FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30021819
Length (bp)1842
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30021819) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30021819) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021819

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021819SMESG000060702.1 SmedASXL_009364SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021819SMESG000060702.1 dd_Smed_v6_23771_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 71.2478 bits (173), Expect = 2.692e-12
Identity = 83/344 (24.13%), Postives = 131/344 (38.08%), Query Frame = 3
Query:  675 HPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G ++ PG    I+ +     +L      C  +     + +L     YT   CI+   Q  ++K C C YI YPRP    + V YC        G  + K+ +D  +  + C +             KCR  CS  +Y+ +   ++W    +++W    LS Q+N            +  N +N          ++ VNI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E V+ L++  F
Sbjct:  299 HPMYGNCYTFNDKN----NSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPS-KYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFT-------------KCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNY-----------TVNNKRNG---------VAKVNIF--FKELNY-----------------KTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMF 581          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 70.8626 bits (172), Expect = 4.594e-12
Identity = 83/344 (24.13%), Postives = 131/344 (38.08%), Query Frame = 3
Query:  675 HPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G ++ PG    I+ +     +L      C  +     + +L     YT   CI+   Q  ++K C C YI YPRP    + V YC        G  + K+ +D  +  + C +             KCR  CS  +Y+ +   ++W    +++W    LS Q+N            +  N +N          ++ VNI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E V+ L++  F
Sbjct:  322 HPMYGNCYTFNDKN----NSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPS-KYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFT-------------KCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNY-----------TVNNKRNG---------VAKVNIF--FKELNY-----------------KTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMF 604          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 69.707 bits (169), Expect = 8.620e-12
Identity = 84/344 (24.42%), Postives = 131/344 (38.08%), Query Frame = 3
Query:  675 HPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G ++ PG    I+ +     +L      C   N S   ++      YT   CI+   Q  ++K C C YI YPRP    + V YC        G  + K+ +D  +  + C +             KCR  CS  +Y+ +   ++W    +++W    LS Q+N            +  N +N          ++ VNI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E V+ L++  F
Sbjct:  358 HPMYGNCYTFNDKN----NSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCT-KNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFT-------------KCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNY-----------TVNNKRNG---------VAKVNIF--FKELNY-----------------KTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMF 640          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 69.3218 bits (168), Expect = 1.177e-11
Identity = 85/351 (24.22%), Postives = 139/351 (39.60%), Query Frame = 3
Query:  675 HPQHFNCYTF-----EPRNISVSVSTRF-FSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLT--EEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKS---LNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEF----IEFVYLLILK 1667
            +P + NCY F     E    S +  T F   LI+ +G  + DY        +       G+R ++HE  + P I  EG++   G    I        ++  P  PC  +     + +  S YN  Y+   C+    Q  ++++C C + LYP P    +   YC          +F    +C S+ L+MS+   E     C+  C+   Y+ T+S+  W    ++ W  H LS                             + RD S  NI  SRK    LN+   +F Y  ++          E    ++  LLS +GG     +G +V  ++EF    I+FV++ I+K
Sbjct:  266 YPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIG--QEDY--------VPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLP----RGEKYCNN-------RDFPDWAHCYSD-LQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS-----------------------------QERDQS-TNITLSRKGIVKLNIYFQEFNYRTIE----------ESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIK 554          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 68.9366 bits (167), Expect = 1.643e-11
Identity = 85/351 (24.22%), Postives = 139/351 (39.60%), Query Frame = 3
Query:  675 HPQHFNCYTF-----EPRNISVSVSTRF-FSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLT--EEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKS---LNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEF----IEFVYLLILK 1667
            +P + NCY F     E    S +  T F   LI+ +G  + DY        +       G+R ++HE  + P I  EG++   G    I        ++  P  PC  +     + +  S YN  Y+   C+    Q  ++++C C + LYP P    +   YC          +F    +C S+ L+MS+   E     C+  C+   Y+ T+S+  W    ++ W  H LS                             + RD S  NI  SRK    LN+   +F Y  ++          E    ++  LLS +GG     +G +V  ++EF    I+FV++ I+K
Sbjct:  311 YPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIG--QEDY--------VPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLP----RGEKYCNN-------RDFPDWAHCYSD-LQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS-----------------------------QERDQS-TNITLSRKGIVKLNIYFQEFNYRTIE----------ESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIK 599          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 77.7962 bits (190), Expect = 2.626e-14
Identity = 99/391 (25.32%), Postives = 153/391 (39.13%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYL 1655
            ++Y N+L      + IA+G+K   +++ C            D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E      I  Q   + KL  P   C  D     + +L SK  YT   C+N   Q  +V+ C C +   P P        YC       + +E+ + I C     K  + EE+  +  CR  CS+  +  T S+ KW    ++QW L  LS +   +  LN N                L + DL+N+NI               Y  L  +S      SE    ++  LLS  GG   L +  ++  V+E +E  ++
Sbjct:  243 LHYTNVLAKISMEDKIAMGYKADELIVTCFF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSK-KYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYC-------NYEEYPSWIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEQWMLRVLSWELGEK--LNKN----------------LTKNDLANLNIF--------------YQDLNSRSI-----SESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFI 566          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 68.9366 bits (167), Expect = 1.620e-11
Identity = 92/388 (23.71%), Postives = 146/388 (37.63%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYL 1655
            ++Y N+L      + IA+G+K   +++ C            D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E      I  Q   + KL  P   C  D     + +L SK  YT   C+N   Q  +V+ C C +   P P        YC       + +E+ + I C     K  + EE+  +  CR  CS+  +  T S+ KW                  +LN+ + +            +    DL+N+NI               Y  L  +S      SE    ++  LLS  GG   L +  ++  V+E +E  ++
Sbjct:  235 LHYTNVLAKISMEDKIAMGYKADELIVTCFF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSK-KYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYC-------NYEEYPSWIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKW-----------------PSLNSEVRSAWVLQLFYVGHGFFNLNDLANLNIF--------------YQDLNSRSI-----SESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFI 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 65.4698 bits (158), Expect = 1.827e-10
Identity = 71/270 (26.30%), Postives = 108/270 (40.00%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKW 1301
            ++Y N+L      + IA+G+K   +++ C            D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E      I  Q   + KL  P   C  D     + +L SK  YT   C+N   Q  +V+ C C +   P P        YC       + +E+ + I C     K  + EE+  +  CR  CS+  +  T S+ KW
Sbjct:  233 LHYTNVLAKISMEDKIAMGYKADELIVTCFF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSK-KYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYC-------NYEEYPSWIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKW 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 64.6994 bits (156), Expect = 2.615e-10
Identity = 71/270 (26.30%), Postives = 108/270 (40.00%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKW 1301
            ++Y N+L      + IA+G+K   +++ C            D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E      I  Q   + KL  P   C  D     + +L SK  YT   C+N   Q  +V+ C C +   P P        YC       + +E+ + I C     K  + EE+  +  CR  CS+  +  T S+ KW
Sbjct:  233 LHYTNVLAKISMEDKIAMGYKADELIVTCFF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSK-KYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYC-------NYEEYPSWIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKW 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 63.929 bits (154), Expect = 4.595e-10
Identity = 66/282 (23.40%), Postives = 110/282 (39.01%), Query Frame = 3
Query:  810 IDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIE--KKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFV 1649
            + +  QA G R ++H P   P +E +G  + PG  N I+ +    ++L      C  D  S   I +    +YT   C+N   QY +++ C C Y  YP P  P  E  YC       + ++      C     +  L   +    +C  +C    Y  +    KW          S  S A+K L+           +  + S  +R D+S +N+           ++ +Y  +++  S+          S+ +LLS +GG  S   G +V  V E  E V
Sbjct:  299 MPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDG-SDLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLP--PGME--YC-------NYNKHPDWGYCFYQLYEKMLDHTLICFTQCPKQCKQTEYHLSAGTAKWP---------SPVSKAKKLLSL----------QERYNSTSKRSDISKINVYY---------EELSYRSVEETPSV----------SVTMLLSSMGGLWSWWFGSSVLSVAEIAELV 530          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1b (sodium channel, nonvoltage-gated 1 beta [Source:MGI Symbol;Acc:MGI:104696])

HSP 1 Score: 64.6994 bits (156), Expect = 2.130e-10
Identity = 89/342 (26.02%), Postives = 135/342 (39.47%), Query Frame = 3
Query:  675 HPQHFNCYTF-----EPRNISVSVSTRF-FSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKL---DTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLT--EEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKS---LNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIE 1643
            +P + NCY F     E    S +  T F   LI+ +G  + DY        +       G R ++HE  T P I  EG++   G    I    VL  KL     P  PC  +     + +L S YN  Y+   C++   Q  ++++C C + LYP P    +   YC          +F     C  N L+MS+T  E     C+  C+   Y+ T+S+  W    ++ W LH LS                             + RD S+ NI  SRK    LN+   +F Y  ++          E    ++  LLS +GG     +G +V  ++EF E
Sbjct:  264 YPDYGNCYIFNWGMTEETLPSANPGTEFGLKLILDIG--QEDY--------VPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIG---VLVDKLQRKGEPYSPCTMNGSDVAIKNLYSVYNTTYSIQACLHSCFQDHMIRNCSCGHYLYPLP----EGEKYCNN-------RDFPDWAYCYLN-LQMSVTQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLS-----------------------------QERDQSS-NITLSRKGIVKLNIYFQEFNYRTIE----------ESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGE 540          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 64.3142 bits (155), Expect = 2.603e-10
Identity = 82/347 (23.63%), Postives = 128/347 (36.89%), Query Frame = 3
Query:  666 RLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            +  HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G +V PG    I+ +      L      C  +     + +L     YT   CI+   Q  ++K C C YI YP+P    K V +C        G  + K+        + C S             KCR  CS   Y+ +   ++W   +++ W    LSLQ+N            +  N +N          ++ +NI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E ++ L++ T 
Sbjct:  217 QFHHPMYGNCYTFNNKN----NSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPS-KYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFS-------------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNY-----------TINNKRNG---------VAKLNIF--FKELN-----------------YKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITL 502          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 64.3142 bits (155), Expect = 2.688e-10
Identity = 82/347 (23.63%), Postives = 128/347 (36.89%), Query Frame = 3
Query:  666 RLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            +  HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G +V PG    I+ +      L      C  +     + +L     YT   CI+   Q  ++K C C YI YP+P    K V +C        G  + K+        + C S             KCR  CS   Y+ +   ++W   +++ W    LSLQ+N            +  N +N          ++ +NI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E ++ L++ T 
Sbjct:  217 QFHHPMYGNCYTFNNKN----NSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPS-KYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFS-------------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNY-----------TINNKRNG---------VAKLNIF--FKELN-----------------YKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITL 502          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 63.5438 bits (153), Expect = 4.777e-10
Identity = 82/347 (23.63%), Postives = 128/347 (36.89%), Query Frame = 3
Query:  666 RLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            +  HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G +V PG    I+ +      L      C  +     + +L     YT   CI+   Q  ++K C C YI YP+P    K V +C        G  + K+        + C S             KCR  CS   Y+ +   ++W   +++ W    LSLQ+N            +  N +N          ++ +NI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E ++ L++ T 
Sbjct:  324 QFHHPMYGNCYTFNNKN----NSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPS-KYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFS-------------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNY-----------TINNKRNG---------VAKLNIF--FKELN-----------------YKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITL 609          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 63.5438 bits (153), Expect = 5.509e-10
Identity = 82/347 (23.63%), Postives = 128/347 (36.89%), Query Frame = 3
Query:  666 RLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            +  HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G +V PG    I+ +      L      C  +     + +L     YT   CI+   Q  ++K C C YI YP+P    K V +C        G  + K+        + C S             KCR  CS   Y+ +   ++W   +++ W    LSLQ+N            +  N +N          ++ +NI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E ++ L++ T 
Sbjct:  298 QFHHPMYGNCYTFNNKN----NSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPS-KYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFS-------------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNY-----------TINNKRNG---------VAKLNIF--FKELN-----------------YKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITL 583          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.433e-20
Identity = 123/543 (22.65%), Postives = 214/543 (39.41%), Query Frame = 3
Query:  192 MTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVT-LHQRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFA-NNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRN---ISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCG--KLWPKIDLDEF---------------TTRINCVSNY---LKMSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNAN----ISAESYQNAKNSWKSYLERRDLSNVNIAD-----SRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPV-----LLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPTKSTP 1703
            +TS  +  + +W++ V+           LL+  Y ++ V  L +        +P+++IC+  P S          + +    FN    QN + +L    KF      + +SI  +Y+NL   ++  L H    +L   R N       N    FD           +FNC+TF       +  +      SLI S+ + +P    +      +    + G+R VVH PG++P     G+ + PG  + +  + +L+ +L  P   C  D     +++   +Y YTF+ C+ L KQ LI++ C C     P    P+    +CG  K W +I+ +                 T  + C       L    T E+   C   CS  +Y  +VS++ W  + +QL  +      ++    N     + E  +   +  + +L R D    +I       S K +  +  D     + + +  L++ S  E   LP      L + IGG   L +G++V  ++E IE V  L    F   N  K  P
Sbjct:   59 VTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISL---------RTIRRMYFN-NESQNLITWLRFIQKFRFEQDSFMNSIRAFYENL-GQDAKKLSHNLEDMLMHCRFNRELCHVSNFSTFFDG---------NYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTND-----MLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGLVF---NSEKGLP 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.011e-13
Identity = 104/407 (25.55%), Postives = 163/407 (40.05%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGG------FCSLLIGLTVAVVVEFIEFVYLLILKTFYQ 1679
            ++Y N+L      + IA+G+K   +++ CL           D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E G    I  Q   + KL  P   C  D      I +++ YN  YT   C+N   Q  +V+ C C +   P P        YC       + +E+   I C     K  + EE+  +  CR  CS+  +  T S+ KW    +++W L  LS +   +  LN N                L + DL N+NI               Y  L  +S      SE    ++  LLS  GG       CS++ GL + V V FI+  ++++ + +++
Sbjct:  235 LHYNNILAKISMEDKIAMGYKADELIVTCLF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSD---ISVENLYNKKYTLQICLNSCFQREMVRSCGCAHYDQPLP----NGAKYC-------NYEEYPNWIYCYVKLYKQFVQEELGCQSTCRESCSFKEWTLTRSLAKWPSLNSEEWMLRVLSWELGEK--LNKN----------------LTKNDLGNLNI--------------FYQDLNSRSI-----SESPTYNIVTLLSNFGGQLGLWMSCSMVCGLEI-VEVFFIDSFWVILRQKWHK 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51171|SCNNG_XENLA (Amiloride-sensitive sodium channel subunit gamma OS=Xenopus laevis OX=8355 GN=scnn1g-a PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 5.250e-13
Identity = 99/404 (24.50%), Postives = 161/404 (39.85%), Query Frame = 3
Query:  525 IYYQNLL----YNESIALGHKY-TIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF---EPRNISVS-VSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYL----LILKTFYQN 1682
            ++Y N+L      + IA+G+K   +++ C            D    D+       HP + NCYTF   E  N+ VS +    + L V L   E +Y  +           A G + +VH+    P IE  G  +E      I  Q   + KL  P   C  D     + +L +K  YT   C+N   Q  +V+ C C +   P P        YC       + +E+ + I C     K  + EE+  +  CR  CS+  +  T S+ KW    +++W L  LS +   +  LN N++                + DL+N+NI               Y  L  +S      SE    ++  LLS  GG   L +  ++  V+E IE  ++    ++L+  ++N
Sbjct:  235 LHYTNILAKISMEDKIAMGYKADELIVTCFF----------DGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY--------LSTAAGAKILVHDQDEYPFIEYLGTELETATETSIGMQLTESAKLSDPYSDCTMDGRDVSVENLYNK-KYTLQICLNSCFQREMVRSCGCAHYDQPLP----NGAKYC-------NYEEYPSWIYCYFKVYKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEEWMLRVLSWELGEK--LNKNLT----------------KNDLANLNIF--------------YQDLNSRSI-----SESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIIEVFFIDSFWVVLRQRWRN 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2QAR5|SCNNG_PANTR (Amiloride-sensitive sodium channel subunit gamma OS=Pan troglodytes OX=9598 GN=SCNN1G PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.004e-13
Identity = 116/542 (21.40%), Postives = 204/542 (37.64%), Query Frame = 3
Query:  144 ILELFCRCMTIRGVNKMT-SASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTL--HQRDLQKNSTFPAITICHHHPFSKDAYK--LWDSKKVLSPSLFNLY------MRQNALHYLNQDDKFANNFYYFDSIDIYYQN-------LLYNESIALG----HKYTIVLYCLRRN--DYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRN----ISVSVSTRFFSLIVSLGRPEPDYANHEQ--AFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI--EKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLN--LDGDDFAYVVLKKKSSILKERS--EKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYL 1655
            ++  +C      G  ++  S     R LW  F L    +++    LL+  ++   V++  H R L     FPA+TIC+ +P+     +  L D ++    +L +LY       R+ A  + +  +     F +   + I+ Q+               +G    HK + V++   +    +Q++F                HP H NCYTF  R     +S S+    + L V L      Y N E+   FL+     + G + ++H     P +E  G  +E   +  I      + KL  P   C  D      + + + YN  Y+   C++   Q  +V+ C C    Y +PL P     YC       +  +    + C     +  + EE+  +  C+  CS+  +  T S+ +                                    W S +  + L  V   D  + +N  L+  D A +++  K   L +RS  E    S+ +LLS  GG   L +  +V  V+E IE  ++
Sbjct:   28 LMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFRKLD----FPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWSSISEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLNF------------TLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVIL------YINEEEYNPFLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSD---VPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQ--YSQPLPPAAN--YC-------NYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQ------------------------------------WPSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKD--LNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFI 491          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2Q5A1|SCNNA_PANTR (Amiloride-sensitive sodium channel subunit alpha OS=Pan troglodytes OX=9598 GN=SCNN1A PE=3 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 6.854e-12
Identity = 83/344 (24.13%), Postives = 132/344 (38.37%), Query Frame = 3
Query:  675 HPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYC--------GKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTF 1673
            HP + NCYTF  +N     S  + S +  +          EQ   I +     G R +VH       ++  G ++ PG    I+ +     +L      C  +     + +L     YT   CI+   Q  ++K C C YI YPRP    + V YC        G  + K+ +D  +  + C +             KCR  CS  +Y+ +   ++W    +++W    LS Q+N            +  N +N          ++ VNI    K LN                  K  SE   +++  LLS +G   SL  G +V  VVE  E ++ L++ TF
Sbjct:  322 HPMYGNCYTFNDKN----NSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPS-KYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFT-------------KCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNY-----------TVNNKRNG---------VAKVNIF--FKELNY-----------------KTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITF 604          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3WAS3 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7676 PE=3 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 9.430e-165
Identity = 252/551 (45.74%), Postives = 347/551 (62.98%), Query Frame = 3
Query:  141 TILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKN-STFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQ-NALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNS-----WKSYLERRDLSNVNI----------ADSRKSLNLDGDD--------FAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPTKSTPVKNK 1715
            T   LFCRC T+RG+ K+    + LR +W++FV+ M  +L+ +  LLILD+  YDV +H R L  + S FPA+T+CHH+PFS  A KLW  KKVLSP  FN YMR     + LN D   A    ++DS+ +YYQNL   E  ALGH + I L C+R +     FE+DC+    Y++++ SH Q+ NC+TFEP +   ++ T F SLIVS+G P+      EQAFL D+FEQAKGLR VVHEPGT PD+E+ GLH EPGKLNEI ++PV   K++TP RPC   +E+ K  DLD  YNYT  +C+ L +Q  I++ C C Y++ PRP +PT E PYCG++WP +D+++F  R+ C+ + L +++  + + + C PRC YYTY++ +SITKWRA+ WQL+WL +Q+ A +     + + S ++   S     WK YL  R+LSN+             D  K +NLD DD        FAY+VLK+KS    + +EK VL+L VL+SRIGG CS+ IG+T A VVE IEFVY       Y N P K+T  + K
Sbjct:   20 TTFVLFCRCSTVRGLGKLWQGPTILRIIWAIFVVSMMCVLLTSVVLLILDFLAYDVGVHTRLLLDDPSPFPALTVCHHYPFSMRARKLWQEKKVLSPGQFNRYMRNLTWTNLLNNDVNAAEAITFYDSLSVYYQNLSPEEVKALGHDHRIFLNCMRVSSQTSIFEDDCRLLKGYLVRQFSHHQYLNCHTFEPADQKEALETSFLSLIVSMG-PKESSDPDEQAFLPDIFEQAKGLRVVVHEPGTYPDLEKFGLHAEPGKLNEIGYEPVRWTKMNTPTRPCF--HEAGKYYDLDGVYNYTHEQCLLLYQQKEIIEDCGCYYVMNPRPSFPTNEKPYCGRMWPNLDIEKFVNRLECLRDKLHIAVKRKYDGRVCLPRCEYYTYDSAISITKWRARMWQLYWLRVQTQAVRLAQEFMQSNSGKDITESLGYRMWKRYLSERNLSNIPAEATWNDSTRPPDVIKQINLDIDDGLSANDDGFAYIVLKRKSQNTIDNTEKLVLTLNVLVSRIGGLCSVTIGITAACVVEIIEFVY-------YANCPRKATASRKK 560          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3TLF4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8069 PE=3 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 4.399e-164
Identity = 257/558 (46.06%), Postives = 347/558 (62.19%), Query Frame = 3
Query:  153 LFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDL-QKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQ-NALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNA---QKAL---NANISAESYQNAKNSWKSYLERRDLSNV-------NIA---DSRKSLNLD--------GDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPTKSTPVKNKFVTVENYDNK 1745
            LFCRC T+RG+ K+     FLR  W++FV+ M  +L+ A  LLI+D+  YDV +H + L  + S FP++TICHH+PFS  A KLW  KKVLSP  FN YMR       LN D   A    ++DS+ +YYQNL   E++ALGH Y I L C+R        E+DC+    Y +K+ SH Q+ NC+TFEP N + ++ST F SLIVS+G P+      EQAFL DVFEQAKGLR VVHEPGT PD+E+ GLH EPGKLNEI ++PV   K++TP RPC   + + +  DLD  YNYT  +CI L +Q  I+  C C Y++ PRP +PT+E PYCGK+WP++D ++F  R+NC+   L +S+ ++ +   C+PRC YYTYE+++SITKWRA  WQL+WL +Q+      KA    N N+S       K  W+ YL  ++L  +       N+A   D  + +NLD         D FAY+VLK+KS   K+ +EK VL+L VL+SRIGG CS+ IG+T A VVE IEF+Y       Y N P      K+  +T  +  +K
Sbjct:   24 LFCRCTTVRGLGKLWQGPKFLRITWAIFVVSMMSVLIIAVVLLIVDFLNYDVGVHTKLLLDEPSPFPSLTICHHYPFSLQARKLWQEKKVLSPGQFNRYMRNLTWTSLLNNDVNAAEAITFYDSLSVYYQNLKPEEAVALGHDYKIFLNCMRVASQTNIIEDDCRVLSGYKVKQFSHHQYLNCHTFEPENHAEALSTSFLSLIVSMG-PKESSGPDEQAFLTDVFEQAKGLRVVVHEPGTYPDLEKFGLHAEPGKLNEIGYEPVKWTKMNTPTRPCF--HTAPQYNDLDGVYNYTHEQCILLHQQKEIIDECGCHYVMNPRPYFPTEEKPYCGKMWPRMDTEKFVNRLNCIVGKLNISVKQKYDGTVCQPRCEYYTYESSISITKWRAHPWQLYWLRVQTQGVRLAKAFAENNTNVSITESLGYK-MWQRYLGEKNLGKIPVEATWNNLARPPDILRHINLDIDGSVSTNSDGFAYIVLKRKSQNTKDNTEKLVLTLNVLVSRIGGLCSVTIGITAACVVEIIEFIY-------YSNKPKSKDQEKSSRMTGNSDQDK 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A430Q3F3 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006550 PE=3 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 2.068e-162
Identity = 255/553 (46.11%), Postives = 358/553 (64.74%), Query Frame = 3
Query:  147 LELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKN-STFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDD-KFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKAL--------NANISAESYQNAKNSWKSYLERRDLSNVNIADSRKS-----------------------------LNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNN 1685
             +LFC C ++RG++K+      LR +W  FVL MT +L+ +T LLI D+  YDV++H + +  N S FP++T+CH  PFS +AYKLW+  K+LSPS +NLYMR+  L+ L ++D + A+  + +DS+ +YYQNL Y ES+ LGH  TI L C+R   +   FE++C   + Y IKRLSH Q+ NCYTFEP NI+ +  T F SLIV +G  + D  N +QAFL DVFEQA+GLR V+HE GT+PD+E+ G+HVEPGKLNEIN++P+   KL+TPKRPCI  NES +  DL+ KYNYT  +C+ + +Q  I+ HC C+Y+++PR + P+K +PYCG+LWP ++  EF  +I C++ YL  S+ ++ +   C PRC +Y YE+T S+TKWRA  WQL+WL +Q+ A ++L        + NI   +Y N+   W+ YL   +L+N+     RKS                             L+LD +DFAYV+LK+KS    E++EK +L+L VL+SRIGG CSL IGLT A  VE  EF YLL     Y+NN
Sbjct:   56 FDLFCSCTSVRGMSKIRRGPKVLRIMWLTFVLSMTFLLLSSTALLIKDFLNYDVSVHTQLIMDNPSPFPSLTVCHQPPFSYEAYKLWNESKILSPSKYNLYMRKLILNALYKNDIQSASTIWSYDSLSVYYQNLNYKESLNLGHNLTIFLNCMRIYSHMSVFEDNCTLLNGYHIKRLSHHQYLNCYTFEPININAANETTFLSLIVGMGPRDKD-INIQQAFLPDVFEQARGLRVVIHETGTMPDLEKNGIHVEPGKLNEINYEPIRWKKLNTPKRPCIKPNESHQYFDLNIKYNYTHTQCLLVHQQIEIMNHCHCIYVMHPRLILPSKTLPYCGQLWPYLNQTEFIKKILCLNKYLNNSIKQKYDGHMCFPRCEFYDYESTTSVTKWRAYPWQLYWLRVQNYATQSLIHYHNQYPSNNI---TYTNSFKLWEFYLNYNNLTNL----PRKSELLKYNNNNNHNNTYSDIFTLLPNWPPEYLDLDSEDFAYVILKRKSHSTIEKTEKLILNLYVLISRIGGLCSLTIGLTAAFFVELFEFCYLL-----YKNN 595          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183JHQ3 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2228 PE=3 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 3.245e-162
Identity = 255/554 (46.03%), Postives = 358/554 (64.62%), Query Frame = 3
Query:  147 LELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKN-STFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDD-KFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKAL--------NANISAESYQNAKNSWKSYLERRDLSNVNIADSRKS------------------------------LNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNN 1685
             +LFC C ++RG++K+      LR +W  FVL MT +L+ +T LLI D+  YDV++H + +  N S FP++T+CH  PFS +AYKLW+  K+LSPS +NLYMR+  L+ L ++D + A+  + +DS+ +YYQNL Y ES+ LGH  TI L C+R   +   FE++C   + Y IKRLSH Q+ NCYTFEP NI+ +  T F SLIV +G  + D  N +QAFL DVFEQA+GLR V+HE GT+PD+E+ G+HVEPGKLNEIN++P+   KL+TPKRPCI  NES +  DL+ KYNYT  +C+ + +Q  I+ HC C+Y+++PR + P+K +PYCG+LWP ++  EF  +I C++ YL  S+ ++ +   C PRC +Y YE+T S+TKWRA  WQL+WL +Q+ A ++L        + NI   +Y N+   W+ YL   +L+N+     RKS                              L+LD +DFAYV+LK+KS    E++EK +L+L VL+SRIGG CSL IGLT A  VE  EF YLL     Y+NN
Sbjct:   60 FDLFCSCTSVRGMSKIRRGPKVLRIMWLTFVLSMTFLLLSSTALLIKDFLNYDVSVHTQLIMDNPSPFPSLTVCHQPPFSYEAYKLWNESKILSPSKYNLYMRKLILNALYKNDIQSASTIWSYDSLSVYYQNLNYKESLNLGHNLTIFLNCMRIYSHMSVFEDNCTLLNGYHIKRLSHHQYLNCYTFEPININAANETTFLSLIVGMGPRDKD-INIQQAFLPDVFEQARGLRVVIHETGTMPDLEKNGIHVEPGKLNEINYEPIRWKKLNTPKRPCIKPNESHQYFDLNIKYNYTHTQCLLVHQQIEIMNHCHCIYVMHPRLILPSKTLPYCGQLWPYLNQTEFIKKILCLNKYLNNSIKQKYDGHMCFPRCEFYDYESTTSVTKWRAYPWQLYWLRVQNYATQSLIHYHNQYPSNNI---TYTNSFKLWEFYLNYNNLTNL----PRKSELLKYNNNNNHNNNTYSDIFTLLPNWPPEYLDLDSEDFAYVILKRKSHSTIEKTEKLILNLYVLISRIGGLCSLTIGLTAAFFVELFEFCYLL-----YKNN 600          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3U2C4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS598 PE=3 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 2.037e-161
Identity = 244/526 (46.39%), Postives = 343/526 (65.21%), Query Frame = 3
Query:  153 LFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKN-STFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQ-NALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNS-----WKSYLERRDLSNV----NIADSR------KSLNLDGDD--------FAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVY 1652
            LFCRC T+RG  K+      LR++W+ FV+ M  +L+ +  LLILD+F YDV +H R L  + S FPA+T+CHH+PFS  A KLW  K+VLSP  FN YMR     + LN D + A    ++DS+ +YYQNL  +E+  LGH + + L C+R +     FE+DC+    Y +++ SH Q+ NC+TFEP N   S+ T F SLIVS+G P+      EQAFL D+FEQAKGLR VVHEPGT PD+ER GLH EPGKLNEI ++PV   K++TP +PC   +++    DLD  YNYT  +C+ L +Q  I++ C C Y++ PRP +P+ E PYCG++WPK+D++EF  R+ C+ + L +S+  + +   C PRC YYTY++ +SITKWRA+ WQL+WL +Q+ A + +  +IS    ++ K+S     WK YL + +L ++    +++D+       K +NLD DD        FAY+VLK+KS    + +EK VL+L VL+SRIGG CS+ IG+T A VVE IEFVY
Sbjct:   24 LFCRCTTVRGFGKLWQGPMLLRFIWATFVVSMMCVLITSVVLLILDFFAYDVGVHTRLLLDDPSPFPALTVCHHYPFSLAARKLWQEKQVLSPGQFNRYMRNITWTNLLNNDLQAAEATSFYDSLSVYYQNLRPDEAKLLGHDHRVFLNCMRISSQTTFFEDDCRLLKGYKVRQFSHHQYLNCHTFEPTNWQESMDTSFLSLIVSMG-PKESSDPDEQAFLPDIFEQAKGLRVVVHEPGTYPDLERFGLHAEPGKLNEIGYEPVRWTKMNTPTKPCF--HQAGLYNDLDEVYNYTHEQCLLLHQQKEIIESCGCYYVMNPRPSFPSDEKPYCGRMWPKLDIEEFVKRLECLKHKLDISVKRKYDGSTCLPRCEYYTYDSAISITKWRAQLWQLYWLRVQNQAIRLVQDHISKNPGKDIKDSLGYRMWKRYLGKENLRDIPKEASLSDAERPPDVIKRVNLDIDDDLSTNDDGFAYIVLKRKSQNTIDNTEKLVLTLNVLVSRIGGLCSVTIGITAACVVEIIEFVY 546          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 64.6994 bits (156), Expect = 3.032e-11
Identity = 57/240 (23.75%), Postives = 90/240 (37.50%), Query Frame = 3
Query:  663 KRLSHPQHFNCYTFEPRNIS----VSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDL-DSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPT----KEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKW---RAKQWQLHWLSLQSN 1346
             R  HP + NCYTF   N S     S   R + L + L   + DY        I       G R +VH+  + P +E  G  + PG    +  + +   ++  P   C  D  +  +++L  S Y     EC     Q  +V+ C C Y  YP P   +        + G  + K+     +  + CV              KC   C+   +  T     W    +++W  + LSLQ+N
Sbjct:  231 SRFHHPTYGNCYTFNSANSSKLWQASKPGRDYGLSLILRTEQNDY--------IPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVPVLNLYSSAYTVQVPECSCF--QLALVEACGCGYYFYPLPPNASYCSYNNTAWAGHCYYKLYRQFISDELGCV-------------DKCAQPCTTKRFAVTPGYAAWPDSSSEKWIFNLLSLQNN 447          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: ASIC5 (acid sensing ion channel subunit family member 5 [Source:HGNC Symbol;Acc:HGNC:17537])

HSP 1 Score: 62.3882 bits (150), Expect = 1.466e-10
Identity = 110/529 (20.79%), Postives = 205/529 (38.75%), Query Frame = 3
Query:  138 ETILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVG-ATCLLILDYFKY----DVTLHQ-RDLQKNSTFPAITICHHHPFSKDA-------YKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTF------EPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEI------EKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFV 1649
            ETI   F    ++ GV + TSA S  +  + + V++  + + G    L +  Y+ +     +TLH  RDL    +FPA+T C+++     A       ++ W     L P    L++  N    + Q     N      +  ++ + L Y    A+ +K T+V +  RR+    DF++   ++              NCYTF      E R++    +     L V     + DY  + +     V     G+R VVH+P   P +E  GL +  G    ++ Q   ++    P   C P  +      L S   Y+   C+   +  L+ + C C    +P       ++  C                +C  + L   L + +        +C   C +  + ++VS   + + Q                    +A+ Y+ + N    Y+ R +L ++++A +         D  Y +++++ ++ +           VLLS IGG   L +G +V  ++E +EFV
Sbjct:    7 ETIA--FSSSTSLHGVARATSAQSRAQRAFWMMVVVAGVAMAGWQVALRLAAYYAWPTSTSLTLHYVRDL----SFPAVTFCNYNRIGSVARNTCIISFEGWTILHDLIP--LGLFVANNFTPPITQTYSARNQ--DLSTTILFVRRLNY----AIRNK-TLVSWFFRRHTTPQDFQHVFTEYG-------------NCYTFNGGFSEEQRSLKQKTAGAGKGLQVLFDVQQWDYWENPELGFTGV-----GIRLVVHDPDEPPQVEALGLSIGVGTQAYVSVQHTKSINQQYPWGDCDPSKK------LQSPAPYSMARCLQECEADLVERICGCKPFNFP------GDIKEC----------SLYQHYHCARDALVHILAQGMCTGGSHLSQCPVPCLHKNFPSSVSYATFPSLQ--------------------AAQRYERSLNYSLVYM-RENLLSIDVAYT---------DLNYALIQQQKTLPES----------VLLSDIGGQLGLFVGASVITIIEVLEFV 440          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 53.9138 bits (128), Expect = 7.397e-8
Identity = 63/249 (25.30%), Postives = 96/249 (38.55%), Query Frame = 3
Query:  651 SYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANH-----EQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYN--YTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIE--KKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNAN 1370
            S   K+L HP   NC+TF   +   S+       I S G    DY  H      Q   +       G +  +H   T P IE  G+ + P   + +  +     KL  P   C  D      ID+ S Y+  Y+   C N   Q+ ++K C C     P P    +   +C       + D       C      M + EE++  + CR  CS   +E T+S+  W +K  +  WL    + ++ L AN
Sbjct:  263 STSFKKLQHPILGNCFTFNDGSDGKSLD------IASAGI---DYGLHMVLNTRQDNSLPYLAMGAGAKIGIHLQNTTPFIEAVGIDIPPAMESSLGLRVNDVQKLGDPYSDCTMDGSD---IDVKSLYDSPYSVQTCQNSCFQWEMIKSCGCANYEQPLP----EGSRFC-------NYDNNPGWEYCYYRLYDMYIKEELKCIQVCRQICSETEHEVTLSLADWPSKASK-GWLLRALSKEQGLPAN 487          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 67.3958 bits (163), Expect = 9.061e-12
Identity = 64/298 (21.48%), Postives = 122/298 (40.94%), Query Frame = 3
Query:  789 NHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPK-RPCIPDNESSKLIDLDSKYNYTF------YECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLI 1661
            N EQ   ++   +  G++  + + G +P   ++G+ + PG+   I    +   ++D  K R C   NE S   +L   YN T+      Y C+N  K    ++ C C    Y  P    + +P C +L         +T I+C++           +++C P CS  +++ TVS  +W A+ +++                            +  +L  R L+ +  + S+  +N +     +V   +   +L +  E    +   LLS IGG   + IG++     E IE V +++
Sbjct:  235 NLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDK-NLFFGYNMTYSIMACKYSCLNARK----IERCGCTN--YNTPEMQKRNIPLCNRL--------NSTIIDCLNKAYDTFEDGSCDRECPPSCSEVSFDLTVSSARWPARSFEV--------------------------TKYAYFLRVRVLNKIASSSSKYFVNSENIAQVHVYYGELDYLLVQ--ETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVIL 489          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO34318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS2])

HSP 1 Score: 49.6766 bits (117), Expect = 2.168e-6
Identity = 64/262 (24.43%), Postives = 102/262 (38.93%), Query Frame = 3
Query:  564 LGHKY-TIVLYCLRRNDYQIDFENDCQQ--FDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYA-----NHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDT-PKRPCIPD-NESSKLIDLDSKYNYTFYE--CINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIE--KKCRPRCSYYTYEATVSITKWRA 1307
            LGH++ ++V  C  R        +DC+          R  H ++ NC+ F P    +  + +    + +L R  P+Y      N EQ   ID      G    V   G +P  E EG+ V PG    I    V   ++D    R C+ +  E  +      KYN T+ +  C+N    Y   K C CM        +P +E   C  +          T + C+    +M   +++    +C   C+  TY+ T S + W A
Sbjct:   25 LGHQFDSLVRKCSWRG-------SDCRANATTGRYWGRFWHNKYGNCFVFNPL---IGWNGKKRRALTAL-RAGPNYGLTLELNVEQDEYIDGLSTKAGAVIQVSPVGYMPFPEEEGIDVSPGFSTSIALTKVKISRVDAFGNRSCVNEITEKDRENLYHVKYNATYSKTACLNFCLAYNQRKTCNCMEY-----RFPVEEEAVCDTM--------NKTTVECLRRVREMLKMKKLNCTAECSAPCNQETYKTTSSFSMWPA 262          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000060702.1 (SMESG000060702.1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 588/592 (99.32%), Postives = 589/592 (99.49%), Query Frame = 3
Query:   21 MHTTTFEYGHKSAHDIECQPXXXXXXXXXXXXXXXXXXDETILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPTKSTPVKNKFVTVENYDNKRNVYSWNNEERPKEILL 1796
            MHT TFEYGHKSAHDIECQPVKRKKKKRRTNNLKKLVKDE+ILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYE INLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKT YQNNPTKSTPVKNKFVTVENYDNKRNVYSWNNEERPKEILL
Sbjct:    1 MHTRTFEYGHKSAHDIECQPVKRKKKKRRTNNLKKLVKDESILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYEYINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTVYQNNPTKSTPVKNKFVTVENYDNKRNVYSWNNEERPKEILL 592          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000000150.1 (SMESG000000150.1)

HSP 1 Score: 432.95 bits (1112), Expect = 3.061e-144
Identity = 223/517 (43.13%), Postives = 328/517 (63.44%), Query Frame = 3
Query:  144 ILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRD-LQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKFANNFY-------YFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTT---RINCVSNYLK-MSLTEEIEKK-CRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLN-LDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVY 1652
            I  LFC   +IRG+NK+     FLR LW  FVL+MT  L  AT  ++L++ +YDV ++ +  L  NS+FPA+TICHHHPFS  A+ LW+   V+SP+ +N Y+R+ +      +D F  N Y       Y D++ +YYQNL  NES  +GH     L C+ +  + I+FE+DC +  +    RLS  ++FNC+TF+P NI+VS      +++VSL  P+PDY  HEQAF+++ F++A+GLR VVHE G+ PDI ++GLHVEPGK+NEI +QP+ + +++TP +PC+  ++     DLD  +      CI L+KQ LI+K+CKC+++ +PRP+ PT ++PYCG    KI  D FT    RI+C+ + +      +E+E+  C PRC   T+E+T+SITKW A  W L+W+   + A   L AN++  +       +K +L+  +  N++  +S K  + L G++FAYVVL++KS     + EK V +  VLLSRIGG CSL IGLT A VVEFIEF+Y
Sbjct:   66 IFYLFCTTTSIRGMNKVPKGPIFLRLLWLSFVLIMTTGLTVATTFMVLEFLQYDVNVYTKIILDSNSSFPALTICHHHPFSIKAHDLWNRSIVMSPAKYNRYLRKMS------NDSFQKNQYGHGSVSSYLDTMSMYYQNLQMNESFMIGHDKETYLTCMNQLGFNINFEDDCSKLFNTSFHRLSLHEYFNCHTFQPENINVSYLFESINIVVSL-EPKPDYREHEQAFIVETFQRAEGLRVVVHETGSFPDIAQDGLHVEPGKMNEIKYQPIQHKRVNTPTKPCVERDDLMTFKDLDQTFMSDKKNCILLKKQELIMKNCKCIFVSFPRPIEPTLDLPYCG----KIQNDNFTVIEDRISCIGDIVSDADYQKELERTICFPRCDILTFESTISITKWGATAWHLYWIRETNKALNLLKANVNNSTRVTETKGYKMWLDYANKENLSDVESTKVNHFLQGENFAYVVLQRKSKNTVIKQEKLVTTPYVLLSRIGGVCSLTIGLTAAFVVEFIEFIY 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000043119.1 (SMESG000043119.1)

HSP 1 Score: 428.328 bits (1100), Expect = 2.152e-142
Identity = 221/542 (40.77%), Postives = 328/542 (60.52%), Query Frame = 3
Query:  153 LFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQR-DLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDD-KFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYL-KMSLTEEIEK-KCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNS-----WKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPTKSTPVKN-KFVTVENYDNKR 1748
            LFC  ++IRG+NK+      LR LW  FVL+M+ IL+ ++CLL+ D+  YDV ++ + ++   + FPA+T+CHHHPFS   Y++W S K +SPS FN  MR   L  L  +D + A    Y+D I IYYQNL Y ++I +GH  +I L C+   + QI F  +C + + Y IK LSH +HFNCYTFEP    VS +     +IVSLG PEP + + EQ+F+ID F QA+GL+ +VHE GT+PDI+  GLHVEPGK+NEI ++P      +TP +PCI D      +DL + YNYT + C+   +Q  I+  C CM+I  PRP+ P + +PYCG +    +L    + + C+S+ L + S  ++ EK KC  RC+Y T+++T+SITKWRA +W L+WL  Q  +   +   + A   +N   S     W  Y  ++DL    +  +     L  D+FAY+VL+++S    ++ E+ V++  VL+SRIGG CSL +G+T+A +VE +EF YL   K   +     S  V+N K ++ +   N +
Sbjct:   63 LFCSTISIRGINKIIKGPRPLRLLWLCFVLIMSAILITSSCLLVRDFMLYDVNINTKLEIDSMTPFPALTVCHHHPFSHRGYRMWKSGKAMSPSYFNRKMRNLTLDQLLLNDVESAETISYYDGISIYYQNLPYEQAIQMGHNSSIFLTCMYLLENQIYFAENCTKLEFYRIKLLSHHEHFNCYTFEPTQPHVSSNLDMLGIIVSLG-PEPKHFDMEQSFIIDTFRQAQGLKVIVHESGTLPDIDEAGLHVEPGKMNEIIYRPNQWQLTNTPAKPCINDTSRIAYVDLANTYNYTKHLCLKYAEQEDIMNQCHCMFIYNPRPMMPNESMPYCGSILKDFNLSNIYSYVKCLSDVLNQKSKRQQWEKEKCFHRCNYMTFDSTISITKWRATEWHLYWLRQQITSLGEMKQFLKANPNRNVTESQAFKTWLIYGNKKDLRKTGLKANE--FLLKDDNFAYIVLRRESKDSVKKYERLVITQYVLVSRIGGLCSLTVGITLAFIVELVEFCYLFSAKETEKRKRKYSNSVENVKLISTQQETNDK 601          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000039581.1 (SMESG000039581.1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.298e-137
Identity = 215/519 (41.43%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  153 LFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLH-QRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKF--ANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLK-MSLTEEIE-KKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNSWKSYLERRDLSNVNIADS-RKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTFYQNNPT 1691
            LFC   +++G+NK+T     LR+LW  FV+ M+ +L+ ++CLL+ D+  YDV ++ +  L   + FP+ITICHHHPFS +AYK W   K+LSPS FN  MR N  H     ++   A     +D I +YYQN+ YN+S+ +GH+  I L C+   +  I +E +C + + Y +K  SH +HFNCYTFE +   ++       +IVS+G P PDY+  EQAF++D F QA+GL+ +VHEPG  PDI+  G+HVEPGKLNEI+++PV     +TP +PC  D +  +  DL+  YNYT   C++ E+Q  I+  C C++I  PR   PTK++PYCG      DL E   RI C++N  + ++  +++E +KC  RC+Y TYE ++SITKWRA +W LHW+ LQ    + L  N    + ++    +K +L+  + +N+ + D  RK   L  D+FAY+VL+++S     + E+ V+S  VL+SRIGG CS  +G+T +  VE +EF+YL     +YQ+N T
Sbjct:   81 LFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSMEAYKYWRENKILSPSTFNRKMR-NLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITT----LGIIVSMG-PPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLQIPTKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATEST--YFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYL-----YYQSNKT 586          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 349.362 bits (895), Expect = 6.231e-112
Identity = 204/540 (37.78%), Postives = 305/540 (56.48%), Query Frame = 3
Query:  144 ILELFCRCMTIRGVNKMT-SASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNST-FPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLN---------QDDKFANNFYYF---DSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLI-DLDSKYNYTFYECINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLK----MSLTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLS--LQSNAQ----KALNANISAESY--------QNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLIL 1664
            ++  F    +IRG +++  S ++FLR LW +FV+     L+ +   +++DY +Y V +       N+T FPA+T C+H PFS+ AY+LW+  KV+SP+ FN   R  AL             +D  F +  +     D + +YYQNL    S  LGH  +I+  C+      + F+N CQ  D  ++K +SHP +FNC+T EP     S+ +R   LI+ LG  E     H Q FL D+FEQA GLR ++HEP + P+IE EG+ +EPG+LNE+N+QP LN+K+DT ++PCI  NE  ++  DLD+ + Y    C N+E Q  I+  CKC+Y  YPR L+P+KE+PYCG L P+    +   R NC++        +    + +KKC   CS   Y  T S+TKWR   WQL+WL   L + AQ     A N NI + +         QN  +  +++  R++LS   I +S K   L  + + +VV+K+K++    + E+ VLS   L+SR+GG CSL IGLT A  +E I+F+Y +I 
Sbjct:   16 VIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQD-DMLIVKNISHPSYFNCFTVEPHPKYASIFSRL-GLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCI--NEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPE-KYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEF-IPESEKL--LFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIF 547          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1A2.692e-1224.13sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A4.594e-1224.13sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A8.620e-1224.42sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1B1.177e-1124.22sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B1.643e-1124.22sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh122.626e-1425.32cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.620e-1123.71cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.827e-1026.30cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh122.615e-1026.30cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
copg24.595e-1023.40coatomer protein complex subunit gamma 2 [Source:X... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1b2.130e-1026.02sodium channel, nonvoltage-gated 1 beta [Source:MG... [more]
Scnn1a2.603e-1023.63sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a2.688e-1023.63sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a4.777e-1023.63sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a5.509e-1023.63sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP1.433e-2022.65FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|O13263|SCNNH_XENLA1.011e-1325.55Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|P51171|SCNNG_XENLA5.250e-1324.50Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|H2QAR5|SCNNG_PANTR7.004e-1321.40Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|H2Q5A1|SCNNA_PANTR6.854e-1224.13Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WAS39.430e-16545.74Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3TLF44.399e-16446.06Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A430Q3F32.068e-16246.11Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A183JHQ33.245e-16246.03Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A0R3U2C42.037e-16146.39Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCNN1A3.032e-1123.75sodium channel epithelial 1 alpha subunit [Source:... [more]
ASIC51.466e-1020.79acid sensing ion channel subunit family member 5 [... [more]
SCNN1G7.397e-825.30sodium channel epithelial 1 gamma subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421379.061e-1221.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343182.168e-624.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060702.10.000e+099.32SMESG000060702.1[more]
SMESG000000150.13.061e-14443.13SMESG000000150.1[more]
SMESG000043119.12.152e-14240.77SMESG000043119.1[more]
SMESG000039581.11.298e-13741.43SMESG000039581.1[more]
SMESG000062815.16.231e-11237.78SMESG000062815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021819 ID=SMED30021819|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1842bp
TTTAATTATTTTTTTCAATAATGCATACAACAACGTTTGAATATGGACAT
AAATCGGCCCATGATATTGAATGTCAACCAGTGAAACGAAAAAAAAAGAA
AAGAAGAACGAATAATCTCAAAAAATTGGTAAAAGACGAAACTATATTAG
AATTATTCTGTAGATGCATGACCATTAGAGGGGTTAATAAAATGACTTCG
GCCAGCTCTTTTTTGAGATATTTGTGGTCAGTATTCGTCCTGTTAATGAC
AATCATTTTGGTTGGTGCTACATGTCTGTTGATTCTTGATTATTTTAAAT
ACGACGTCACTCTTCACCAGAGAGATTTACAGAAGAATTCGACGTTTCCT
GCCATTACCATCTGTCATCATCATCCGTTTTCCAAAGACGCATACAAGTT
ATGGGATTCGAAAAAGGTCTTGTCTCCGTCTTTGTTCAATCTCTACATGC
GACAGAATGCTCTTCATTATCTCAACCAAGACGACAAATTTGCAAATAAC
TTTTATTATTTTGATTCTATCGACATATACTATCAAAATCTTTTGTATAA
TGAATCTATAGCTCTTGGTCACAAGTATACAATCGTTCTTTATTGCCTCA
GGAGAAACGATTATCAAATTGACTTTGAAAATGACTGCCAGCAGTTTGAT
AGTTATGTTATTAAACGATTATCTCACCCTCAACATTTTAATTGTTACAC
CTTTGAACCAAGAAACATTTCGGTCTCGGTTTCCACTCGATTCTTTAGCT
TAATTGTTTCTCTAGGACGACCGGAACCGGACTATGCCAATCATGAACAA
GCTTTTCTTATCGATGTCTTTGAACAGGCCAAGGGTCTGAGAGCCGTAGT
CCATGAACCAGGAACTATTCCAGATATCGAAAGAGAAGGTCTTCATGTCG
AACCAGGGAAACTAAATGAAATCAATTTTCAGCCAGTTTTGAATTTAAAA
CTTGACACTCCTAAACGACCTTGCATACCTGACAATGAAAGTTCCAAACT
AATCGACTTGGATTCGAAATATAATTATACGTTTTACGAATGTATAAATC
TTGAAAAGCAATATTTGATAGTGAAACATTGTAAATGTATGTATATTCTC
TATCCCAGACCCCTCTATCCAACAAAGGAAGTTCCGTACTGTGGAAAGCT
TTGGCCTAAAATCGACCTAGACGAATTTACAACGCGGATAAATTGTGTTT
CGAATTATTTAAAAATGTCTCTGACTGAAGAAATTGAAAAGAAATGTCGA
CCAAGATGTTCCTATTACACATACGAAGCAACAGTGTCGATTACGAAATG
GCGTGCAAAGCAGTGGCAACTCCACTGGCTCAGTTTACAAAGCAATGCTC
AGAAAGCTCTAAATGCCAACATTTCAGCTGAGAGTTACCAAAATGCTAAG
AACAGTTGGAAATCCTATTTAGAAAGACGCGACTTGTCTAATGTTAACAT
TGCTGACTCAAGAAAATCTCTCAATCTCGATGGAGATGATTTTGCTTATG
TTGTTTTAAAGAAAAAGAGTTCCATTCTCAAAGAAAGATCGGAAAAAGAA
GTCTTGAGTTTGCCAGTTCTATTGAGTCGCATCGGTGGATTTTGTTCTCT
ATTGATAGGACTAACTGTCGCTGTTGTAGTTGAATTCATAGAATTTGTTT
ATTTACTCATTCTCAAAACTTTTTACCAAAACAATCCGACAAAATCAACA
CCGGTTAAAAATAAATTCGTCACAGTGGAAAATTACGACAACAAACGTAA
TGTTTACAGTTGGAACAATGAAGAAAGACCGAAAGAAATTTTGTTGTGAA
ATATTTTACAAGTATTTTGTTTATGTGTGTTTGTGTATGTAA
back to top

protein sequence of SMED30021819-orf-1

>SMED30021819-orf-1 ID=SMED30021819-orf-1|Name=SMED30021819-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MHTTTFEYGHKSAHDIECQPVKRKKKKRRTNNLKKLVKDETILELFCRCM
TIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQ
RDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHY
LNQDDKFANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQI
DFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGR
PEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNE
INFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYECINLEKQYLI
VKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMS
LTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNAN
ISAESYQNAKNSWKSYLERRDLSNVNIADSRKSLNLDGDDFAYVVLKKKS
SILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKT
FYQNNPTKSTPVKNKFVTVENYDNKRNVYSWNNEERPKEILL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 105..121
score: 40.0
coord: 347..364
score: 39.56
coord: 409..429
score: 29.14
coord: 272..290
score: 30.11
coord: 213..229
score: 32.47
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 46..542
e-value: 1.7E-54
score: 185.5
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 41..563
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 96..510
e-value: 2.1E-31
score: 111.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 310..413
e-value: 2.1E-31
score: 111.3
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 118..272
e-value: 2.1E-31
score: 111.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 66..540
e-value: 2.1E-31
score: 111.3
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 526..548