SCP domain-containing protein

Overview
NameSCP domain-containing protein
Smed IDSMED30021818
Length (bp)238
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCP domain-containing protein (SMED30021818) t-SNE clustered cells

Violin plots show distribution of expression levels for SCP domain-containing protein (SMED30021818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021818SMESG000047165.1 SmedASXL_010175SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
embryonic pharynxSMED30021818SMESG000047165.1 SMED30015313smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30021818SMESG000047165.1 SMED30015313smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynxSMED30021818SMESG000047165.1 SMED30015313smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
embryonic pharynxSMED30021818SMESG000047165.1 SMED30015313smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
head regionSMED30021818SMESG000047165.1 OX_Smed_1.0.20877ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30021818SMESG000047165.1 dd_Smed_v4_14382_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 55.4546 bits (132), Expect = 2.934e-10
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDR 225
            Q+++++ HN+ RR V+       P A NML++EWN EAA  AQ  A++C ++H   +DR
Sbjct:   70 QREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDR 121          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 55.4546 bits (132), Expect = 3.040e-10
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDR 225
            Q+++++ HN+ RR V+       P A NML++EWN EAA  AQ  A++C ++H   +DR
Sbjct:   62 QREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDR 113          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 55.0694 bits (131), Expect = 3.798e-10
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDR 225
            Q+++++ HN+ RR V+       P A NML++EWN EAA  AQ  A++C ++H   +DR
Sbjct:   52 QREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDR 103          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 53.1434 bits (126), Expect = 1.174e-9
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDR 225
            Q+++++ HN+ RR V+       P A NML++EWN EAA  AQ  A++C ++H   +DR
Sbjct:   62 QREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDR 113          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 50.8322 bits (120), Expect = 1.296e-8
Identity = 21/60 (35.00%), Postives = 36/60 (60.00%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            Q+++++ HN+ R+ V+       P A+NML++EW+ E    AQ  A++C  QH    DR+
Sbjct:   37 QREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRK 89          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 48.521 bits (114), Expect = 2.573e-8
Identity = 23/66 (34.85%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQI----SGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            +Q +++AHN  R  +A+G+     + + +A NML+++W++  AQ AQ  A+ C  QH  S D+ +G
Sbjct:   23 KQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQH--SPDKSYG 86          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-11 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93746])

HSP 1 Score: 45.8246 bits (107), Expect = 2.559e-7
Identity = 24/75 (32.00%), Postives = 38/75 (50.67%), Query Frame = 1
Query:    1 LGVVISVIQCDLTPDQQQQLIDAHNKYRRDVAQGQI----SGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQ 213
            L   I+ +    T   QQ ++DAHNK R  +A+G      + Q + +NM +++W+   A  AQ  A+ C   H Q
Sbjct:    7 LVCCIAGVFSQFTSTGQQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDATVATSAQNYANTCPTGHSQ 81          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-6 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18538])

HSP 1 Score: 44.669 bits (104), Expect = 6.636e-7
Identity = 20/67 (29.85%), Postives = 38/67 (56.72%), Query Frame = 1
Query:    7 VVISVIQCDLTPDQQQQLIDAHNKYRRDVAQG--QISG--QPAAANMLELEWNDEAAQRAQMSADRC 195
            ++I ++  + +   QQ ++D HN +R  +A G   I+G  +PA +N+ ++ W+   A  AQ  A+ C
Sbjct:   11 LLIVLVDAEFSSSTQQFIVDLHNSFRSKLATGTYSINGTLKPAGSNIRKMSWDSTLATSAQTYANTC 77          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-6 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18538])

HSP 1 Score: 44.669 bits (104), Expect = 6.636e-7
Identity = 20/67 (29.85%), Postives = 38/67 (56.72%), Query Frame = 1
Query:    7 VVISVIQCDLTPDQQQQLIDAHNKYRRDVAQG--QISG--QPAAANMLELEWNDEAAQRAQMSADRC 195
            ++I ++  + +   QQ ++D HN +R  +A G   I+G  +PA +N+ ++ W+   A  AQ  A+ C
Sbjct:   11 LLIVLVDAEFSSSTQQFIVDLHNSFRSKLATGTYSINGTLKPAGSNIRKMSWDSTLATSAQTYANTC 77          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-17 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N3I3])

HSP 1 Score: 43.5134 bits (101), Expect = 1.878e-6
Identity = 20/57 (35.09%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   52 QQLIDAHNKYRRDVAQGQISGQ----PAAANMLELEWNDEAAQRAQMSADRCVFQHD 210
            QQ +DAHN++R  +A+G    +      A N+++++WN   A  AQ  A++C   HD
Sbjct:   25 QQTLDAHNEFRSSIAKGTYVTKGLLHAPATNIMKMKWNVTIATAAQNHANKCPKGHD 81          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 66.2402 bits (160), Expect = 3.094e-14
Identity = 29/67 (43.28%), Postives = 42/67 (62.69%), Query Frame = 1
Query:   19 VIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSR 219
            +I   +T +++  ++  HN+ R+ VA G+  GQP A NM E+ W+DE A RAQ  AD C F+HD  R
Sbjct:   27 IIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHR 93          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 53.5286 bits (127), Expect = 7.562e-10
Identity = 24/64 (37.50%), Postives = 38/64 (59.38%), Query Frame = 1
Query:   31 DLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRD 222
            +++  ++Q L+D HN  R  +A G + G  +AA+M  L W+ E  Q A + A RC F HD+ R+
Sbjct:   90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRN 153          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG42564 (gene:FBgn0260766 transcript:FBtr0301268)

HSP 1 Score: 47.7506 bits (112), Expect = 9.751e-8
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRF 231
            ++P  ++ L+   N+ R  VA+G  +G   A+ M  L+WN E A  A+ +   CV +HD+ R+ +F
Sbjct:   89 ISPKVERFLLRRFNELRDSVAKGGFNGLSPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKF 154          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG34002 (gene:FBgn0054002 transcript:FBtr0302155)

HSP 1 Score: 44.669 bits (104), Expect = 1.095e-6
Identity = 22/58 (37.93%), Postives = 33/58 (56.90%), Query Frame = 1
Query:   31 DLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQ 204
            D+    ++ +++ HN YR  VA GQ+   P AA ML+L+W+ E A  A +   RC  Q
Sbjct:   63 DVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQ 120          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 43.1282 bits (100), Expect = 3.595e-6
Identity = 21/63 (33.33%), Postives = 34/63 (53.97%), Query Frame = 1
Query:   58 LIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDR---RFGG 237
            ++  HN+ R  +A G +SG P+A  M  + W+   AQ A  +A +C   HD+ R+    R+ G
Sbjct:   64 ILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAG 126          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 50.447 bits (119), Expect = 8.421e-9
Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            QQ+++D HN +RR V       QP+A+NML++ W+D  A+ A+   ++C   H     R   G
Sbjct:    9 QQEIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNG 64          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000021732.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:144837652:144848955:1 gene:ENSXETG00000011357.1 transcript:ENSXETT00000021732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.245e-7
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:   46 QQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRC 195
             +Q ++D HN++R +V        P A NML++EWNDEAA++A++ A  C
Sbjct:   19 NRQIIVDVHNRWRGNVT-------PTAMNMLKMEWNDEAAKKAEIWARTC 61          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 47.3654 bits (111), Expect = 1.997e-7
Identity = 23/67 (34.33%), Postives = 32/67 (47.76%), Query Frame = 1
Query:   37 TPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            T   QQ ++D HN YRR V        P+A NML++ W++ AA  A   +  C   H  +  R   G
Sbjct:   30 TSTVQQVIVDTHNGYRRSV-------NPSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISG 89          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 45.0542 bits (105), Expect = 1.608e-6
Identity = 23/67 (34.33%), Postives = 32/67 (47.76%), Query Frame = 1
Query:   37 TPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            T   QQ ++D HN YRR V        P+A NML++ W++ AA  A   +  C   H  +  R   G
Sbjct:   30 TSTVQQVIVDTHNGYRRSV-------NPSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISG 89          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 43.8986 bits (102), Expect = 3.172e-6
Identity = 22/60 (36.67%), Postives = 32/60 (53.33%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            +Q+++D HN YRR       S  P A+NML++ W+ EA   A+  A  C   H Q   R+
Sbjct:   34 RQKIVDIHNAYRR-------SANPTASNMLKMSWSIEAENNAKNWATTCNQYHSQPAARQ 86          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 43.1282 bits (100), Expect = 6.024e-6
Identity = 21/62 (33.87%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   52 QQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            Q +I+AHN YRR+ +       P+A NML++ W++ AA  A   +  C   H  +  R   G
Sbjct:   36 QIIINAHNNYRRNAS-------PSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISG 90          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 58.9214 bits (141), Expect = 1.515e-11
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            LT D++Q ++D HN+YR  V+       P A++ML++ W+DE A  A+  A +CV+ H++ R RR
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR 87          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 58.151 bits (139), Expect = 2.085e-11
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            LT D++Q ++D HN+YR  V+       P A++ML++ W+DE A  A+  A +CV+ H++ R RR
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR 87          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 58.151 bits (139), Expect = 2.085e-11
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            LT D++Q ++D HN+YR  V+       P A++ML++ W+DE A  A+  A +CV+ H++ R RR
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR 87          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 56.9954 bits (136), Expect = 5.375e-11
Identity = 26/65 (40.00%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            LT D++Q ++D HN+YR  V+       P A++ML++ W+DE A  A+  A +CV+ H++ R RR
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR 87          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Crisp3 (cysteine-rich secretory protein 3 [Source:MGI Symbol;Acc:MGI:102552])

HSP 1 Score: 47.7506 bits (112), Expect = 1.207e-7
Identity = 19/53 (35.85%), Postives = 32/53 (60.38%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQH 207
            Q++++  HN+ RR V+       P+ +++L +EWN +A   AQ  AD+C F H
Sbjct:   39 QEEIVSKHNQLRRKVS-------PSGSDLLNMEWNYDAQVNAQQRADKCTFSH 84          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.291e-16
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    7 VVISVIQCD-----LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            ++ S + CD     L  + ++ ++D HNK R+ VA GQ SGQP+AANM EL WNDE A  AQ SA+ CVF+H     R+
Sbjct:   17 IIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRK 95          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.701e-16
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    7 VVISVIQCD-----LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            ++ S + CD     L  + ++ ++D HNK R+ VA GQ SGQP+AANM EL WNDE A  AQ SA+ CVF+H     R+
Sbjct:   17 IIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRK 95          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPU0|VA552_SCODE (Scoloptoxin SSD552 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.539e-14
Identity = 35/79 (44.30%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    7 VVISVIQCD-----LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            ++ S + CD     L  + ++ ++D HNK R+ VA GQ SGQP AANM EL W+DE    AQ SA+ CVF+H     R+
Sbjct:   17 IIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPLAANMKELHWDDEIEAIAQRSAETCVFKHTAKSLRK 95          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPU2|VA543_SCODE (Scoloptoxin SSD43 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.420e-13
Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            L    + +++  HN+ R+ VA GQ  GQP A+NM +L WNDE A  AQ +A+RC+FQH     R+
Sbjct:   30 LDKKMKNKILKHHNELRQKVANGQERGQPTASNMKQLRWNDELAANAQRAAERCIFQHTSDEGRK 94          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P85840|VA5_TITSE (Venom allergen 5 (Fragments) OS=Tityus serrulatus OX=6887 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.861e-12
Identity = 32/58 (55.17%), Postives = 43/58 (74.14%), Query Frame = 1
Query:   43 DQQQQLIDAHNKYRRDVAQGQI-SGQ-PAAANMLELEWNDEAAQRAQMSADRCVFQHD 210
            D +  +I+ HNK R ++A GQ  SG+ PAA +MLE+EW+DE AQ AQ  AD+CVF+HD
Sbjct:   33 DDRNTIINLHNKVRNNIALGQDQSGRLPAAGDMLEMEWDDELAQIAQKLADQCVFKHD 90          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.737e-18
Identity = 33/76 (43.42%), Postives = 54/76 (71.05%), Query Frame = 1
Query:    7 VVISVIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            VV+     DL+  +++ L+  HN +R ++AQG++SGQP A NM ++ WN E+A +AQ++AD+C+F HD   DR++G
Sbjct:    6 VVLDFCSGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYG 81          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: R4G7V0 (Putative defense-related protein OS=Rhodnius prolixus OX=13249 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.210e-16
Identity = 34/74 (45.95%), Postives = 52/74 (70.27%), Query Frame = 1
Query:   19 VIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQS---RDRRF 231
            V+  +++P++QQ ++D HN+YR+ +A G+I GQP  +NM+E+ W+DE A  AQ  AD CVF+HD +     RRF
Sbjct:   25 VLSREVSPEEQQLILDVHNRYRQAIALGKIRGQPTGSNMIEMSWDDELANMAQQWADNCVFRHDTNIRRTSRRF 98          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: T1H8Z6 (SCP domain-containing protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.763e-16
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 1
Query:   31 DLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQS---RDRRF 231
            +++P++QQ ++D HN+YR+ +A G+I GQP  +NM+E+ W+DE A  AQ  AD CVF+HD +     RRF
Sbjct:    6 EVSPEEQQLILDVHNRYRQAIALGKIRGQPTGSNMIEMSWDDELANMAQQWADNCVFRHDTNIRRTSRRF 75          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A182GLU5 (SCP domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG012149 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.440e-15
Identity = 33/66 (50.00%), Postives = 47/66 (71.21%), Query Frame = 1
Query:   22 IQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSR 219
            IQ  L P  +  +++ HNK R+ VAQG I GQP A NMLE++W+DE A++AQ  AD+C+F+HD  +
Sbjct:   44 IQSGLGPTDKYDILEEHNKLRQAVAQGLIPGQPGAENMLEMQWDDELARKAQDWADQCIFKHDPKK 109          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1S4J2G6 (Allergen, putative OS=Culex quinquefasciatus OX=7176 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.111e-14
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 1
Query:   19 VIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHD-QSRDRRF 231
            V +  L P  + ++++ HNK R+ VAQG I GQP A NMLE+ W++E A++AQ  AD+C+F+HD + R  RF
Sbjct:   26 VPESGLDPSDKYEILEEHNKLRQAVAQGLIPGQPGAENMLEMSWDNELARKAQEWADQCIFKHDPKKRLARF 97          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 4.112e-7
Identity = 23/69 (33.33%), Postives = 34/69 (49.28%), Query Frame = 1
Query:   28 CDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            C      Q ++++ HN +RR V+       P+A NML++ W+ EAA  AQ  A+ C   H     R  G
Sbjct:   36 CTDVTSVQDEIVNLHNVFRRGVS-------PSATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLG 97          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 42.3578 bits (98), Expect = 1.839e-6
Identity = 21/60 (35.00%), Postives = 29/60 (48.33%), Query Frame = 1
Query:   49 QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRR 228
            Q  ++D HN  RR+V        P+A NML++ W  EA   A   A+ C F H     R+
Sbjct:   44 QTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRK 96          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 49.2914 bits (116), Expect = 2.616e-8
Identity = 26/81 (32.10%), Postives = 41/81 (50.62%), Query Frame = 1
Query:    4 GVVISVIQCDLTPDQ---QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            GV  + +  D+ P+    Q +++D HN +RR V       +P AA+ML + +++E A  AQ   D+CV  H     R   G
Sbjct:   13 GVRSACVLADICPEDTAVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNG 86          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 47.7506 bits (112), Expect = 9.372e-8
Identity = 24/72 (33.33%), Postives = 37/72 (51.39%), Query Frame = 1
Query:   31 DLTPDQ---QQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            D+ P+    Q +++D HN +RR V       +P AA+ML + +++E A  AQ   D+CV  H     R   G
Sbjct:    7 DICPEDTAVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNG 71          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 43.5134 bits (101), Expect = 3.678e-6
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 1
Query:   34 LTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHD 210
            LT  Q++ L++ HN YR     GQ+S  P+AA ML L+W+      A+  A +C+++H+
Sbjct:   57 LTDQQEEMLVELHNHYR-----GQVS--PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHN 108          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000062609.1 (SMESG000062609.1)

HSP 1 Score: 130.568 bits (327), Expect = 5.196e-40
Identity = 59/76 (77.63%), Postives = 69/76 (90.79%), Query Frame = 1
Query:    7 VVISVIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            VV+SVI+C +TP QQ+QLIDAHNKYRRD AQG+I GQPAAANMLEL+WN+EAAQRAQ SA++CVF HDQ RDR+FG
Sbjct:   13 VVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFG 88          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000062601.1 (SMESG000062601.1)

HSP 1 Score: 110.153 bits (274), Expect = 4.719e-32
Identity = 44/78 (56.41%), Postives = 63/78 (80.77%), Query Frame = 1
Query:    1 LGVVISVIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            + + I++  C++TPDQ++ LIDAHNKYRR+VAQG++S QP AANMLEL+W+ EA  +AQ   ++CVF+HD S +R+FG
Sbjct:   10 VAIYITICHCNVTPDQKKALIDAHNKYRREVAQGKVSKQPEAANMLELKWSSEAEAKAQKFVNKCVFKHDSSGERKFG 87          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000062601.1 (SMESG000062601.1)

HSP 1 Score: 110.153 bits (274), Expect = 5.164e-32
Identity = 44/78 (56.41%), Postives = 63/78 (80.77%), Query Frame = 1
Query:    1 LGVVISVIQCDLTPDQQQQLIDAHNKYRRDVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            + + I++  C++TPDQ++ LIDAHNKYRR+VAQG++S QP AANMLEL+W+ EA  +AQ   ++CVF+HD S +R+FG
Sbjct:    8 VAIYITICHCNVTPDQKKALIDAHNKYRREVAQGKVSKQPEAANMLELKWSSEAEAKAQKFVNKCVFKHDSSGERKFG 85          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.667e-29
Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 1
Query:   88 DVAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            DVAQGQISGQPAAANMLEL+WNDEAAQRAQMSADRCVFQHDQSRDRRFGG
Sbjct:   46 DVAQGQISGQPAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 95          

HSP 2 Score: 65.855 bits (159), Expect = 9.550e-15
Identity = 30/34 (88.24%), Postives = 30/34 (88.24%), Query Frame = 1
Query:  133 MLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFG 234
            M   EWNDEAAQRAQMSADRCVF HDQSRDRRFG
Sbjct:   12 MFLSEWNDEAAQRAQMSADRCVFPHDQSRDRRFG 45          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 102.064 bits (253), Expect = 2.711e-29
Identity = 48/49 (97.96%), Postives = 49/49 (100.00%), Query Frame = 1
Query:   91 VAQGQISGQPAAANMLELEWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 237
            VAQGQISGQPAAANMLEL+WNDEAAQRAQMSADRCVFQHDQSRDRRFGG
Sbjct:    1 VAQGQISGQPAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGG 49          
The following BLAST results are available for this feature:
BLAST of SCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRISP32.934e-1040.68cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP33.040e-1040.68cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP33.798e-1040.68cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP31.174e-940.68cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP21.296e-835.00cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-72.573e-834.85SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-112.559e-732.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-66.636e-729.85SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-66.636e-729.85SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-171.878e-635.09SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84833.094e-1443.28gene:FBgn0038126 transcript:FBtr0082782[more]
CG94007.562e-1037.50gene:FBgn0030562 transcript:FBtr0073920[more]
CG425649.751e-833.33gene:FBgn0260766 transcript:FBtr0301268[more]
CG340021.095e-637.93gene:FBgn0054002 transcript:FBtr0302155[more]
CG326793.595e-633.33gene:FBgn0052679 transcript:FBtr0071469[more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01068499.18.421e-934.92cysteine-rich venom protein natrin-1-like [Source:... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021732.11.245e-742.00pep primary_assembly:Xenopus_tropicalis_v9.1:5:144... [more]
stn11.997e-734.33STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
stn11.608e-634.33STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
stn13.172e-636.67STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
stn16.024e-633.87STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi161.515e-1140.00peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.085e-1140.00peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.085e-1140.00peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi165.375e-1140.00peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Crisp31.207e-735.85cysteine-rich secretory protein 3 [Source:MGI Symb... [more]
back to top
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPU1|VA576_SCODE1.291e-1646.84Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE1.701e-1646.84Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU0|VA552_SCODE2.539e-1444.30Scoloptoxin SSD552 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU2|VA543_SCODE1.420e-1344.62Scoloptoxin SSD43 OS=Scolopendra dehaani OX=260977... [more]
sp|P85840|VA5_TITSE2.861e-1255.17Venom allergen 5 (Fragments) OS=Tityus serrulatus ... [more]
back to top
BLAST of SCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI852.737e-1843.42GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
R4G7V04.210e-1645.95Putative defense-related protein OS=Rhodnius proli... [more]
T1H8Z64.763e-1647.14SCP domain-containing protein (Fragment) OS=Rhodni... [more]
A0A182GLU54.440e-1550.00SCP domain-containing protein OS=Aedes albopictus ... [more]
A0A1S4J2G61.111e-1447.22Allergen, putative OS=Culex quinquefasciatus OX=71... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000032496.14.112e-733.33pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CRISP31.839e-635.00cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000020674.22.616e-832.10cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020676.29.372e-833.33cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000023160.23.678e-637.29peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of SCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062609.15.196e-4077.63SMESG000062609.1[more]
SMESG000062601.14.719e-3256.41SMESG000062601.1[more]
SMESG000062601.15.164e-3256.41SMESG000062601.1[more]
SMESG000047165.12.667e-2998.00SMESG000047165.1[more]
SMESG000047165.12.711e-2997.96SMESG000047165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021818 ID=SMED30021818|Name=SCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=238bp
TTAGGTGTCGTTATCTCAGTTATCCAGTGTGATCTGACTCCTGACCAACA
ACAACAATTGATTGATGCTCATAATAAATACCGTCGAGATGTTGCTCAAG
GTCAAATTAGTGGACAGCCAGCTGCTGCAAATATGTTGGAATTGGAATGG
AACGATGAAGCTGCACAACGAGCTCAAATGTCGGCTGATCGTTGCGTTTT
CCAACATGATCAATCAAGAGATCGTCGATTTGGAGGTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000023embryonic pharynx
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region