Query: 2107 HICRFIGVCL--DHPYIVYEYCPKGSLED-VLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIV 2529
            HICR   +C   +H Y+++EY   G L D ++    +K     K++  + I   + YLH N+  H +LK  N ++ S   +KI DFGL ++   +  +     + +  S  + APELL     P  G  + D++SF ++   +V
Sbjct:  184 HICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLKEHHARKFA--RGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQL-----HTFCGSLYFAAPELLKAQ--PYTGP-EVDIWSFGIVLYVLV 317          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 54.299 bits (129), Expect = 1.217e-7
Identity = 39/158 (24.68%), Postives = 68/158 (43.04%), Query Frame = 1
Query: 2146 YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPP 2619
            YI+ EYC  GSL  ++++    L      + +     G+ YLH     H ++K++N L+ +   +K+ DFG+ ++  +    +    N       W APE+L         +   D++S      E++ +N      P  NLT   I+  V N    P
Sbjct:   96 YILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLN-------WMAPEILG----NRGASTLSDIWSLGATVVEMLTKNP-----PYHNLTDANIYYAVENDTYYP 237          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 53.1434 bits (126), Expect = 2.655e-7
Identity = 48/192 (25.00%), Postives = 85/192 (44.27%), Query Frame = 1
Query: 2149 IVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICR----GMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRP 2712
            I  EY P GS+  +L          F+ SL+ +  R    G+ YLH  +  H ++K +N L+D +  +KITDFG+ S K +  N    +      S  W +PE++  +      T K D++S   +  E+      F     P+ +  +   K+    +P   P+   ++G        +++A++ D   RP
Sbjct:  531 IFLEYVPGGSVSSMLNNY-----GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGI-SKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTAT----TAKADIWSTGCVVIEMFTGKHPF-----PDFSQMQAIFKIGTNTTPEI-PSWATSEGKN-----FLRKAFELDYQYRP 701          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 510.375 bits (1313), Expect = 5.715e-169
Identity = 278/522 (53.26%), Postives = 365/522 (69.92%), Query Frame = 1
Query: 1960 SMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHE-EPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRP---TLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGED 3504
            ++++ Q+F    ++K N+VA+K IN   +IE+T E+  E+K ++ + ++++  F G C++ P   I+ +YCPKGSL+D+L  E IKLD MF  SL+ DI +GM YLH+     HG LKS NC+VD R+VLKITD+GL   K N+     E E  MYY+  LWTAPELL  ++P   GT KGDVYSF +I QE++ R+G F L+   N  S +I EKV   +SPPFRP   T++L       ++ L +  W+E+P  RPDF  I+  +RKL  G  + NI+DN+++ +E+YANNLE LV +RT Q  +EK+K E+LL  MLP  VA  L+  + V AE++D V+IFFSDIVGFT+LS+ESTP+Q+++LLN LYT FD II NYDVYKVETIGDAYMV SGLP  NG+ H+ EIA M++  L+ I  F I HRP+ KL+LRIGIHSG   +GVVG KMPRYCLFGDTVNT+SRMESNG  LKIHIS STK ILD  G + I +RG + LKGKG  +TYWL G D
Sbjct:    1 NINQRQIFTTVGIYKSNMVAIKRIN-KRQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRK-LWTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPFDLSYYTNEPS-DIIEKVTRVESPPFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQS-NIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 502.286 bits (1292), Expect = 2.216e-165
Identity = 256/473 (54.12%), Postives = 338/473 (71.46%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLM-LTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKL-NKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISI-FIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWL 3492
            D+ +D++ +FIG C+  P   IV +YC +GSL+D+L  + +KLD +F  SL+ DI +GM YLHN+    HGNLKSSNCLVDSR+VLKITD+GLP L+        E     ++  LW APE+L + + P  GT KGDVYSF++I QE   R+G +S      +  K I EKVR  + PP+RP +  L DG  +++  L++Q W EDP  RPDF  IK  +R++ +K G   NI DN+++ ME YA+NLE LVA+RT+Q ++EK+K + LL S+LP+ VA QL K + V AES++ VTI+FSDIVGFT+LSAESTPMQ++  LN LYT FD II+ YDVYKVETIGDAYMV SGLP  NG  H+ EIA+M++  + A+S  FI+ H+P+ KL+LR+G H+GPV +GVVG  M RYCLFGDTVNT+SRMESNG PL+IHISQ TK++LD  GTF++  RG + LKGKG   T+WL
Sbjct:   28 DIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIE---TNWRDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPYSAN---YMEPKAIIEKVRKSEFPPYRPIVANLIDGA-EELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWL 493          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 419.853 bits (1078), Expect = 6.634e-135
Identity = 226/487 (46.41%), Postives = 314/487 (64.48%), Query Frame = 1
Query: 2092 DMSNDHICRFIGVCLDHPYI--VYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSN---PPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTL--MLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 3528
            D+ + ++ R++GVC++ P I  V  +C +G+L+D+L  + IKLDWMF+ S   DI  GM  +HN+    HGNLKSSNCL+DSR+  KITD+GL  L+ N+T     E  +Y K+  WTAPELL L++      N T  GDVYS+ ++  EI+ R+  +S   D  L+SK++ E VR +  P FRP     + +     ++++ Q  WD D   RP F+ IK   +KL   G     +  + SR   Y NN   LV  R    +  K+    LL  +L + +A +L K  +V AES+  VTIFFSDIVGFT+++A+STP+Q+++LLN+LYT FD +++ +DVYKVETIGDAYMV SGLP  NG  H+ E+A M++  L  +  F IPH P +K++LRIGIHSG   +GVVGLKMPRYCLFGDTVN +SRMES+GL L+IH+S   KE+LD  G + + ERG + +KGKG  +TY+L G+D     PLP
Sbjct:    6 DLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVY-KNLFWTAPELLPLADGFKDRKNKTQAGDVYSYGIVLYEIITRDEPYSTNTD-TLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIK---KKLKANGMGNGKISGMFSR---YYNNFSKLVISRMGVCMALKR----LL--VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGKD-GFDKPLP 477          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 416.772 bits (1070), Expect = 1.424e-134
Identity = 211/431 (48.96%), Postives = 290/431 (67.29%), Query Frame = 1
Query: 2188 VLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSN---PPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTL--MLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLK 3462
            +L  + IKLDWMF+ S   DI  GM  +HN+    HGNLKSSNCL+DSR+  KITD+GL  L+ N+T     E  +Y ++  WT PELL L++      N T  GDVYS+ ++  EI+ R+  +S   D  L+SK++ E VR +  P FRP     + +     ++++ Q  WD D   RP F+ IK  + K N  G   NI+DN+++ M +Y + LE +V +RT+Q  EEK K ++LLY MLP+ +A +L K   V AES+  VTIFFSDIVGFT+++A+STP+Q+++LLN+LYT FD +++ +DVYKVETIGDAYMV SGLP  NG  H+ E+A M++  L  +  F IPH P +K++LRIGIHSG   +GVVGLKMPRYCLFGDTVN +SRMES+GL L+IH+S   KE+LD  G + + ERG + +K
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGEFAVY-RNLFWTVPELLPLADGFKDHKNKTQAGDVYSYGIVLYEIITRDEPYSTNTD-TLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKL-KANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 412.149 bits (1058), Expect = 5.602e-132
Identity = 236/493 (47.87%), Postives = 303/493 (61.46%), Query Frame = 1
Query: 2095 MSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGP-HGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLE-----------LRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDS-NIVDPLP 3528
            +S+ +I  +IGVC+  P   IV E C +GSL DVL  + IKLDW FK S   DI  GM  LH +    HGNL SSNCLVD  +V KI D+GL     +      +      KS LW APE  ++ N    G+  GDVYSF VI  EIV R   F         +  I  ++ + + PP RPTL   D C   + K I+Q W E+P++RP F  IK  MRK+N GG +  ++D++L +M+ Y+NNLE LV +RT Q   EK K + LLY MLP+ VA QL   ++V AE +D VT+FFSDIVGFT LS+ STP+Q++  LN LYT FD+II NYDVYKVETIGDAYMV SGLP+ N + H+ EIA M++  L  I  F I H PD +L            L   I SGP  +GVVG+K PRY +FGDTVN +SRMESNG+P +IHIS   ++ L   G + +  RG I+LKGKG  +TY+L+G+D  N V P P
Sbjct:    5 LSHVNINPYIGVCITAPNICIVSEACGRGSLADVLINDDIKLDWTFKMSFATDIAAGMEALHASEVSFHGNLTSSNCLVDRMWVCKIADYGLQRFSKHTYEPEEQLTGQTGKS-LWMAPE--HMRNASSTGSQPGDVYSFGVILSEIVTRCEPFETL----RATTSILRRIMSTEFPPLRPTLN-ADDCDPTITKFIKQCWSEEPSARPTFRDIKKSMRKIN-GGRSLRLVDSMLGKMDIYSNNLEVLVEERTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFLNDLYTYFDNIIPNYDVYKVETIGDAYMVVSGLPEKNRDRHAGEIATMALHLLCDIRTFKIRHVPDTRLVSSYSLLLIITCLFYLIFSGPAVAGVVGIKKPRYDVFGDTVNVASRMESNGVPNRIHISAECRKALLNLGGYHMERRGEIELKGKGKVITYFLNGKDGFNRVRPEP 488          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 311/528 (58.90%), Postives = 395/528 (74.81%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDG--CTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNI 3513
            G  + +  K QLFAKT  FKGNLVA+K +N   +IE+T ++L+E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMF+YSL+ DI +GM +LHN++ G HGNLKSSNC+VDSRFVLKITD+GL S + +  N   ++ +  Y   LWTAPELL   + P  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT   TD    ++++  L++  W EDP  RPDF  IK+ M KLNK G T +IL+NLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIA MS+A L+ +  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TKE+LD F  F +  RG +++KGKG   TYWL GE +++
Sbjct:  482 GSLITAQGKYQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEN---DDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVE-SMDLSPKEIVQKVRNGQRPYFRPT---TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEGST-SILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKTDV 1000          

HSP 2 Score: 104.76 bits (260), Expect = 3.375e-22
Identity = 71/261 (27.20%), Postives = 125/261 (47.89%), Query Frame = 1
Query:  928 EYLFLNIDIFSSQDIIERPWYRKD---------RPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGV--MGAFVAIAIIG--GVFIHRRTKFQAELNAMNWIIPWDDLE 1668
            E +F+N+    +  +  RP+  +          + N  ++   +   ++  IT   P+  +YK+F  ++  RA+ ++    E  L++    SF+D  +LYA+ L++TL++GG   +G  + +   NRSF  +   V+I     R  D  L  + NQ+TG + VVS Y G  ++      + I W +     PLD P C +       P  N G    G+  +G+ +A+ I G     I+R+ K + EL  M W + W+DL+
Sbjct:  202 EGIFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRSKFTHQYDTSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCGP--PLDNPPCVFSTD---DPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQ 457          

HSP 3 Score: 70.0922 bits (170), Expect = 1.304e-11
Identity = 44/176 (25.00%), Postives = 78/176 (44.32%), Query Frame = 1
Query:  214 AMLLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDS-----DCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYL 720
            A ++LP N+  +PWAL    P++ M  E +     +        + Y  ++      C ++   +   V   +   PDV FGP C Y +A + R ++ W  P+IT G   Y F  +++ E+ T+ R+G        G  ++ L +++ W     + F D      P Y    GI++
Sbjct:   36 AAVMLPDNYHKYPWALPRVFPALLMAQEDLHTKHKLLLGHTITILNYSTENPAAPGSCAESRAQVV-VVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGF--EKLDEYKTIVRIGPSTTK--LGAFVNVLHTQFNWTSRAVVIFYDLKQDDRPHYFLSEGIFM 206          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 311/528 (58.90%), Postives = 395/528 (74.81%), Query Frame = 1
Query: 1945 GINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDG--CTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNI 3513
            G  + +  K QLFAKT  FKGNLVA+K +N   +IE+T ++L+E+K ++D+  +H+ RFIG C+D P   IV EYCP+GSL+D+L  E I LDWMF+YSL+ DI +GM +LHN++ G HGNLKSSNC+VDSRFVLKITD+GL S + +  N   ++ +  Y   LWTAPELL   + P  GT KGDVYSF +I QEI  RNG F +    +L+ KEI +KVRN   P FRPT   TD    ++++  L++  W EDP  RPDF  IK+ M KLNK G T +IL+NLLSRMEQYANNLE LV +RT+ YLEEK+KAE+LLY +LP  VA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH+REIA MS+A L+ +  F I HRP+ +L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG  LKIH+S +TKE+LD F  F +  RG +++KGKG   TYWL GE +++
Sbjct:  534 GSLITAQGKYQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCEN---DDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVE-SMDLSPKEIVQKVRNGQRPYFRPT---TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEGST-SILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKTDV 1052          

HSP 2 Score: 165.236 bits (417), Expect = 7.249e-41
Identity = 128/497 (25.75%), Postives = 219/497 (44.06%), Query Frame = 1
Query:  214 AMLLLPKNFSTFPWAL--TIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDS-----DCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGV--MGAFVAIAIIG--GVFIHRRTKFQAELNAMNWIIPWDDLE 1668
            A ++LP N+  +PWAL    P++ M  E +     +        + Y  ++      C ++   +   V   +   PDV FGP C Y +A + R ++ W  P+IT G   Y F  +++ E+ T+ R+G        G  ++ L +++ W     + F D      P Y    GI++     K   N  +      +  D K        L+  I     I  +C   +    IM    S       Y    +D+F+      +PW +  + +  N I  + F+++  IT   P+  +YK+F  ++  RA+ ++    E  L++    SF+D  +LYA+ L++TL++GG   +G  + +   NRSF  +   V+I     R  D  L  + NQ+TG + VVS Y G  ++      + I W +     PLD P C +       P  N G    G+  +G+ +A+ I G     I+R+ K + EL  M W + W+DL+
Sbjct:   36 AAVMLPDNYHKYPWALPRVFPALLMAQEDLHTKHKLLLGHTITILNYSTENPAAPGSCAESRAQVV-VVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGF--EKLDEYKTIVRIGPSTTK--LGAFVNVLHTQFNWTSRAVVIFYDLKQDDRPHYFLSEGIFM---NLKDEMNMTVSARPYTNEQDYKE-------LVSFIKENGRIIYICGPLETFLSIMKLFQSEIQDPESYAIFYLDVFAESLTHRKPW-QNAKFDWTNPI--QVFKSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCGP--PLDNPPCVFSTD---DPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQ 509          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 298/516 (57.75%), Postives = 385/516 (74.61%), Query Frame = 1
Query: 1972 VQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            +Q++ KT  +KGNLVA+K IN   +IE+T  +L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D++  E + LDWMF+YSL+ DI +GM +LHN+    HGNLKSSNC+VDSRFVLKITD+GL SL+   T+   ++ + YY   LWTAPELL   +PP+ GT KGDVYSF +I QE+    GVF +     L  KEI + V     P  RP+L      ++++  L+Q+ W E+P  RPDF TIK+L+RK ++G  + NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH RE+ARM++A L A+  F I HRP ++L LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES G  LKIH+S++T+++L  F TF +  RG I++KGKG   TYWL GED++
Sbjct:  545 LQIYTKTGYYKGNLVAIKYIN-KKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLR---TSSCPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTH-TLIPKEIIQGVIRGGVPLLRPSLCFHSH-SEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDNS 1053          

HSP 2 Score: 165.236 bits (417), Expect = 6.765e-41
Identity = 122/431 (28.31%), Postives = 207/431 (48.03%), Query Frame = 1
Query:  421 PDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNA-INILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERP---WYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGG------KIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            P    GP CDY  +P+AR    W+ P++T GA      +D  ++F  +T  G  H  K  G    ++   + W+    + F D  +      C+    + ++G   ++    I V+      D   +S I++  + QI  KN  +  LC   D +R +M++          Y+F  ID+F+     E+P   W+R D   +++  A+ AFR++  +T  +P+  +Y +F   +K+ A+  +NFT ++ L N     F+D V+LY+  LN+TLSK        +   G++V + MWNR+F+ +  TV +   GDR  DF+L D+    +G FEVV  Y    ++   V  K +++       PL+ P CG+  D   C      +  + A V+     I I   +FI+R+ K + EL A  W + W D++ S
Sbjct:  105 PWAFIGPGCDYSSSPVARFTTHWDVPMVTAGA-----RADGFSKFAAVTNTGPTH--KKLGEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCY----FAIEGLYSLMGKHNITVF------DYFVESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWFRGD---QDDHAARLAFRSVKVLTYMEPQNAEYHQFVETLKKDAEKMFNFTIKDSLYNLIAGGFYDGVMLYSRALNETLSKRKPGLRPVQRPKGDMVTQRMWNRTFQGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVVCVYNSSIKEL--VLQKGLNFQWPGGSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMS 513          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 298/516 (57.75%), Postives = 385/516 (74.61%), Query Frame = 1
Query: 1972 VQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSN 3510
            +Q++ KT  +KGNLVA+K IN   +IE+T  +L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D++  E + LDWMF+YSL+ DI +GM +LHN+    HGNLKSSNC+VDSRFVLKITD+GL SL+   T+   ++ + YY   LWTAPELL   +PP+ GT KGDVYSF +I QE+    GVF +     L  KEI + V     P  RP+L      ++++  L+Q+ W E+P  RPDF TIK+L+RK ++G  + NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTALSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH RE+ARM++A L A+  F I HRP ++L LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES G  LKIH+S++T+++L  F TF +  RG I++KGKG   TYWL GED++
Sbjct:  486 LQIYTKTGYYKGNLVAIKYIN-KKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLR---TSSCPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTH-TLIPKEIIQGVIRGGVPLLRPSLCFHSH-SEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDNS 994          

HSP 2 Score: 85.8853 bits (211), Expect = 2.092e-16
Identity = 102/425 (24.00%), Postives = 171/425 (40.24%), Query Frame = 1
Query:  421 PDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNA-INILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIER---PWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQ-QTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            P    GP CDY  +P+AR    W+ P++T GA      +D  ++F  +T  G  H  K  G    ++   + W+    + F D  +      C+    + ++G   ++    I V+      D   +S I++  + QI  KN  +  LC   D +R +M++          Y+F  ID+F+     E+   PW+R D   +++  A+ AFR      +R P                           + NSF         +Y L    T     +I   ++  + +W      +  TV +   GDR  DF+L D+    +G FEV         K+ P   K +++       PL+ P CG+  D   C      +  + A V+     I I   +FI+R+ K + EL A  W + W D++ S
Sbjct:  105 PWAFIGPGCDYSSSPVARFTTHWDVPMVTAGA-----RADGFSKFAAVTNTGPTH--KKLGEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCY----FAIEGLYSLMGKHNITVF------DYFVESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWFRGD---QDDHAARLAFR------VRHP--------------------------SIFNSFS--------VYNLSTTITPQSFMQI---KMCSEPVWCVVSAGVMGTVEMDKFGDREIDFALWDMTDINSGKFEV---------KHLP---KGLNFQWPGGSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMS 454          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 296/513 (57.70%), Postives = 386/513 (75.24%), Query Frame = 1
Query: 1972 VQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNH-GPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGE 3501
            +Q+FAKT  +KGN+VA+K  N   +IE+  ++L E+K ++D+ N+H+ RFIG C+D P   I+ EYCP+GSL+D+L  + I L+WMFK+SL+ DI +GM++LHN+    HG LKSSNC+VD+RFVLKITD+GL + +  + + +  + + YY   LW APELL + NPP  GT KGDVYSF++I QE+  R G F L  DP L+ KEI ++V   D P  RP++      + ++ +L+Q+ W E+PT RPDF  I+LL+RK NK   T NILDNLLSRMEQYANNLE LV +RT+ Y EEK+KAE LLY +LP  VA QL + + V AE++D V+I+FSDIVGFTALSAESTPM+++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L  +  F I HRP+++L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMES+G  LKIH+S +T+++L  F +F +  RG ID+KGKG   TYWL GE
Sbjct:  553 LQVFAKTGYYKGNIVAIKYTN-KKRIELNRKVLFELKHMRDVQNEHLTRFIGACVDPPNICIITEYCPRGSLQDILENDSITLEWMFKFSLINDIVKGMVFLHNSVIFSHGKLKSSNCVVDNRFVLKITDYGLSTFR--QESDVGSDSHSYYAQKLWMAPELLRMENPPPQGTQKGDVYSFSIILQEVALRRGAFYLDGDP-LSPKEIVDRVILGDWPCLRPSID-PQSHSPELGQLMQRCWAEEPTERPDFNHIRLLLRKHNKESRT-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWLLGE 1059          

HSP 2 Score: 196.052 bits (497), Expect = 1.297e-50
Identity = 139/506 (27.47%), Postives = 242/506 (47.83%), Query Frame = 1
Query:  190 RPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEK-VRKMEXXXXXXXXXXXLYPIDSD------CLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTID-NMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDL-NQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGY--DLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETS 1674
            RP ++  LA ++LP+  + +PWA   P I   LE+ + K+ +   ++ N  + Y   S       C ++  PL    + F  + P    GP C Y  +P+      W+ P+IT GA   AF  D I  + T+T  G  H  K  G     +   + W +   + F D      P Y    G+Y  +  + I  +    V+ E       N   I+ + ++  I N   +  +C  PD+ R++M+     +  + +Y+FL ID+F+     ++PW R D   +++ IAK AF+++  ++ R+P+ ++Y++F  ++K  AK  +N++ ++ L+N     F+D ++LYA  LN+T    G    G+L+   MWNR+F  +   + +   GDR  DF+L DL +  +  F++V  Y   + +  PV    + W  +    PLD P CG+  D   C      I  + +  +     + +   +FI R+ K + EL A  W I WDD++ S
Sbjct:   40 RPRQNITLA-IILPETNTAYPWAW--PRIGPALERAIIKINSDPNLLPNHHLTYVFKSSENSNGICSESVAPLVAVDLEFAYK-PWAFIGPGCSYTASPVGLFTTHWDVPLITAGAPAIAFL-DGI--YPTITNTGPTH--KKLGRFALRICEHFGWREYVTLMFSDNKEDDRPCYFAMEGLY--EELKSINISLQDSVFEE-------NKPPINYSQILADIQNIGRVMFVCCSPDVFRRLMIEFWKADLPHEQYVFLYIDLFAVSLSNKQPWARGD---QDDTIAKDAFQSVKILSYREPQNQEYQQFVRDLKADAKTSFNYSVQDSLMNIIAGGFYDGLMLYAHALNETALVPGARPPGKLISGKMWNRTFHGVTGLLHLDVSGDRETDFALWDLVDTNSSSFQIVVVYNSFEEQVTPVPGTSVRW--LGGARPLDVPKCGFKNDNPACLTKTITIHQMVSITLFFIFTMTLTIAIFICRKMKLEKELVAQLWRISWDDIQMS 522          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 2309.64 bits (5984), Expect = 0.000e+0
Identity = 1155/1155 (100.00%), Postives = 1155/1155 (100.00%), Query Frame = 1
Query:   70 MFFQSVKTMFFHCLLTGFIISLCREGSEALEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD 3534
            MFFQSVKTMFFHCLLTGFIISLCREGSEALEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMENINPIIKNIKILYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKLNKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLDHPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD
Sbjct:    1 MFFQSVKTMFFHCLLTGFIISLCREGSEALEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMENINPIIKNIKILYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKLNKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLDHPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD 1155          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 1395.18 bits (3610), Expect = 0.000e+0
Identity = 698/1148 (60.80%), Postives = 868/1148 (75.61%), Query Frame = 1
Query:  109 LLTGFIISLCREGSEA-LEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKP--GYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLD--HPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSP-PFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD 3534
            +L   +IS    G E       Q C + RP+R YPLAML+LPKNFS FPW LTIP+IK+ LEKV+ M  +NPI+K++K L P+DS C++T+  LY  V  FV +MPDV+FGPIC YV+APIARL+AFWN P+++TGA+YY F  +R +EF TLTR+GSGHLD   G +I + F KYKW  G YI+ K AY + IP+YCH LG YL +     V  WPI+ Y EL    + ND+ ++  LI+ IGNK A+ +LC DP  V +I+L+A  LNF NGEY+F+NI +FSS +  + PWY       EN  AK+A+R+L+++TL+ PE EK++ FS +VK  A  EYN+  E +L+N+FVS+F+D V+LYA  LN TL+ GG I +G L++KNMWN +FE +G TVTI   GDR ADFS++D++ +TG F+ V+++IG K  +  V +  +DWG+V+N IP   P CGYD S CPKP    NIGAISAGVMG    I+   G F++R  K QAELNAMNWIIPW+ LETSEK R   +     H   K +   I N     + S +++ +     +EN +L+ +++    K  + N     N    D   IS  SL+TI GINLD +   QLF KTAL+KGN+VALKPI    +I+I  +LLI++KK+KD++NDHICRFIG CL+  + Y+VY+YCPKGSLEDVLAKEQI LDW+FKYSL+QDICRGM+YLHNN GP G LKSSNCLVDSRFVLKITDFGL SL+G+K  ++ E+ N+Y+K+ LWTAPELL +SNPP++GT KGDVYSFA++CQEIVYR GVFSL  + + +++EI E V+ ++SP PFRP+L    GCT+D + LI+Q+W+EDP  RPDF TIK  MRK NK GD+GNILDNLLSRMEQYANNLE +V +RTEQYLEEK+KAEDLLYSMLPK VAHQLIKNQ V AESYD+VTIFFSDIVGFTALSAESTPMQII+LLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLH+REIARM+IAFL AI  F+IPHRPDK+L+LRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLP KIHISQST ++L TFGTF+++ERGHI++KGKG   TYWLHGE+  IVDP+P D
Sbjct:    1 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVN-----HNCVKYQSKPIHNSKVKVHQSRSQNVKGTRNEMENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKD 1143          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 1394.02 bits (3607), Expect = 0.000e+0
Identity = 699/1148 (60.89%), Postives = 867/1148 (75.52%), Query Frame = 1
Query:  109 LLTGFIISLCREGSEA-LEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKP--GYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLD--HPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSP-PFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD 3534
            +L   +IS    G E       Q C + RP+R YPLAML+LPKNFS FPW LTIP+IK+ LEKV+ M  +NPI+K++K L P+DS C++T+  LY  V  FV +MPDV+FGPIC YV+APIARL+AFWN P+++TGA+YY F  +R +EF TLTR+GSGHLD   G +I + F KYKW  G YI+ K AY + IP+YCH LG YL +     V  WPI+ Y EL    + ND+ ++  LI+ IGNK A+ +LC DP  V +I+L+A  LNF NGEY+F+NI +FSS +  + PWY       EN  AK+A+R+L+++TL+ PE EK++ FS +VK  A  EYN+  E +L+N+FVS+F+D V+LYA  LN TL+ GG I +G L++KNMWN +FE +G TVTI   GDR ADFS++D++ +TG F+ V+++IG K  +  V +  +DWG+V+N IP   P CGYD S CPKP    NIGAISAGVMG    I+   G F++R  K QAELNAMNWIIPW+ LETSEK R   +   N   Y  K   N          S  K  + + +++EN +L+ +++    K  + N     N    D   IS  SL+TI GINLD +   QLF KTAL+KGN+VALKPI    +I+I  +LLI++KK+KD++NDHICRFIG CL+  + Y+VY+YCPKGSLEDVLAKEQI LDW+FKYSL+QDICRGM+YLHNN GP G LKSSNCLVDSRFVLKITDFGL SL+G+K  ++ E+ N+Y+K+ LWTAPELL +SNPP++GT KGDVYSFA++CQEIVYR GVFSL  + + +++EI E V+ ++SP PFRP+L    GCT+D + LI+Q+W+EDP  RPDF TIK  MRK NK GD+GNILDNLLSRMEQYANNLE +V +RTEQYLEEK+KAEDLLYSMLPK VAHQLIKNQ V AESYD+VTIFFSDIVGFTALSAESTPMQII+LLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLH+REIARM+IAFL AI  F+IPHRPDK+L+LRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLP KIHISQST ++L TFGTF+++ERGHI++KGKG   TYWLHGE+  IVDP+P D
Sbjct:    1 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNH--NCVKYQSKPIHN----------SKVKVHQSRSQNMENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKD 1136          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 580/1118 (51.88%), Postives = 763/1118 (68.25%), Query Frame = 1
Query:  196 NRDYPLAMLLLPKNFS-TFPWALTIPSIKMGLEKVRKMEXXXXXXXXXXXLYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRR---KFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNP-PVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 3528
            N DYPLA++++P +    F   L + +  + LEK+R       I K        DSDCL +  PLY +V   +K  P V FGPICDY +APIARL+ FW+ P+IT       F   +  E+ TLTRV S  +  +   L  ++F  Y W++ K I     Y  T   +C  +G        +  KN   K    L+          + +L   +G++NA+ +LC +P+ VR+I+L+A  LNFINGEY+F+NID+ +S+   ++PWY K+  +E N  AK+A+R+L+T+T ++PE E+Y+ F  EVK R   +Y   +E+   N F+  FHD+++LYAL LNDT++     E+G  + + MWNR+ + +   ++I  +GDR AD+S++D+++ TG+F++V+NYIG+K+ Y PV  +IIDW    N  P   P CGY+   CP      G IS   M A +  A+I G +I++R KFQAELNAMNW+IPWD++ET EKR R   K SD         KRF       +     L K DE     I N  L  D+  S+          R NS      NIS  S ++  G+  D++H ++ F  TAL+KGN+VALK ++ + K+EI   LLIE+KK+K+++N+HICRFIGVCLD P  +++ EYCPKGSL+D+L  EQI LDWMFK+SL+QDICRGMIYLH+N GPHGNLKSSNCLVDSRFVLKI DFGL  L+G K  ++  +   YY++ LWTAPE+L  +    +  + K DVYSF +ICQE+VYRNGVF L+ D NL  K+I E V      P+RP L   + C++ + ++I+Q+W ED + RPDF TIK +MR LNKGGD+GNILDNLLSRMEQYANNLE LV +RTEQYLEEK+K EDLLYSMLPK VA QLI+N+ V AESY+MV+I+FSDIVGFTALSAESTPMQ+IELLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARMS+AFL AI  F IPH+P+K++ELRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIH+S+ + ++L TF  FIIS+RG +++KGKG Q TYWLHGEDS IVDP+P
Sbjct:   35 NPDYPLAIIMIPDDIRHNFNKNLMLSAFDIALEKIRTWNIHPFIRKLKYYA-DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLI-----YEQTFLNFCRSVGTLF---DSENYKNKTFKSVVLLNA---------ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRF-------QYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPS--------RVNSI-----NISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLS-DINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 1110          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 554/1040 (53.27%), Postives = 725/1040 (69.71%), Query Frame = 1
Query:  427 VIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRR---KFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSXXXXXXXXXXRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGXXXXXXXXXXXXXXXXDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNP-PVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 3528
            V FGPICDY +APIARL+ FW+ P+IT       F   +  E+ TLTRV S  +  +   L  ++F  Y W++ K I     Y  T   +C  +G        +  KN   K    L+          + +L   +G++NA+ +LC +P+ VR+I+L+A  LNFINGEY+F+NID+ +S+   ++PWY K+  +E N  AK+A+R+L+T+T ++PE E+Y+ F  EVK R   +Y   +E+   N F+  FHD+++LYAL LNDT++     E+G  + + MWNR+ + +   ++I  +GDR AD+S++D+++ TG+F++V+NYIG+K+ Y PV  +IIDW    N  P   P CGY+   CP      G IS   M A +  A+I G +I++R KFQAELNAMNW+IPWD++ET EKR R   K SD         KRF       +     L K DE     I N  L  D+  S+          R NS      NIS  S ++  G+  D++H ++ F  TAL+KGN+VALK ++ + K+EI   LLIE+KK+K+++N+HICRFIGVCLD P  +++ EYCPKGSL+D+L  EQI LDWMFK+SL+QDICRGMIYLH+N GPHGNLKSSNCLVDSRFVLKI DFGL  L+G K  ++  +   YY++ LWTAPE+L  +    +  + K DVYSF +ICQE+VYRNGVF L+ D NL  K+I E V      P+RP L   + C++ + ++I+Q+W ED + RPDF TIK +MR LNKGGD+GNILDNLLSRMEQYANNLE LV +RTEQYLEEK+K EDLLYSMLPK VA QLI+N+ V AESY+MV+I+FSDIVGFTALSAESTPMQ+IELLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARMS+AFL AI  F IPH+P+K++ELRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIH+S+ + ++L TF  FIIS+RG +++KGKG Q TYWLHGEDS IVDP+P
Sbjct:   53 VWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLI-----YEQTFLNFCRSVGTLF---DSENYKNKTFKSVVLLNA---------ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRF-------QYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPS--------RVNSI-----NISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLS-DINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 1051          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR13.410e-5558.05natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR21.095e-4357.59natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2F4.516e-12647.20guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D3.367e-12348.67guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C6.419e-11344.92guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-280.000e+040.71Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-280.000e+040.62Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-285.594e-17652.39Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-281.819e-16549.72Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-229.497e-13244.63Receptor-type guanylate cyclase gcy-22 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311830.000e+040.63gene:FBgn0051183 transcript:FBtr0346151[more]
CG311830.000e+040.63gene:FBgn0051183 transcript:FBtr0083187[more]
CG107381.436e-15151.82gene:FBgn0036368 transcript:FBtr0304792[more]
CG107381.697e-15151.82gene:FBgn0036368 transcript:FBtr0304791[more]
CG107382.777e-15151.82gene:FBgn0036368 transcript:FBtr0302487[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b3.087e-3858.79natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr25.694e-3758.49natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
npr1a9.761e-5358.25natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a9.761e-5358.25natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b6.407e-17956.84natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR20.000e+058.27natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+056.17natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.13natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.13natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.13natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr14.568e-5657.66natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr20.000e+057.86natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr25.487e-4657.98natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr29.285e-14356.16natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2g1.599e-13444.36guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18293|ANPRA_MOUSE3.195e-5557.66Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P16066|ANPRA_HUMAN1.637e-5458.05Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|P18910|ANPRA_RAT1.322e-5657.66Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P55202|ANPRB_ANGJA2.936e-3959.27Atrial natriuretic peptide receptor 2 OS=Anguilla ... [more]
sp|P16067|ANPRB_RAT1.437e-4557.98Atrial natriuretic peptide receptor 2 OS=Rattus no... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|228390040.000e+050.14tr|G4V651|G4V651_SCHMA Guanylate cyclase OS=Schist... [more]
gnl|BL_ORD_ID|234938290.000e+048.23tr|A0A210PTL8|A0A210PTL8_MIZYE Guanylate cyclase O... [more]
gnl|BL_ORD_ID|183279370.000e+046.56tr|A0A1I8HCY1|A0A1I8HCY1_9PLAT Guanylate cyclase O... [more]
gnl|BL_ORD_ID|182663310.000e+047.11tr|A0A1I8JDN4|A0A1I8JDN4_9PLAT Guanylate cyclase O... [more]
gnl|BL_ORD_ID|182431520.000e+046.82tr|A0A267FJR9|A0A267FJR9_9PLAT Guanylate cyclase O... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b4.327e-5159.81atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b4.327e-5159.81atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a9.093e-4657.95natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.027e-17756.89atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b4.836e-17756.89atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.11.418e-4860.00pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR10.000e+057.08natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.11.525e-14150.42pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008986.11.287e-13949.79pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000008942.12.289e-13447.31pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN11.491e-1030.94Serine/threonine protein kinase involved in regula... [more]
CDC53.053e-1027.06Polo-like kinase; controls targeting and activatio... [more]
KIN28.307e-929.17Serine/threonine protein kinase involved in regula... [more]
CDC151.217e-724.68Protein kinase of the Mitotic Exit Network; locali... [more]
STE112.655e-725.00Signal transducing MEK kinase; involved in pheromo... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342755.715e-16953.26Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309852.216e-16554.12Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361826.634e-13546.41Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279231.424e-13448.96Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362045.602e-13247.87Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr23.375e-2258.90natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr27.249e-4158.90natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc76.765e-4157.75membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc72.092e-1657.75membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc21.297e-5057.70membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056411.10.000e+0100.00SMESG000056411.1[more]
SMESG000010241.10.000e+060.80SMESG000010241.1[more]
SMESG000010241.10.000e+060.89SMESG000010241.1[more]
SMESG000068881.10.000e+051.88SMESG000068881.1[more]
SMESG000068881.10.000e+053.27SMESG000068881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021820 ID=SMED30021820|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3650bp
GATATTTGACAACAAAAATAGAATCAAAGAATTTTCGACAATATAAACAA
AAATAAACGCTTCTCCAAAATGTTTTTTCAATCAGTAAAAACAATGTTCT
TTCATTGTCTTTTGACGGGTTTCATTATTTCTCTTTGCCGAGAAGGATCC
GAGGCGTTAGAAAAGACAAATCAAGGTTGTGATTTGGTGAGACCTAATCG
GGATTATCCACTGGCCATGTTATTGCTGCCGAAAAATTTCTCAACTTTCC
CATGGGCTTTGACAATTCCATCTATTAAAATGGGACTGGAAAAAGTACGG
AAAATGGAAAATATTAATCCGATTATCAAAAATATAAAAATACTTTATCC
AATTGACAGTGACTGTTTGCAGACTCACAAACCACTTTACGAATCAGTGA
TAAATTTTGTCAAGGAAATGCCAGATGTTATATTTGGACCAATATGTGAT
TACGTAATAGCTCCTATTGCACGGTTAATGGCGTTCTGGAATAGGCCAGT
GATAACAACTGGTGCACTGTATTACGCCTTTAGTAGTGACAGAATTGCGG
AGTTTCATACTCTGACGAGAGTCGGAAGTGGTCATTTAGACAAATACACC
GGATATTTAATTTCAGAATTGTTTTCCAAATACAAGTGGAATAAAGGAAA
ATATATCTTTTTCAAAGACGCTTACAACAGCACCATCCCGATGTATTGTC
ACGGATTGGGAATTTATTTAGTTAAAGGAGCTCGAAAAATTGTCAAAAAC
TGGCCAATAAAAGTCTACACCGAATTGCACCCAAATGATATAAAGAATGA
TTCAACAATTGATAACATGCTTATTGAACAAATTGGCAATAAAAATGCCA
TAAATATTTTATGTGCTGATCCAGATATTGTCAGAAAAATTATGTTACGA
GCTGCATCACTAAATTTTATCAATGGTGAATACTTATTTTTGAATATAGA
CATATTCAGCAGTCAAGATATTATTGAGAGACCCTGGTATAGAAAAGATA
GACCAAATGAGGAGAATGAAATAGCTAAAAAGGCATTTAGAACTTTAATG
ACAATCACACTTAGAAAACCGGAAGGCGAAAAATACAAAGAGTTCTCAGC
AGAAGTCAAACGAAGAGCGAAAATGGAATACAATTTTACTGACGAAAATG
AACTTGTAAATAGCTTTGTCAGTTCTTTCCATGATGCAGTTATTCTGTAT
GCTCTGGGTTTAAATGATACTTTGAGTAAAGGAGGAAAAATTGAAGATGG
GGAATTAGTTGTTAAAAATATGTGGAATCGATCATTTGAAAGCCTAGGAA
CGACTGTAACAATAAGCCCTGATGGGGATAGATATGCCGATTTTTCTTTG
ATGGATTTGAATCAGCAAACCGGAATGTTTGAGGTAGTTTCAAATTATAT
TGGTAGAAAAAGAAAATACAAACCTGTAAATGATAAAATCATTGACTGGG
GGACTGTTAATAATAAAATTCCACTAGATACACCGACATGCGGATATGAT
CTATCTGGCTGTCCCAAACCAGGATACAATATCGGTGCCATTTCCGCAGG
AGTAATGGGCGCTTTTGTAGCAATTGCAATTATTGGCGGTGTTTTTATTC
ACCGACGAACGAAGTTTCAAGCCGAATTAAATGCAATGAATTGGATTATT
CCTTGGGATGATTTGGAAACATCTGAGAAACGTAGACGGAAATTTTCTGA
CGGAGATAATTTCCATCCTTATACGAAAAAAAGATTTTCGAACATTATGA
ATAAAAATGAGATGGAGAATCTTTCCTTAACGAAAGATGATGAATTAAAG
CACGAATCTATTGAAAACTATTATCTCATGACAGATATTGACACATCAAA
AAAGAAAAAACATAAATTAAATAAACTAAGGAGATATAATTCTTATAAAG
ATGATGAATCAAATATCAGCAATAAGTCGTTGGACACAATTATTGGCATC
AATTTGGACAGTATGCACAAGGTGCAACTCTTTGCGAAAACAGCTTTATT
CAAGGGAAACTTGGTGGCACTGAAACCGATAAATGTCAACGGAAAAATAG
AGATTACAACTGAGCTATTGATTGAGATTAAAAAGATAAAAGATATGAGT
AATGATCACATCTGCCGATTTATTGGAGTTTGTTTAGATCACCCGTATAT
TGTTTATGAGTATTGTCCAAAAGGCAGTTTGGAAGATGTCCTTGCAAAAG
AACAAATCAAGCTTGATTGGATGTTTAAGTATTCACTGATGCAAGACATT
TGTCGAGGAATGATTTACTTACATAATAATCACGGACCTCATGGAAATTT
GAAAAGCTCAAATTGCTTAGTTGATTCAAGATTTGTATTGAAAATAACTG
ATTTTGGCCTACCATCTTTGAAGGGAAATAAGACCAATATGATGCATGAA
GAACCAAATATGTATTATAAAAGTTTTCTTTGGACTGCCCCAGAACTATT
GAACTTATCCAATCCACCAGTTAATGGAACAATCAAAGGAGACGTCTATA
GTTTTGCTGTGATATGCCAAGAAATTGTATATAGAAATGGGGTTTTTTCG
TTAACTCCTGATCCAAATTTGACCTCAAAAGAAATCTTTGAAAAAGTCCG
AAACAAAGATTCACCACCATTTCGTCCAACATTAATGCTCACAGACGGAT
GTACAGATGACGTGTTAAAATTAATTCAACAAGCTTGGGATGAGGATCCC
ACCAGTCGACCAGATTTTGCTACAATTAAATTGCTGATGAGAAAATTAAA
CAAGGGCGGAGATACTGGGAACATATTGGATAATTTACTTTCCCGGATGG
AGCAATATGCTAATAATCTCGAAGGACTTGTGGCGAAAAGAACTGAACAA
TATCTAGAGGAAAAACAAAAGGCCGAAGATTTACTCTATTCTATGCTACC
AAAATTTGTTGCGCATCAGTTGATAAAAAATCAAAATGTAATTGCGGAAA
GTTATGACATGGTTACGATTTTCTTTAGTGACATAGTTGGTTTTACCGCA
CTGTCGGCTGAATCAACACCAATGCAAATCATTGAGTTACTCAATCGACT
TTACACTACTTTTGACTCAATAATCGAAAATTATGACGTATATAAAGTAG
AAACAATTGGAGACGCTTACATGGTCTGTTCTGGACTACCTCAGTTGAAT
GGAAATTTACATTCGCGGGAAATCGCCCGAATGTCCATTGCTTTTTTACA
AGCAATTAGTATTTTCATCATTCCACATAGGCCAGATAAGAAATTAGAAT
TGCGAATAGGCATTCATTCAGGACCAGTGTGCTCTGGTGTTGTTGGACTA
AAGATGCCAAGATATTGTTTATTTGGTGATACAGTTAATACGTCAAGTAG
AATGGAATCCAATGGATTGCCTTTGAAAATACACATCAGTCAATCTACTA
AGGAAATTTTAGATACCTTTGGTACATTCATTATTTCAGAAAGGGGACAT
ATTGATTTGAAGGGTAAAGGACTTCAGTTGACCTATTGGTTGCATGGTGA
AGATTCGAATATTGTAGATCCACTTCCGGTTGACTAAATTTATTAAAATT
TTACTAACACTGATTCGAGAATCCAAGAGTCATTTTATGTTTAAATTGAT
AAATGAGATATGATAAAATTTTATAAATGTTTAACTGGTTAACTTTTCAG
back to top

protein sequence of SMED30021820-orf-1

>SMED30021820-orf-1 ID=SMED30021820-orf-1|Name=SMED30021820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1156bp
MFFQSVKTMFFHCLLTGFIISLCREGSEALEKTNQGCDLVRPNRDYPLAM
LLLPKNFSTFPWALTIPSIKMGLEKVRKMENINPIIKNIKILYPIDSDCL
QTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGAL
YYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKD
AYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNM
LIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQD
IIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRA
KMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKN
MWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKY
KPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFV
AIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHP
YTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKL
NKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVA
LKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLDHPYIVYEYCP
KGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCL
VDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPP
VNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPP
FRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTG
NILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQ
LIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDS
IIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFI
IPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGL
PLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVD
PLPVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001170ANPR/GUC
IPR001054A/G_cyclase
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001828ANF_lig-bd_rcpt
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR028082Peripla_BP_I
IPR029787Nucleotide_cyclase
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0016020membrane