Dolichol kinase-like Protein

Overview
NameDolichol kinase-like Protein
Smed IDSMED30021812
Length (bp)7335
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dolichol kinase-like Protein (SMED30021812) t-SNE clustered cells

Violin plots show distribution of expression levels for Dolichol kinase-like Protein (SMED30021812) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dolichol kinase-like Protein (SMED30021812) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dolichol kinase-like Protein (SMED30021812) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021812

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021812SMESG000022975.1 dd_Smed_v4_7896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021812SMESG000022975.1 dd_Smed_v4_7896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30021812SMESG000022975.1 dd_Smed_v6_7896_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30021812SMESG000022975.1 dd_Smed_v4_7896_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021812SMESG000022975.1 dd_Smed_v4_7896_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021812SMESG000022975.1 dd_Smed_v4_7896_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 56.225 bits (134), Expect = 1.933e-14
Identity = 61/227 (26.87%), Postives = 106/227 (46.70%), Query Frame = -3
Query: 2258 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVD-FSIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIE--NNLCKPIIL*VIMDH----LKCLEIQF--QKYLQILMLMKRETGLINHTHLIKVSQLPLCANEELTELSSD*GLKLEL-S**SVNEFWLRIMTEF 2908
            N  LFS  C +M +D K LL+H E+RWLS G+ L R+++++ ++  +   +K      F  +N+        DIF   ND   S+QG     F +  K E   +     K +      +M   L  +I E  N+L    +  VI +H    L+C E  F  ++  +I  L  +   L +  +L     L +   ++L +L++D GLK+   +  S+  FW++   ++
Sbjct:  884 NSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNL----NLTVTLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDY 1106          

HSP 2 Score: 45.4394 bits (106), Expect = 1.933e-14
Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = -2
Query: 2055 NYDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRFIALCNK*SKQAHLAH 2273
            +Y  ++++A  LLL F + YLCE  FST + IK+K+  +L      LR AL ++  R   L +K  KQAHL+H
Sbjct: 1105 DYPELAEIALKLLLLFPSTYLCETGFSTLSVIKTKHRNSLN-IHYPLRVALSSIQPRLDKLTSK--KQAHLSH 1174          
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Match: DOLK (dolichol kinase [Source:HGNC Symbol;Acc:HGNC:23406])

HSP 1 Score: 72.4034 bits (176), Expect = 6.428e-12
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWI---SNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMT-TFIEAHTDQMDN 1451
            YF I  +G  L+  L+ F D+RD G L+L+ I LL G+SLPIW+       + +     +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q+++   I  F +      ++   ++ +I T + +EA+T Q+DN
Sbjct:  378 YFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKK--TFEGTMTSIFAQIISVALILIF-DSGVDLNYSYAWILGSISTVSLLEAYTTQIDN 525          
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 56.6102 bits (135), Expect = 9.234e-11
Identity = 61/228 (26.75%), Postives = 106/228 (46.49%), Query Frame = -3
Query: 2258 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDF-------SIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYK---FESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHL-IKVSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTEF 2908
            N  + +  C++M S+  +L +H EVRW+S GR L RL++L++++  + +++   L  +         + Y        DIF  +N+  +SLQG     F L  K   F+  +K  ++ KR ++N   +M  +       + L    I  +I +HL+ L   F         ++     I H  +  + + L     E+LTELSSD GL+      SV +FW+   T +
Sbjct: 1046 NSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAY------LSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLK--MWLKRTQEN-DYDMFPSFSEFSNSSGLNMTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTELSSDLGLQALFKSVSVTQFWINAKTSY 1264          

HSP 2 Score: 32.7278 bits (73), Expect = 9.234e-11
Identity = 23/58 (39.66%), Postives = 31/58 (53.45%), Query Frame = -2
Query: 2100 NYDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRF 2273
            +Y  + + A   LL F T YLC+AAFS  T  K KN   L     ALR A+ +++ R 
Sbjct: 1263 SYPELHERAMKFLLPFSTVYLCDAAFSALTESKQKN---LLGSGPALRLAVTSLIPRI 1317          
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 60.4622 bits (145), Expect = 4.657e-8
Identity = 55/216 (25.46%), Postives = 99/216 (45.83%), Query Frame = -3
Query: 2258 FCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF---*NYNFKDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIE-NNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIKVSQLPLCAN--EELTELSSD*GLKLELS**SVNEFWLRIMTEF 2887
             C++M +    LL++TEVRWLS G+ L RL++L+ ++  + +    + +   + N  +     Y   DIF KLN+  +S+QG    +F +  K  S ++   +     +  + +    L   + E N+     I   I+ HL+ L     KY  +          + +   + V    L A   E L +L+SD  +K   S  S+N+FW  ++ E+
Sbjct:  415 LCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSA--FRLSDCLTNSSWLLRLAY-LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAIVQHLRGLRATLLKYFPV---TNDNNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEY 624          
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 60.4622 bits (145), Expect = 4.657e-8
Identity = 55/216 (25.46%), Postives = 99/216 (45.83%), Query Frame = -3
Query: 2258 FCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF---*NYNFKDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIE-NNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIKVSQLPLCAN--EELTELSSD*GLKLELS**SVNEFWLRIMTEF 2887
             C++M +    LL++TEVRWLS G+ L RL++L+ ++  + +    + +   + N  +     Y   DIF KLN+  +S+QG    +F +  K  S ++   +     +  + +    L   + E N+     I   I+ HL+ L     KY  +          + +   + V    L A   E L +L+SD  +K   S  S+N+FW  ++ E+
Sbjct:  415 LCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSA--FRLSDCLTNSSWLLRLAY-LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAIVQHLRGLRATLLKYFPV---TNDNNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEY 624          
BLAST of Dolichol kinase-like Protein vs. Ensembl Celegans
Match: dolk-1 (pep chromosome:WBcel235:III:11929358:11933639:-1 gene:WBGene00044233.1 transcript:Y56A3A.36.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dolk-1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.686e-9
Identity = 49/149 (32.89%), Postives = 79/149 (53.02%), Query Frame = 3
Query: 1023 GIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPLV 1469
            G++ + L +    F D +D   L+L+PI LL G+ LP+ +S     +     +  +++GV  VG+GDS AA++G K+G   W    K  ++EGS+    S L+   F+               ++IA+++ T  EA  + MDNFILPLV
Sbjct:  158 GVLNEHLLI----FKDAQD-SELLLTPIYLLVGIFLPLMVSCWDVGSFQ--PTLAIFAGVAAVGVGDSMAAIVGSKFGVTKWKGSKK--SLEGSIAMLFSMLV---FLLTTNLFIKDSSSTISIIIASLVATLAEAFINSMDNFILPLV 294          
BLAST of Dolichol kinase-like Protein vs. Ensembl Fly
Match: CG8311 (gene:FBgn0034141 transcript:FBtr0087121)

HSP 1 Score: 91.2781 bits (225), Expect = 3.593e-18
Identity = 50/147 (34.01%), Postives = 84/147 (57.14%), Query Frame = 3
Query: 1032 GKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPLVF 1472
              +L +A + F D++D G L L+P  LL G S+PIW++    +  N      L SG++ VG+GD+ A+++G K GR+ W R   +R++EG++   +S L+A   +     +  S       + A + +  +EA TDQ+DN +LPL+F
Sbjct:  355 ADRLAVAFSTFKDEKDAGELALTPFCLLIGCSMPIWMTPCPCSGDNTLA---LLSGILAVGVGDTAASVVGSKLGRNKWGR--SSRSLEGTIAFVVSILMAVWLLEISGLVAMSQAKWFATIFAALNSALVEAFTDQVDNLVLPLIF 496          
BLAST of Dolichol kinase-like Protein vs. Ensembl Zebrafish
Match: dolk (dolichol kinase [Source:ZFIN;Acc:ZDB-GENE-070410-59])

HSP 1 Score: 67.781 bits (164), Expect = 1.038e-10
Identity = 47/151 (31.13%), Postives = 76/151 (50.33%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISN---LYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATI-MTTFIEAHTDQMDN 1451
            YF I   G  L+  L  F D+RD G L+L+ I LL G+SLP+W++      +           Y+GV+ VG+GD+ A++ G   G   W    K  T EG+     +Q++A   +F   +   +   +   ++ +I M   +EA+T Q+DN
Sbjct:  364 YFRIRPFGAPLRRLLTLFLDERDSGPLILTHIYLLLGVSLPLWLTPGMCTPKGGLGGASGLVPYAGVLAVGVGDTVASVFGSNVGEIRWPGTKK--TFEGTASSVFAQIIAV-VVFLIADSSINLNASYSWVVGSISMVAMLEAYTSQIDN 511          
BLAST of Dolichol kinase-like Protein vs. Ensembl Xenopus
Match: DOLK (dolichol kinase [Source:NCBI gene;Acc:100380159])

HSP 1 Score: 80.4925 bits (197), Expect = 1.945e-14
Identity = 50/153 (32.68%), Postives = 80/153 (52.29%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWI-SNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPL 1466
            YF I   G+ L+  L  F D+RD G L+L+ I LL G+SLP+W+   +   +     +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q++A   I  F +          +L +  + + +EA T Q+DN +LPL
Sbjct:  363 YFRIKPFGQTLRNLLTLFLDERDSGPLILTHIYLLLGMSLPVWLFPRVCATSLTGSSTLLPYAGVLAVGVGDTVASVCGSAMGELRWPGTKK--TFEGTMMSIFAQIIAAALILIFDSSVNLNSGYVWILGSITLVSLLEAFTTQIDNLVLPL 513          
BLAST of Dolichol kinase-like Protein vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 60.077 bits (144), Expect = 2.865e-14
Identity = 57/225 (25.33%), Postives = 103/225 (45.78%), Query Frame = -3
Query: 2258 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIM---NYGF*NYNF-KDIF*KLNDFKISLQGNYYIIFILKYKFES-SVKN*IYGKRKRKNVSLEMVTALVPLIIENNL---CKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIKVSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTEF 2908
            N  LF   C D++   KTLL+HTE RWLS G+ L R+++L+ ++  + N++   +  F  +   N       +  DIF  LN+  +SLQG       L  K  S  +K  ++ K+  +N    M+  L     E+++    +  ++  + +HL  L  +   Y   L  +     L      +K   +P  A E+ T L++    + + S   V +FW++ +  +
Sbjct:  469 NSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKA--IRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDEN-KFYMLPTLSAFFEEHDIEQHKRITVVISVKEHLDMLASEISWYFPNLPEIP--FALARSPFSVKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFWVKCLQSY 688          

HSP 2 Score: 40.817 bits (94), Expect = 2.865e-14
Identity = 29/75 (38.67%), Postives = 40/75 (53.33%), Query Frame = -2
Query: 2055 VENYDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRFIALCNK*SKQAHLAH 2279
            +++Y  +S+M   LLL F T YLCE  FS+   IKSK + +    E+ LR AL     R   L  K  KQ+  +H
Sbjct:  685 LQSYPVLSEMVLRLLLPFPTTYLCETGFSSLLVIKSK-YRSRLVVEDDLRCALAKTTPRISDLVRK--KQSQPSH 756          
BLAST of Dolichol kinase-like Protein vs. Ensembl Mouse
Match: Dolk (dolichol kinase [Source:MGI Symbol;Acc:MGI:2677836])

HSP 1 Score: 74.7146 bits (182), Expect = 9.482e-13
Identity = 49/151 (32.45%), Postives = 82/151 (54.30%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYE---SFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMT-TFIEAHTDQMDN 1451
            YF I  +G  L+  L+ F D+RD G L+L+ I LL G+SLPIW+        ++ E   +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q+++   I  F +      ++   ++ +I T + +EA+T Q+DN
Sbjct:  374 YFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLEGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKK--TFEGTMTSIFAQIISVALILIF-DSGVDLNYSYAWILGSISTVSLLEAYTTQIDN 521          
BLAST of Dolichol kinase-like Protein vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 44.669 bits (104), Expect = 9.604e-6
Identity = 58/232 (25.00%), Postives = 100/232 (43.10%), Query Frame = -3
Query: 2252 GKNRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDF-------SIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYK---FESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQK-YLQILMLMKRETGLINHTHLIKVSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTEFLK 2914
              +  + +  C++M S+   L ++ EVRWLS GR L RL++L++++  + N++   L  +       + + Y        DIF  +N    SLQG     F L  K   F+  +K  ++ KR ++N    M       +  +++    I  +I +HL+ L   F   Y     L      L +       + L     E+L  LS+D G +      SV +FW+   T + K
Sbjct:  876 ASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAY------LADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLK--MWLKRAQEN-DYGMFPLFSEFLDSSDVSVKNIASIIFEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFATYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTSYPK 1098          

HSP 2 Score: 26.9498 bits (58), Expect = 9.604e-6
Identity = 18/58 (31.03%), Postives = 31/58 (53.45%), Query Frame = -2
Query: 2100 NYDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRF 2273
            +Y ++ + A  LLL F +  LC+A FS  T  K ++   L+     LR A+ +++ R 
Sbjct: 1095 SYPKLHEKALKLLLPFSSTCLCDATFSALTASKQRD---LRTCGPTLRLAVTSLVPRI 1149          
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Match: sp|F4J4C8|EVN_ARATH (Dolichol kinase EVAN OS=Arabidopsis thaliana OX=3702 GN=EVN PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.205e-15
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 3
Query: 1029 IGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQ-------KVLIATIMTTFIEAHTDQMDNFILPLVFCSF 1481
            +G+ L   +N F D RD   L++S   LL G +LPIW+S+ +     N  +   ++G++++GIGD+ A+++G K+G   W++  K +T+EG+     S +  C     F+ +P               +L+A   T  +EA+T Q+DN  +PLVF S 
Sbjct:  420 LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGF-----NDRALSPFAGILSLGIGDTMASMVGHKYGVLRWSKTGK-KTVEGTAAGITSMMAVC-----FVLVPILASMGYILSQGWWSLLVAVTATGMLEAYTAQLDNAFIPLVFYSL 566          
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q8R2Y3|DOLK_MOUSE (Dolichol kinase OS=Mus musculus OX=10090 GN=Dolk PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.633e-12
Identity = 49/151 (32.45%), Postives = 82/151 (54.30%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYE---SFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMT-TFIEAHTDQMDN 1451
            YF I  +G  L+  L+ F D+RD G L+L+ I LL G+SLPIW+        ++ E   +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q+++   I  F +      ++   ++ +I T + +EA+T Q+DN
Sbjct:  374 YFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLEGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKK--TFEGTMTSIFAQIISVALILIF-DSGVDLNYSYAWILGSISTVSLLEAYTTQIDN 521          
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q58CR4|DOLK_BOVIN (Dolichol kinase OS=Bos taurus OX=9913 GN=DOLK PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.023e-11
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWI---SNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMT-TFIEAHTDQMDN 1451
            YF I  +G  L+  L+ F D+RD G L+L+ I LL G+SLPIW+       + +     +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q+++   I  F +      ++   ++ +I T + +EA+T Q+DN
Sbjct:  378 YFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKK--TFEGTMTSIFAQIISVALILIF-DSGVDLNYSYAWILGSISTVSLLEAYTTQIDN 525          
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q9UPQ8|DOLK_HUMAN (Dolichol kinase OS=Homo sapiens OX=9606 GN=DOLK PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.087e-11
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWI---SNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMT-TFIEAHTDQMDN 1451
            YF I  +G  L+  L+ F D+RD G L+L+ I LL G+SLPIW+       + +     +   Y+GV+ VG+GD+ A++ G   G   W    K  T EG++    +Q+++   I  F +      ++   ++ +I T + +EA+T Q+DN
Sbjct:  378 YFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKK--TFEGTMTSIFAQIISVALILIF-DSGVDLNYSYAWILGSISTVSLLEAYTTQIDN 525          
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Match: sp|O95789|ZMYM6_HUMAN (Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 4.098e-10
Identity = 61/228 (26.75%), Postives = 106/228 (46.49%), Query Frame = -3
Query: 2258 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDF-------SIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYK---FESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHL-IKVSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTEF 2908
            N  + +  C++M S+  +L +H EVRW+S GR L RL++L++++  + +++   L  +         + Y        DIF  +N+  +SLQG     F L  K   F+  +K  ++ KR ++N   +M  +       + L    I  +I +HL+ L   F         ++     I H  +  + + L     E+LTELSSD GL+      SV +FW+   T +
Sbjct: 1046 NSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAY------LSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLK--MWLKRTQEN-DYDMFPSFSEFSNSSGLNMTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTELSSDLGLQALFKSVSVTQFWINAKTSY 1264          

HSP 2 Score: 32.7278 bits (73), Expect = 4.098e-10
Identity = 23/58 (39.66%), Postives = 31/58 (53.45%), Query Frame = -2
Query: 2100 NYDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRF 2273
            +Y  + + A   LL F T YLC+AAFS  T  K KN   L     ALR A+ +++ R 
Sbjct: 1263 SYPELHERAMKFLLPFSTVYLCDAAFSALTESKQKN---LLGSGPALRLAVTSLIPRI 1317          
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Match: A0A226D4I7 (Putative AC transposase OS=Folsomia candida OX=158441 GN=Fcan01_25450 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.333e-43
Identity = 82/241 (34.02%), Postives = 126/241 (52.28%), Query Frame = -2
Query: 6048 THLKTTH-PDVLKNSQATSTKRKNYSDLEPTK---KSKSSHSIDSYFYKET--LGEILAKFAAKDGFSIHAILNSEGIREYIRLKKM-EMPNSLSTVASLIYEFYEHKKG---ETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLH-EPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYE--NKSTQVD 6731
            THL++ H  D+LK             DL P++   K+KS   I  +F K+T  L E LA+  AKDG        S  +R  ++     ++P S  T+  ++  + +  K    E +  LK+   IG K+S++ DEWS  + R+Y+N+ LH +P+E   LGL  + GS  AE+  E+V   L    L LENDIV    DG++VM K G+L+    Q+C+ H I   V+ V Y+  N++ + D
Sbjct:   72 THLRSIHHIDLLKK------------DLNPSELGVKAKSVKPISDFFEKKTKSLEETLARMTAKDGIPFSVFSTSTDLRRALKSDGFTDLPKSAHTIKKIVIGYSQKIKSTENEHVLDLKR---IGRKFSVTFDEWSSIKNRRYMNVILHGKPQEFWNLGLIRIHGSLPAEKCLEMVANKLRLLNLSLENDIVCIITDGSSVMTKIGRLSPTYQQLCFAHGIQLGVLDVLYKKINQTPEAD 297          

HSP 2 Score: 88.9669 bits (219), Expect = 1.333e-43
Identity = 49/164 (29.88%), Postives = 91/164 (55.49%), Query Frame = -3
Query: 5441 QSISEVLNQTRKIVKFFKYSSVRKSIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIGREILPKE-HFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETLNENPHPLAAELVSELKDKLLARRNKKVVSLLYFLHNGTY 5929
             ++  V+++ R IV+ F+ S ++  I Q ++ ++ GK L+LILDCKTRW S   M+ RF  ++  I   L+++  +   K+   + ++ I   L P    I  L + ++NLLT++ ++ ++ + L+     LA EL   L+ ++  RR  ++  L  +LH G Y
Sbjct:  337 HTLRPVIDKVRTIVRMFRRSPLKNEILQTYIKQEFGKELSLILDCKTRWNSLVAMLERFYTVQASIKKALVDVRSDAHLKDWELARISDIVDALKPIEATIEALCRRDANLLTADTALNFMIQKLDMQQSGLALELGVALRTRIEERRT-ELSGLFKYLHTGQY 499          
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Match: A0A0J7KNG8 (Dimer_Tnp_hAT domain-containing protein OS=Lasius niger OX=67767 GN=RF55_8155 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.656e-40
Identity = 57/172 (33.14%), Postives = 101/172 (58.72%), Query Frame = -2
Query: 6066 ILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYEN 6581
            ++++  AKDGFS ++   S  +R   +    ++P+S +T+ S++ +F E  K   I +++K      K+S++ DEW+  + R+YLNI LH  ++   LGL  ++GS +AE    LV E L  F +++++DIVA + DG  VM+K G L     Q C+ H I  +++ + Y++
Sbjct:    4 MISRMTAKDGFSFNSFCKSSDLRYLFQKSGHKLPSSSNTIRSIVIQFSESVKANMINEIQKLQMQNQKFSLTFDEWTSRKNRRYLNINLHSDKQHRNLGLIRIQGSSSAEHCVNLVEEHLKIFNINIKDDIVAITADGPNVMIKVGNLMPCFQQRCFAHGIQLAIIDILYKD 175          

HSP 2 Score: 82.0333 bits (201), Expect = 2.656e-40
Identity = 53/185 (28.65%), Postives = 96/185 (51.89%), Query Frame = -3
Query: 5459 IQNMRNQKAEMHFSMIWIQNQITEIQSISEVLNQTRKIVKFFKYSSVRKS-IFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIGREI--LPKEHFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETLNENPHPLAAELVSELKDKLLARRNKKVVSLLYF 6004
            + ++ +   E  F +  I + +    +  +++ + RK+VK F+ S  +   I QK++ E+  K L LILDCKTRW S   M+ RF  +   I+  LI++  EI     E F+I   +   L P    +  L + ++ L+T+E ++ ++ E L+    PL+ +L + L+ ++  RR     +LLY 
Sbjct:  201 LSDVDDDDNEGSFIVDCIPSSVKIASNYKDLITKVRKVVKIFRRSPTKNDLILQKYIQEEHDKRLELILDCKTRWNSLVNMLERFYIVRLCISKALIDLRSEIRFTETEWFAI-NDLKNSLQPVKLGVKVLCRRDATLITAETTVRFILEKLDNQSTPLSTKLAAALRRRIKQRRIDLTGTLLYL 384          
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Match: A0A4C1Y486 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_52339_1 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 6.211e-34
Identity = 85/244 (34.84%), Postives = 137/244 (56.15%), Query Frame = -2
Query: 6030 HLKTTHPDVLKNSQATSTKRKNYS----DLEPTKKSKSSHSIDSYFY-----KETLGEILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKK-RLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIV-LGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSESGQE 6728
            HL+  H   +KN++  ++    YS    D +P+   KS   +    +     K++LGEI+A  AAKDG +I  I  S+ IRE +RL+ + +P + S V  +I ++YE KK ETI  L   + +   ++++S+DEWS  + R+Y NI +H  + +   LGL  + G C A    E++   L+EF L  E D+VA ++DG  VMVK+G+ N     +C NHA+H +V++ F +   T  +  S Q+
Sbjct:   41 HLEHIHKISIKNTETQASTSAGYSADNRDEQPSDSKKSKSKLQKTLHFEPKNKQSLGEIVAVLAAKDGLTIRQITKSDFIRESLRLRGINLPKNESDVMKIILKYYEEKKQETIDFLSNSKQKESARFNLSVDEWSSLRNRRYFNICIHHTDSNFYNLGLVYIPGQCRAVEIKEIIKHRLEEFGLYFEQDVVAVTSDGPNVMVKFGRENPTEMVLCLNHAVHLAVLETFCKKNETNENFTSNQD 284          
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Match: A0A2L2Y7W7 (Zinc finger MYM-type protein 6 (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.214e-33
Identity = 84/221 (38.01%), Postives = 121/221 (54.75%), Query Frame = -3
Query: 2258 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCK---PIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIKVSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTEF 2908
            N  LF N C DM+SD  +LL+H EVRWLS GRSL RL  LK +V  +  EQ   L D+   N       +  DIF K+ND  +S+QG    +F+LK K E+ VK  +  K + ++ SLEM       II NN+ K   PI   +I++HLK +E+   +Y    +  ++         + +++ L L A EE  EL+SD  L+L  S   V+EFW+ I +E+
Sbjct:   86 NSRLFKNLCIDMDSDYTSLLLHAEVRWLSRGRSLKRLLTLKDEVLIFLTEQNSNLADYFQDNLWLLKLCYLADIFDKINDMNLSMQGVCVNMFMLKNKLEAFVKKILIWKNRVESGSLEMFPFTDEYIISNNISKKDTPITK-IIVNHLKDMEVYMHRYFPNDIDTQQWICNPFSIEMEEINFLNLKAQEEFAELTSDTTLRLRFSQVPVHEFWIEIKSEY 305          

HSP 2 Score: 59.3066 bits (142), Expect = 4.214e-33
Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = -2
Query: 2055 YDRISQMAPNLLLAF*TKYLCEAAFSTSTFIKSKNW*TLQKFEEALRPALLNMLQRFIALCNK*SKQAHLAH 2270
            Y  +S+MA N LL F T YLCE+AFST T+IKSK   TL   E  LR AL  +  RF  LC   +KQ+H +H
Sbjct:  305 YPLLSEMAMNKLLPFCTTYLCESAFSTLTYIKSKYRSTLINVENLLRSALTQIEPRFNYLCK--NKQSHPSH 374          
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Match: A0A4C1SVE1 (AC transposase OS=Eumeta variegata OX=151549 GN=EVAR_3373_1 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.724e-33
Identity = 88/264 (33.33%), Postives = 135/264 (51.14%), Query Frame = -2
Query: 6036 KDGNDHGICNECFXXXXXXXXXXXXLWTHLKTTHPDVLKNSQATSTKRKNYSDLEPTKKSKSSHSIDSYFYK-----ETLGEILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSESG 6812
            KDGN    C  C S LKT GGSTKGL THL T H ++   S +TS   +N +   P  K K    +D YF K     + L ++LA+  A DGF     + S+ +R+ +  K  ++P S  T+   +  + E  K +   +LK     G ++S+S DEW+    ++Y+ + +H  ++   LGL  + G+  AE    ++ E L +F + LE DI A   DG  VM+K G+L     Q+C  H I+ +V  V Y+  +   DS + 
Sbjct:   25 KDGNS-AKCKRCPSILKTLGGSTKGLHTHLSTKH-NIKVISASTSQDTENLNTAPPPAKRK----LDDYFTKTKSDDDNLDDVLARMIALDGFPFSVFITSDNLRKLLLAKYTDLPKSAVTIQKRVMNYSEKIKKQVTSELKHLKSAGERFSLSFDEWTSMSNKRYMALNVHSYKKFWNLGLVPIYGNMTAENCLRILNERLSKFDISLETDIAAIVTDGPNVMIKVGRLVCAEQQLCLAHGINLAVCDVLYKKHNYLQDSPTS 282          

HSP 2 Score: 57.3806 bits (137), Expect = 4.724e-33
Identity = 28/69 (40.58%), Postives = 49/69 (71.01%), Query Frame = -3
Query: 5741 QITEIQSISEVLNQTRKIVKFFKYSSVR-KSIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLE 5944
            ++T+ ++I E++ + RK+V +FK S ++ +++ QK+V  + GK L+L+LDCKTRW S   M+ RF  L+
Sbjct:  319 ELTQDENIKELIEKVRKVVIYFKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERFYLLK 387          
BLAST of Dolichol kinase-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 2.777e-12
Identity = 67/220 (30.45%), Postives = 108/220 (49.09%), Query Frame = -3
Query: 2258 LFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVD-FSIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKP-IIL*VIMDHLKCLEIQFQKYLQILMLMKR--ETGLINHTHLIKVSQLPLCANEE--LTELSSD*GLKLELS**SVNEFWLRIMTEF 2899
            LF   C++M S    LL+HTEVRWLS G+ L RL++L+ +V  +  +    L D F+   +        DIF  LN   ISLQG     F ++ K E+++K      ++ +  + E    L   + + N   P  +   I++HL+ L++Q + Y   L +     E   ++   + + +   L A+EE  L +LS D  LKL  S  S+  FWL   +E+
Sbjct:  387 LFRVLCEEMGSSHVQLLLHTEVRWLSRGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLNGLNISLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENASLPNAVSRPIVEHLQSLKMQLRDYFPALDVHFSWIENPFVD---ICQGAIASLSASEEDRLIDLSCDSALKLIFSQKSLVNFWLHARSEY 603          
BLAST of Dolichol kinase-like Protein vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 3.704e-11
Identity = 65/220 (29.55%), Postives = 107/220 (48.64%), Query Frame = -3
Query: 2258 LFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVD-FSIMNYGF*NYNFKDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKP-IIL*VIMDHLKCLEIQFQKYLQILMLMKR--ETGLINHTHLIKVSQLPLCANEE--LTELSSD*GLKLELS**SVNEFWLRIMTEF 2899
            LF   C++M S    LL+HTEVRWLS G+ L RL++L+ +V  +  +    L D F+   +        DIF  LN   +SLQG     F ++ K E+++K      ++ +  + E    L   + + N   P  +   I++HL+ L++Q + Y   L +     E   ++   + + +   L A+EE  L +LS D  LK   S  S+  FWL   +E+
Sbjct:  344 LFRVLCEEMASSHVQLLLHTEVRWLSHGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLNGLNLSLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENASLPNAVSRPIVEHLQSLKMQLRDYFPALDVHFSWIENPFVD---ICQGAFASLSASEEDRLIDLSCDSALKFIFSQKSLVNFWLHARSEY 560          
BLAST of Dolichol kinase-like Protein vs. Ensembl Cavefish
Match: dolk (dolichol kinase [Source:ZFIN;Acc:ZDB-GENE-070410-59])

HSP 1 Score: 65.855 bits (159), Expect = 4.275e-10
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1011 YF*IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISN---LYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACG-FIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDN 1451
            +F I  +G  L+  L  F D+RD G L+L+ I LL G+SLP+W++      +           Y+GV+ VGIGD+ A++ G   G   W    K  T EG+     +Q++A   F+    +I  +  ++  V+ +  M   +EA+T Q+DN
Sbjct:  380 FFRIRPLGAPLRRLLTLFLDERDSGPLILTHIYLLLGVSLPLWLTPGPCTPKGGLGGAGGLVPYAGVLAVGIGDTVASVFGSTVGEIRWPGTKK--TFEGTATSVFAQVIAVAIFLIADASINLNASYSW-VVGSIAMVAMLEAYTLQIDN 527          
BLAST of Dolichol kinase-like Protein vs. Ensembl Yeast
Match: SEC59 (Dolichol kinase; catalyzes the terminal step in dolichyl monophosphate (Dol-P) biosynthesis; required for viability and for normal rates of lipid intermediate synthesis and protein N-glycosylation [Source:SGD;Acc:S000004615])

HSP 1 Score: 57.7658 bits (138), Expect = 1.487e-8
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 3
Query: 1029 IGKQLQLALNPFFDKRDF-GVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKF 1355
            +G  ++L L  F D RD  G L++S + LL G+S P+ ++N                G+I +GIGDS A++IG+++GR  W    K  T+EG+L   ++  + C  + +F
Sbjct:  376 LGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMNNSPM-------------GLIGLGIGDSLASIIGKRYGRIRWKGTQK--TLEGTLAFIVTSFIVCLVLLRF 470          
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Match: ENSORLT00000035574.1 (pep primary_assembly:ASM223467v1:10:5595259:5596581:-1 gene:ENSORLG00000022539.1 transcript:ENSORLT00000035574.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 4.958e-14
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = -3
Query: 2261 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-------KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIKV---SQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTE 2908
            N  LF + C++  ++   LL+HTEVRWLS GR L RL++L+ +V T+  E        S     F N ++        DIF KLN+  +SLQG    I  L  K    +K     KR            L   +   ++    +  VI+ HL  L   F  Y   +     +   + +  L+     S+LP+   E+L E+SSD GL+++    ++ +FWL +  E
Sbjct:  152 NARLFRSLCENTGAEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHG------SPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQE 371          
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Match: ENSORLT00000030788.1 (pep primary_assembly:ASM223467v1:17:2264135:2274164:1 gene:ENSORLG00000023031.1 transcript:ENSORLT00000030788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 3.558e-13
Identity = 66/221 (29.86%), Postives = 99/221 (44.80%), Query Frame = -3
Query: 2276 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-------KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIK---VSQLPLCANEELTELSSD*GLKLELS**SVNEFWL 2908
            N  LF N C++   +   LL+HTEVRWLS GR L RL++L+ +V T+  E        S     F N ++        DIF KLN+  +SLQG    I  L  K    +K     KR            L   +   ++    +  VI+ HL  L   F  Y         +   + +  L+     S+LP+   E+L E+SSD GL+++    ++ +FWL
Sbjct:  293 NARLFCNLCENTGVEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHG------SPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKNTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDTDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWL 507          
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Match: ENSORLT00000031208.1 (pep primary_assembly:ASM223467v1:14:26692610:26696672:-1 gene:ENSORLG00000026199.1 transcript:ENSORLT00000031208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 4.110e-13
Identity = 65/226 (28.76%), Postives = 102/226 (45.13%), Query Frame = -3
Query: 2261 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-------KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIK---VSQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTE 2908
            N  LF + C++  ++   LL+H EVRWLS GR L RL++L+ +V T+  E        S     F N ++        DIF KLN+  +SLQG    I  L  K    +K     KR            L   +   ++    +  VI+ HL  L   F  Y   +     +   + +  L+     S+LP+   E+L E+SSD GL+++    ++ +FWL +  E
Sbjct:  316 NARLFRSLCENTGAEHTELLLHPEVRWLSRGRVLSRLFELRAEVHTFLTEHG------SPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKVEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQE 535          
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Match: ENSORLT00000040762.1 (pep primary_assembly:ASM223467v1:1:8553592:8557739:1 gene:ENSORLG00000022190.1 transcript:ENSORLT00000040762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.084e-12
Identity = 71/228 (31.14%), Postives = 106/228 (46.49%), Query Frame = -3
Query: 2261 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-------KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTAL-VPLIIENNLCKPIIL*VIMDHLKC-LEIQFQKYLQILMLMKRETGLINHTHLIKV---SQLPLCANEELTELSSD*GLKLELS**SVNEFWLRIMTE 2908
            N  LF + C++  ++   LL+HTEVRWLS GR L RL++L+ +V T+  E        S     F N ++        DIF KLN+  +SLQG    I  L  K    +K     KR            L V L  E+    P+ L VI+ HL   L   F  Y   +     +   + +  L+     S+LP+   E+L E+SSD GL+++    ++ +FWL +  E
Sbjct:  366 NARLFRSLCENTGAEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHG------SPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKL-VIVGHLAANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQE 586          
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Match: ENSORLT00000028946.1 (pep primary_assembly:ASM223467v1:20:802231:804233:-1 gene:ENSORLG00000029187.1 transcript:ENSORLT00000028946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.492e-12
Identity = 62/221 (28.05%), Postives = 101/221 (45.70%), Query Frame = -3
Query: 2276 NRHLFSNFCKDMNSDCKTLLIHTEVRWLSIGRSLHRLYQLKYKVFTY*NEQK*YLVDFSIMNYGF*NYNF-------KDIF*KLNDFKISLQGNYYIIFILKYKFESSVKN*IYGKRKRKNVSLEMVTALVPLIIENNLCKPIIL*VIMDHLKCLEIQFQKYLQILMLMKRETGLINHTHLIK---VSQLPLCANEELTELSSD*GLKLELS**SVNEFWL 2908
            N  LF + C++  ++   LL+HTEVRWLS GR + RL++L+ +V T+  E        S     F N ++        DIF KL++  +SLQG    I  L  K    +K     KR            L   +   ++    +  VI+ HL  L   F  Y   +     +   + +  L+     S+LP+   E+L E++SD GL+++    ++ +FWL
Sbjct:  175 NARLFRSLCENTGAEHTELLLHTEVRWLSRGRVMSRLFELRAEVHTFLTEHG------SPHATMFENTDWLAKLCYLADIFRKLSELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVASDRGLQMKFGVSTLTQFWL 389          
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Match: SMESG000022975.1 (SMESG000022975.1)

HSP 1 Score: 424.861 bits (1091), Expect = 7.529e-138
Identity = 206/209 (98.56%), Postives = 207/209 (99.04%), Query Frame = 1
Query: 4195 VLCVVGEKVLKEKWKVCVNCKEYIHFYVFCFMSGVFDILSIQFIWLSPTIGNLILIVSILLQTLIIYFTGDLNTQIQHQLFLFILFGCFTSIIGKTLKPFDITANLCFSYFLLLQGSWHLQMDYNDSHISRTMNSSHFDHSKHQKIQEMEHQMGPEMYHSLYFAIHLYVLYVAICAVSLFFSKIRKSQTLNINNDLESLIDYNLEFRQN 4821
            VLCVVGEKVLKEKWKVCVNCKEYIHFYVFCFMSGVFDILSIQF WLSPTIGNLILIVS LLQTLIIYFTGDLNTQIQHQLFLFILFGCFTS+IGKTLKPFDITANLCFSYFLLLQGSWHLQMDYNDSHISRTMNSSHFDHSKHQKIQEMEHQMGPEMYHSLYFAIHLYVLYVAICAVSLFFSKIRKSQTLNINNDLESLIDYNLEFRQN
Sbjct:   61 VLCVVGEKVLKEKWKVCVNCKEYIHFYVFCFMSGVFDILSIQFFWLSPTIGNLILIVSFLLQTLIIYFTGDLNTQIQHQLFLFILFGCFTSVIGKTLKPFDITANLCFSYFLLLQGSWHLQMDYNDSHISRTMNSSHFDHSKHQKIQEMEHQMGPEMYHSLYFAIHLYVLYVAICAVSLFFSKIRKSQTLNINNDLESLIDYNLEFRQN 269          

HSP 2 Score: 88.9669 bits (219), Expect = 7.529e-138
Identity = 41/45 (91.11%), Postives = 42/45 (93.33%), Query Frame = 3
Query: 4062 MMHYLMRGFFFTIYGLVSLISTIFTKPPKNRENHQPELNFRKKLC 4196
            MMHYLMRGFFFTIYGLVSLISTIFTKPPKNRENHQPELN + KL 
Sbjct:    1 MMHYLMRGFFFTIYGLVSLISTIFTKPPKNRENHQPELNSKTKLV 45          
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Match: SMESG000022973.1 (SMESG000022973.1)

HSP 1 Score: 325.094 bits (832), Expect = 1.698e-97
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 3
Query: 1020 IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPLVFCSFR 1484
            IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPLVFCSFR
Sbjct:  333 IGIIGKQLQLALNPFFDKRDFGVLVLSPIGLLCGLSLPIWISNLYENNHNNYESFWLYSGVITVGIGDSFAALIGRKWGRHYWNRQTKTRTIEGSLGCFLSQLLACGFIFKFLNIPFSGQFAQKVLIATIMTTFIEAHTDQMDNFILPLVFCSFR 487          
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Match: SMESG000026901.1 (SMESG000026901.1)

HSP 1 Score: 174.096 bits (440), Expect = 6.097e-74
Identity = 112/272 (41.18%), Postives = 163/272 (59.93%), Query Frame = -2
Query: 6030 KMSDV*KYYKKDGNDHGICNECFXXXXXXXXXXXXLWTHLKTTHP-DVLKNSQATSTKRKNYSDLEPTKKSKSSHSIDSYFYKETLGEILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSESGQE 6842
            K S+V K ++K+ ++   C  C S LK  GG+T  L  HL+  H  DV KN +             P K++K++ ++ ++  +E++GE+LAK AA DGFSIHA+ +S  IRE+I  +   MP S ST+  LI +F   KK +   K  K  E G   SI+ DEW+ C  ++YLN+TLH  E+   LGL  +EGSC+A +   LV + L ++ + L N I+AS+ DGA+VM KY +LNK  +Q C NHAIH +VV+ F+ NK+  +D  S  E
Sbjct:    4 KKSEVWKIFQKETDNTAKCTMCNSVLKCAGGNTSNLANHLRAKHDIDVKKNEEP------------PEKRAKATSNMLNFIKRESVGELLAKCAAYDGFSIHAMTHSSAIREFITTRSYVMPRSESTIKKLIVDFANEKKIQFKDKFTKMAESGICLSITTDEWTSCSGKRYLNVTLHSQEDSYKLGLIAIEGSCDAYQIHSLVEQKLMDYGIKLRN-ILASTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFH-NKNNVIDEISDSE 261          

HSP 2 Score: 126.331 bits (316), Expect = 6.097e-74
Identity = 75/189 (39.68%), Postives = 111/189 (58.73%), Query Frame = -3
Query: 5363 ISEVLNQTRKIVKFFKYSSVRKSIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIGREILPKE-HFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETLNENPHPLAAELVSELKDKLLARRNKKVVSLLYFLHNGTYAKRNKF-LEYSSKEEVKSFAEQLHQKF 5923
            I+E+L   RK V+FF+ S VR  I Q++V ++EGK L LILD +TRW S   M+ R + L+  I   L EIGR+ L  E  F+IL  + +IL P    + ELSK+ S LLT+EG + +LF  + +N   L     + LK ++  RRNK++++L  FL +GT+ + +   L YS+K    S A  L  + 
Sbjct:  301 INEILQNFRKTVRFFRKSPVRNDILQRYVEDKEGKKLKLILDSRTRWNSLIPMMERLVLLQVCIKHALEEIGRDDLYNEKDFNILANLIEILKPTELAVKELSKHTSTLLTAEGVLTFLFTQMKQNNTALGKIFYNSLKIRISERRNKELITLYKFLQSGTFPQPDLMELPYSTKAPTLSLATMLAARL 489          
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Match: SMESG000077975.1 (SMESG000077975.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.910e-72
Identity = 108/272 (39.71%), Postives = 159/272 (58.46%), Query Frame = -2
Query: 6030 KMSDV*KYYKKDGNDHGICNECFXXXXXXXXXXXXLWTHLKTTHP-DVLKNSQATSTKRKNYSDLEPTKKSKSSHSIDSYFYKETLGEILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSESGQE 6842
            K S+V K ++K+ ++   C  C S LK   G+T  L  HL+  H  DV KN +             P K++K++ S+ ++  +E++ E+LAK AA DGFSI A+ +S  IRE+I  +   MP S ST+  LI +F   KK +   K  K  + G  +SI+ DEW+ C  ++YLN+TLH  E+   LGL  +E SC+A +   LV + L ++ + L N I+ S+ DGA+VM KY +LNK  +Q C NHAIH +VV+ FY NK+  +D  S  E
Sbjct:    4 KKSEVWKIFQKETDNTAKCTMCNSILKCASGNTSNLANHLRAKHDIDVKKNEEP------------PEKRAKATSSMLNFIKRESVEELLAKCAAYDGFSIDAMTHSSAIREFITTRSYVMPRSESTIKKLIVDFANEKKLQFKDKFTKMAKSGMCFSITTDEWTSCSGKRYLNVTLHSQEDSYKLGLIAIECSCDAYQIHSLVEQKLMDYGIKLRN-ILTSTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFY-NKNNVIDEISDSE 261          

HSP 2 Score: 129.028 bits (323), Expect = 1.910e-72
Identity = 69/163 (42.33%), Postives = 103/163 (63.19%), Query Frame = -3
Query: 5441 SISEVLNQTRKIVKFFKYSSVRKSIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIGREILPKE-HFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETLNENPHPLAAELVSELKDKLLARRNKKVVSLLYFLHNGTY 5926
            +I+E+L   RK V+FF+ S VR  I Q++V ++EGK L LILDC+TRW S   M+ R + L+  I   L EIGR+ L  E  F+IL  + +IL P    + ELSK+ S LLT+EG + +LF  + +N   L  +  + LK ++  RRNK++++L  FL +GT+
Sbjct:  300 NINEILQNFRKTVRFFRKSPVRNDILQRYVEDKEGKKLKLILDCRTRWNSIIPMMERLVLLQVCIKHALEEIGRDDLYNEKDFNILANLIEILKPTELAVKELSKHTSTLLTAEGVLTFLFTQMKQNNTALGKKFYNSLKIRISERRNKELITLYKFLQSGTF 462          
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Match: SMESG000022344.1 (SMESG000022344.1)

HSP 1 Score: 167.933 bits (424), Expect = 9.858e-70
Identity = 97/234 (41.45%), Postives = 140/234 (59.83%), Query Frame = -2
Query: 6030 HLKTTHP-DVLKNSQATSTKRKNYSDLEPTKKSKSSHSIDSYFYKETLGEILAKFAAKDGFSIHAILNSEGIREYIRLKKMEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQQRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLENDIVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSESGQE 6728
            HL+  H  DV KN +             P K++K++ ++ ++  +E++GE+LAK A  DGFSIHA+ +S  IRE+I  +   MP S ST+  LI +F   KK +   K  K    G  +SI+ DEW+ C  ++YLN+TLH  E+   LGL  +EGSC+A +   LV + L  + + L N I+AS+ DGA+VM KY +LNK  +Q C NHAIH +VV+ FY NK+  +D  S  E
Sbjct:   19 HLRAKHDIDVKKNEEP------------PEKRAKATSNMLNFIKRESVGELLAKCAVYDGFSIHAMTHSSAIREFITTRSYVMPKSESTIKKLIVDFANEKKLQFKDKFIKMANSGMCFSITTDEWTSCSGKRYLNVTLHSQEDSYKLGLIAIEGSCDAYQIHSLVEQKLMYYDIKLRN-ILASTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFY-NKNNVIDEISDSE 238          

HSP 2 Score: 118.242 bits (295), Expect = 9.858e-70
Identity = 71/188 (37.77%), Postives = 108/188 (57.45%), Query Frame = -3
Query: 5366 ISEVLNQTRKIVKFFKYSSVRKSIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIGREILPKE-HFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETLNENPHPLAAELVSELKDKLLARRNKKVVSLLYFLHNGTYAKRNKF-LEYSSKEEVKSFAEQLHQK 5923
            I+E+L   RK V+FF+ S VR  I Q++  ++EGK   LILDC+TRW S   M+ R + L+  I   L EIG + L  E  F+IL  + +IL P    + ELSK+ S L+T+E  + +LF  + +N   L  +  + LK  +  RRNK++++L  FL +GT+ + +   L YS+K    S A  L  +
Sbjct:  278 INEILQNFRKTVRFFRKSPVRNDILQRYDEDKEGKKFKLILDCRTRWNSLIPMMERLVLLQVCIKHALEEIGCDDLYNEKDFNILENLIEILKPTEFAVKELSKHTSTLITAERVLTFLFTQMKQNNTALGKKFYNSLKIGISERRNKELITLYKFLQSGTFPQPDLMKLPYSTKAPTLSLATMLAAR 465          

HSP 3 Score: 71.633 bits (174), Expect = 5.588e-12
Identity = 36/84 (42.86%), Postives = 58/84 (69.05%), Query Frame = -2
Query: 4998 ECKE--SFK*SFYKNEMSQYECSGAKSANLEKLYESLLTIKSTSTASERMFSISGFICSKIRNRMSTRMLNALVFLRYYFLKKI 5243
            EC    +F+ SF K E+  +  +  KS  ++ L+ +L +I+ TST SER+FSI+G  C+K+R+ M   +L+AL+FL+YYF+KK+
Sbjct:  511 ECANDGNFELSFQK-ELKMFGVTKQKSKTVQNLFNALASIQPTSTDSERVFSIAGNFCTKLRSSMKFELLDALIFLKYYFIKKL 593          
The following BLAST results are available for this feature:
BLAST of Dolichol kinase-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED91.933e-1426.87zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
DOLK6.428e-1231.79dolichol kinase [Source:HGNC Symbol;Acc:HGNC:23406... [more]
ZMYM69.234e-1126.75zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
ZBED54.657e-825.46zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED54.657e-825.46zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dolk-12.686e-932.89pep chromosome:WBcel235:III:11929358:11933639:-1 g... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG83113.593e-1834.01gene:FBgn0034141 transcript:FBtr0087121[more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dolk1.038e-1031.13dolichol kinase [Source:ZFIN;Acc:ZDB-GENE-070410-5... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DOLK1.945e-1432.68dolichol kinase [Source:NCBI gene;Acc:100380159][more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zbed52.865e-1425.33zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Dolk9.482e-1332.45dolichol kinase [Source:MGI Symbol;Acc:MGI:2677836... [more]
Zmym69.604e-625.00zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F4J4C8|EVN_ARATH8.205e-1531.65Dolichol kinase EVAN OS=Arabidopsis thaliana OX=37... [more]
sp|Q8R2Y3|DOLK_MOUSE6.633e-1232.45Dolichol kinase OS=Mus musculus OX=10090 GN=Dolk P... [more]
sp|Q58CR4|DOLK_BOVIN2.023e-1131.79Dolichol kinase OS=Bos taurus OX=9913 GN=DOLK PE=2... [more]
sp|Q9UPQ8|DOLK_HUMAN3.087e-1131.79Dolichol kinase OS=Homo sapiens OX=9606 GN=DOLK PE... [more]
sp|O95789|ZMYM6_HUMAN4.098e-1026.75Zinc finger MYM-type protein 6 OS=Homo sapiens OX=... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A226D4I71.333e-4334.02Putative AC transposase OS=Folsomia candida OX=158... [more]
A0A0J7KNG82.656e-4033.14Dimer_Tnp_hAT domain-containing protein OS=Lasius ... [more]
A0A4C1Y4866.211e-3434.84BED-type domain-containing protein OS=Eumeta varie... [more]
A0A2L2Y7W74.214e-3338.01Zinc finger MYM-type protein 6 (Fragment) OS=Paras... [more]
A0A4C1SVE14.724e-3333.33AC transposase OS=Eumeta variegata OX=151549 GN=EV... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000051422.12.777e-1230.45pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.13.704e-1129.55pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
dolk4.275e-1031.79dolichol kinase [Source:ZFIN;Acc:ZDB-GENE-070410-5... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SEC591.487e-832.73Dolichol kinase; catalyzes the terminal step in do... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dolichol kinase-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035574.14.958e-1429.20pep primary_assembly:ASM223467v1:10:5595259:559658... [more]
ENSORLT00000030788.13.558e-1329.86pep primary_assembly:ASM223467v1:17:2264135:227416... [more]
ENSORLT00000031208.14.110e-1328.76pep primary_assembly:ASM223467v1:14:26692610:26696... [more]
ENSORLT00000040762.11.084e-1231.14pep primary_assembly:ASM223467v1:1:8553592:8557739... [more]
ENSORLT00000028946.11.492e-1228.05pep primary_assembly:ASM223467v1:20:802231:804233:... [more]
back to top
BLAST of Dolichol kinase-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022975.17.529e-13898.56SMESG000022975.1[more]
SMESG000022973.11.698e-97100.00SMESG000022973.1[more]
SMESG000026901.16.097e-7441.18SMESG000026901.1[more]
SMESG000077975.11.910e-7239.71SMESG000077975.1[more]
SMESG000022344.19.858e-7041.45SMESG000022344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021812 ID=SMED30021812|Name=Dolichol kinase-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7335bp
AACAGATAACAGCTTTCCAACTTTATTATTACTCATTATTACTAAAATAT
ATGGATTAGACAAAACAAGAGAAAATAGGACACATTAAACATTATTTTAG
ATACTTGACAATATCTTCATCAGGTGTGTTGTTGTCTTTTTTCGGTGAAG
GGTACTAGGAATAGGCAATGAGCATCTAACTACACGGCTGAAAAACATCG
TGGTAGGTAATTGCTGAAGCTCTATTTTCATATGTGTTAGGAGACTTTTG
TATGGTTCTATCGCACTGTCAAGAGCATTCTGAAACCTCAATGCACGCAC
CATTTGGGTCCCATTTGTCAATCATTTCGTGTACTACCTTCACGACCTTC
GAGATACGATCAAGTGTAAGGCCAACTTCCACCTCTTGACCCCCAGGAAC
ACCTGGCTTTTCTTTTTCCACCTCATCATTTTTAGATCCAGCAGATCAAC
ATCAGTTAAAAACATAATTTAAATAAAAAACGAATATATATAATTTTTTG
TATGTATTCTCTCGCATAATTCTCACGAGCACTCTGTTGATTATGTAATA
TGATTGTTTGGAATAAATATTTAAAAAAAAGACCGCGATGAGTGAAACTG
TGAAAGTCGAAGCACGAAATGGCGAGGGATTACTGTATTCTTATCCAATT
TTTCAAACACAATTTTCTTAGTTACAAGATAATAAAATGTTAACATCCAA
AATTTCAATTCAAAATTGACATTAAGGAGCATCCATTAAGTACATCCGCT
GTGAATGATGAAGGGGTCTTCACAAAGTGGTATATTGGAGTCAATAAAAA
GGTCACAATGGGACAAGTAGGGCGATACAAAATGTTAATATTTTGAATAT
ATCCTCAATGGATGCTCCTTTACATTTGATTCACTGTATCCAATTTATTC
ATTTAGAATTGACCACTTTATTTCCTCATCATTTTCTAAATAATACCATT
ATAATTTCCTTCCTATCAACTCGTTAAAAATATCCCTGTTTAATTGCTTT
ATCGTCATTTTATTTCTAGATTGGAATAATTGGTAAACAGTTACAACTCG
CACTGAATCCCTTTTTCGACAAAAGGGATTTTGGAGTATTAGTTCTTTCT
CCAATCGGTCTTTTGTGTGGCTTGTCTTTGCCGATATGGATATCGAACCT
CTATGAAAATAACCATAATAATTATGAAAGCTTTTGGCTTTATAGTGGTG
TAATAACTGTTGGAATTGGCGACAGTTTTGCGGCATTAATCGGCCGAAAG
TGGGGTCGGCATTATTGGAATCGACAAACAAAAACTCGAACAATCGAAGG
TAGTTTGGGGTGTTTTTTGTCACAATTATTGGCTTGCGGTTTCATTTTTA
AATTTCTTAATATTCCATTTTCTGGCCAATTTGCTCAAAAAGTCTTGATA
GCGACTATTATGACAACATTTATTGAAGCTCACACAGATCAAATGGATAA
TTTCATATTACCGCTCGTATTTTGTTCATTCAGATAATATGAACTGATTC
GTTTTTTTAAAAAATTCTATTTGAAATTTTTGTATTTTTCCATTTTCCAT
TAAGATATTATAAACGGGCACGGACAATTCGTCAATATTGAATGGTTTGT
CTAAGGAGATTTGTTGTTTAAATTGTAGATTAATATTTGTCTTATGAATT
TTAAATTAAATTGGTTACGAAAATACTGAATTTTTAATTAAAATTTTGCC
CTGAATTCTACCGCTGAGGATATCTATTAACAAAATGCATTAGAAACAAC
ATTGAAAAAAATATTTTAAATTTCCTTGATGCGTTATTATTATCAGGAAC
AAAAATTTATGAAAAAGAATATTAAAAAAATATCGGAGTGAATGTGACTG
TTTTCTCAATCTTAATTCATTCCTGATTACAAGTTTTACTTTATGCAAAT
CCTAAAATGCTATCATGAAGAGTTTTTTATTTGGTGAAAGCCAATATTTT
TGCGACTCTGGACATAGAGATAAAAGTAGAAATAAGAAAAACAATTTTTT
AGTATCCATACCAATGTAATTTTACAATCTCAATAAAACCAAATATGTAT
ATTAATGAGCTAGATGTGCTTGTTTACTTTATTTATTGCATAAAGCAATA
AATCTTTGGAGCATATTTAATAGTGCAGGTCGTAGAGCTTCTTCAAATTT
TTGCAGAGTTTACCAGTTTTTTGATTTTATAAATGTTGATGTTGAAAACG
CAGCTTCGCATAAATATTTAGTTTAAAATGCTAGCAGTAGGTTTGGAGCC
ATTTGAGAAATTCTGTCATAATTCTCAACCAAAATTCATTTACTGATTAT
TAGGAAAGCTCAAGTTTTAAACCTCAGTCACTGGATAACTCTGTAAGTTC
CTCATTGGCGCATAATGGTAGCTGACTGACCTTAATCAAGTGCGTATGGT
TTATTAATCCAGTTTCCCTTTTCATCAACATCAAAATTTGAAGGTATTTT
TGAAATTGTATCTCCAGACACTTCAAATGATCCATTATGACTTAAAGAAT
TATGGGTTTACAAAGGTTATTTTCAATTATTAAAGGAACTAAAGCCGTAA
CCATTTCTAGTGATACGTTTTTCCGCTTTCTTTTTCCATATATTCAATTT
TTCACAGAACTTTCAAATTTATATTTTAATATAAATATGATATAATAATT
TCCTTGTAGTGAAATTTTGAAATCATTTAATTTTTAAAAAATATCTTTGA
AATTATAGTTTTAGAAACCGTAATTCATTATGGAGAAATCAACTAAATAT
TATTTCTGCTCATTTCAATATGTAAAAACTTTATATTTAAGTTGATATAA
TCTATGTAAACTTCGCCCTATCGAGAGCCACCTTACTTCTGTATGTATCA
ACAACGTTTTGCAATCGGAATTCATATCTTTGCAAAAGTTAGAAAATAAA
TGACGATTTTTTCCGAATGTAAACATGACTTACACATGGGTCTCAAATTA
TTTACTGAATTTAAAATCAATTTCAATGAACAATTTTTATTTAGTTGGAA
ACTATTTTTTTTTCATATTTTTTTATAACCTTTTATAAAAATTAATTTTT
TGACTTCTAACATGTAAAAAATGTTAAGTCAGCCATTCTCTGAGTACTGC
CTAAACCAATATTTATCAGTCGTTTTACTCTAGTGGCACACTTTCCAAAA
AAGATTTTTTTTCACAAAAGATGCAAAAAAATAAATTTCTAAATAAATGC
TAACGAAAAATAATTTCAACAATACTAACATTGTACGGATATAAACAATT
TTTGTAAAAAACGCATAGTAATTATTTTATATAATAAAAATTGACAAAAA
TATGTAAAAATTAAGTTTTAGGGACACTAAGAACATTCAAAAAATATGTA
CATTTTTACACCTAATCCCCTGTCTCATTATGTATCTTTTTTGGGGACCC
GCTTAGCTAATGAGGACATCCTAACAGAAACTTAATTTCACTGCACACTT
TTTTTGTAAATATTGGTCTAAGCCAACAAGATCATGGTCTCGGTTCTAAA
TCAACAATTTTTATGATATCCGCTAGAAAATTATCGGAATGATGCTAATT
CATAAATTTATTAGAGGATACAATTTTTGTTTATCAACAGGAACTTTCTT
CAAAACTTCGAGATCCGGTATGACAATATTTTCGAGACCCTTCAAATTTG
AAAACTATGACAAATAAAACACAAAAATGTTTGCGCTTTAATTTGTTACT
TTTTCAAATAGTTGGTTCATTTTCCACTCATTTTTTAAAAAGTAATCAGA
CCGGAAACATATGATTATTAGTAAACTTTACTGAATGGAAAGCTTGAGCC
CATCTTTGTGCATCATTAATATTACCACTCTTTTGAACTTTCAAGTCTAT
GCGCTAATGAAAAACAATTAAGAAACAACACTAAAATTTTCATACAATAA
AAAGCTTCATCAGTGTTGATAATGTCAAATGAAAAATTTCAATATCAATT
GACACAGAAAAATCAGTTTTAAGGTTAGTTTTTATTAGTTTTAACAACAA
GTCTTACAAATTTCAAATTTCAAATAAACATCAAATTAGTTGTTTGGAGG
ACTTCTAGAAAATGATGCACTATTTGATGAGAGGATTCTTCTTCACCATT
TATGGTCTGGTGTCTTTGATAAGCACAATTTTTACGAAACCTCCAAAAAA
TCGAGAAAACCATCAACCGGAATTGAATTTCAGAAAGAAATTGTGTTCTC
TGCGTTGTCGGGGAAAAGGTTTTGAAAGAAAAATGGAAGGTTTGTGTCAA
TTGCAAGGAATATATTCACTTTTATGTTTTCTGCTTCATGTCTGGGGTAT
TTGATATATTATCTATCCAATTTATCTGGCTCTCTCCAACAATTGGAAAT
CTCATTCTTATAGTTTCAATCCTACTTCAAACACTGATCATATACTTCAC
TGGAGATCTTAATACTCAAATACAGCATCAGCTTTTCTTGTTTATTTTGT
TCGGTTGTTTCACAAGTATCATTGGGAAAACTTTGAAACCTTTTGATATT
ACTGCTAATTTGTGTTTTTCGTATTTTCTTTTATTGCAAGGTAGCTGGCA
TTTGCAGATGGACTACAATGATTCTCATATAAGCAGAACAATGAATAGTT
CTCATTTCGATCACAGTAAGCACCAAAAGATTCAAGAAATGGAGCATCAG
ATGGGACCTGAAATGTATCATTCTCTATATTTCGCTATTCACTTGTACGT
TCTCTATGTAGCTATTTGTGCCGTTTCGCTATTCTTTAGCAAGATCAGAA
AGAGTCAAACACTGAATATTAATAATGATCTAGAATCTTTGATAGATTAC
AATTTGGAATTCCGACAAAATTAGGGTTTCCAAAAATCCCGGGATTCGGA
AAATTCGGGATCCCGGGATTTTTATTTTTTCAAAATAAATTTTTATATTT
TTTCTAAATTTATATACCAAATATTTTTTTATTATATCAAAACTAAAGAT
TTTACATAAATTATTGTAAATTAAGCTTATTTAAACATCTACCTTTCGAT
TTTCTTTAAAAAATAATATCGTAAAAATACTAAAGCGTTCAGCATTCTTG
TTGACATTCGATTTCGAATTTTCGAGCAAATGAATCCAGATATGGAAAAC
ATTCGTTCAGAAGCTGTTGATGTTGATTTTATTGTCAATAAAGATTCATA
TAACTTTTCCAAATTTGCAGATTTAGCACCAGAACATTCATATTGTGACA
TCTCATTTTTATAGAAACTTTATTTAAAACTTTCTTTGCATTCAAAACTT
TGTTAATTGTTTCCTGTAGCTTATTTTCTCTCTGCATAATTTTGTCAGGT
TTTGCTTCGTCTTCTGAGCCTGAGCCCGAGCTTGAGGTTTCTTTTTCTTT
ATTGTTTAAAGAAAACTTTTGGTGTAATTGTTCGGCAAATGATTTAACTT
CTTCTTTGCTTGAATACTCCAAGAACTTATTTCTTTTTGCATATGTACCA
TTGTGAAGGAAATATAACAAAGACACAACTTTTTTGTTTCGTCTTGCTAA
AAGTTTGTCTTTCAATTCTGAGACGAGCTCTGCAGCAAGCGGATGTGGAT
TTTCATTCAGGGTCTCAAATAAGTATGCAATCGAACCTTCAGAAGTTAAC
AAGTTACTGTTGTTTTTACTTAGCTCATTAATTACTTCAGCAGCAGGTGC
AAGTATTTGACTAATTACTGTCAGAATACTGAAATGTTCTTTGGGTAAAA
TTTCTCGTCCAATTTCTATTAGCGTATCATTGATGGGTTTCTCAAGCTTT
ATGAATCGTGCAACCATTTGATCTGTAGATTTCCACCTTGTTTTACAATC
CAAAATTAGGTTTAAGTTTTTGCCTTCTTGTTCCAATACATGCTTTTGAA
AAATTGATTTGCGAACAGACGAATATTTAAAGAACTTGACAATTTTTCTA
GTTTGATTTAACACCTCACTAATGCTCTGAATCTCTGTAATCTGGTTCTG
AATCCAAATCATTGAAAAATGCATCTCTGCCTTTTGATTCCTCATATTCT
GTATCATCTTCGTCTTCTACGACCCCAATTTCTTGACCACTTTCTGAATC
AACCTGAGTTGATTTATTCTCATAGAAAACTTTTACCACAGAATTATGAA
TAGCGTGATTGTAGCAGACTTGAGAAATATTTTTGTTGAGTTTTCCATAT
TTCACCATTACTGCAGCTCCATCATTGCTGGATGCTACAATATCATTTTC
CAAATCCAATTTGAATTCATCTAAAAATTCTGTGACAAGTTCAGTTGTCC
TTTCGGCGTTACATGATCCTTCCACGAGTTTCAACCCCAAAACAATGTCT
TCTTCAGGCTCGTGTAATGTAATATTCAAATATTTGCGTTGTTGACAATC
TGACCATTCATCGATGCTTATTGAATATTTTCCACCAATTTCCAGTCTCT
TTTTCAATTTTTGAATAGTTTCACCTTTTTTGTGCTCATAGAATTCATAG
ATTAAACTTGCTACAGTTGATAGACTGTTGGGCATTTCCATTTTTTTCAA
TCTGATGTATTCTCGTATACCCTCGGAATTCAAAATTGCGTGTATAGAAA
AACCATCTTTCGCTGCAAATTTCGCCAAAATCTCACCGAGTGTTTCTTTG
TAAAAATACGAATCTATTGAATGACTGCTTTTTGATTTCTTTGTGGGTTC
AAGATCTGAATAATTTTTCCTTTTTGTTGAGGTTGCTTGGCTGTTTTTCA
ACACGTCTGGATGGGTGGTCTTTAAATGAGTCCATAAACCTTTTGTTGAA
CCTCCTTTGGTTTTCAATTTGCTAAAACATTCATTACAAATTCCATGATC
GTTACCATCTTTTTTGTAGTATTTTTAGACGTCTGACATTTTCTAAAAAA
TGATTATAACTATTTCACGATAAAATAATAAAACATCAATTTAATAATCA
TTTTAAGTCATAGTTATCAAAATATACTAGCTTTGAAATTCAAGGTTTGA
ATCACTGTCAAAGATTTACAGTTCAGATAATTTTTTCAATCCAGAAAATG
CACGACAAATTTTTCAATTATAAATTATACAAAAGAAACAAGAGCAAGTT
CAGAATAAAAAACGGGGGGCAAGAAAAACGTGGAACTTTCTGGGTTTTTT
TAAACTGGAGCTTTTCATATCCGAATCTTCAATTCATTTCGTCGAATCAT
AAAAAAAACTCTTCAATTTTTCCTTTGAAACTGAATTATATTCAAAAAAA
GTGGAGATATTTTCAACAGAAGATTCGTAATCCCAAAAAAAACAGGAACA
AAATCCCGGGATCCCATTTTGAAAACCCTAATCCCGATGATACATGATAT
TTTAATCATTAGGTTTGTGTGATATAGATAGTGAG
back to top

protein sequence of SMED30021812-orf-1

>SMED30021812-orf-1 ID=SMED30021812-orf-1|Name=SMED30021812-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MIQNMRNQKAEMHFSMIWIQNQITEIQSISEVLNQTRKIVKFFKYSSVRK
SIFQKHVLEQEGKNLNLILDCKTRWKSTDQMVARFIKLEKPINDTLIEIG
REILPKEHFSILTVISQILAPAAEVINELSKNNSNLLTSEGSIAYLFETL
NENPHPLAAELVSELKDKLLARRNKKVVSLLYFLHNGTYAKRNKFLEYSS
KEEVKSFAEQLHQKFSLNNKEKETSSSGSGSEDEAKPDKIMQRENKLQET
INKVLNAKKVLNKVSIKMRCHNMNVLVLNLQIWKSYMNLY*
back to top

protein sequence of SMED30021812-orf-2

>SMED30021812-orf-2 ID=SMED30021812-orf-2|Name=SMED30021812-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MSGVFDILSIQFIWLSPTIGNLILIVSILLQTLIIYFTGDLNTQIQHQLF
LFILFGCFTSIIGKTLKPFDITANLCFSYFLLLQGSWHLQMDYNDSHISR
TMNSSHFDHSKHQKIQEMEHQMGPEMYHSLYFAIHLYVLYVAICAVSLFF
SKIRKSQTLNINNDLESLIDYNLEFRQN*
back to top

protein sequence of SMED30021812-orf-3

>SMED30021812-orf-3 ID=SMED30021812-orf-3|Name=SMED30021812-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MEMPNSLSTVASLIYEFYEHKKGETIQKLKKRLEIGGKYSISIDEWSDCQ
QRKYLNITLHEPEEDIVLGLKLVEGSCNAERTTELVTEFLDEFKLDLEND
IVASSNDGAAVMVKYGKLNKNISQVCYNHAIHNSVVKVFYENKSTQVDSE
SGQEIGVVEDEDDTEYEESKGRDAFFNDLDSEPDYRDSEH*
back to top

protein sequence of SMED30021812-orf-4

>SMED30021812-orf-4 ID=SMED30021812-orf-4|Name=SMED30021812-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MHDKFFNYKLYKRNKSKFRIKNGGQEKRGTFWVFLNWSFSYPNLQFISSN
HKKNSSIFPLKLNYIQKKWRYFQQKIRNPKKNRNKIPGSHFENPNPDDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004168dolichol kinase activity
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0043048dolichyl monophosphate biosynthetic process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR008906HATC_C_dom
IPR004170WWE-dom
IPR006904DUF716
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane