Netrin receptor UNC5C

Overview
NameNetrin receptor UNC5C
Smed IDSMED30021806
Length (bp)3061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin receptor UNC5C (SMED30021806) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin receptor UNC5C (SMED30021806) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Netrin receptor UNC5C (SMED30021806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Netrin receptor UNC5C (SMED30021806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021806SMESG000000615.1 SmedASXL_016106SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30021806SMESG000000615.1 dd_Smed_v4_18393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021806SMESG000000615.1 dd_Smed_v6_18393_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021806SMESG000000615.1 OX_Smed_1.0.10416ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Match: UNC5A (unc-5 netrin receptor A [Source:HGNC Symbol;Acc:HGNC:12567])

HSP 1 Score: 155.221 bits (391), Expect = 7.668e-38
Identity = 92/300 (30.67%), Postives = 148/300 (49.33%), Query Frame = 3
Query:  288 VYLKPNKKSDKKQFDKITKSVQGD----VHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            ++ K N +  ++    I +S  G        V + ++ + VE  F +  +WCQC  A++   +T +Q     K +I +AY+ K F+ EP +  + L + + L C PP+G P  ++ W +N   ++ +    + ++ + SLV+    + D   Y CVA+N    R S +A + V       NG W  W  W+ C   C  G           ++RSR C   +       C G ++Q  +CAT C VDG WS WS WS C  DCT  R REC++P P++GG++C  + +  +  NCT D C
Sbjct:   73 IFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQC-VAWSSSGTTKSQ-----KAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY-----VNGGWSTWTEWSVCSASCGRG----------WQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEEC--QGTDLDTRNCTSDLC 349          

HSP 2 Score: 107.842 bits (268), Expect = 4.081e-23
Identity = 100/413 (24.21%), Postives = 176/413 (42.62%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            +++ +TGIS+ + PD     K   + L   K    RL      T LS I+ C     + L +P+IL   HC    S  SW +++ K +    WE  +     +  +   YC L+   CY+ T +L  F L+G++ +                      A KRL ++ F        +  +  Y   DT D    ++      G ++   P +L  K+S  N+ +++    +S WK      YQEI F  +WN  T+ ++     LE            + V+Q     D    S++FN T+ +      +  S    +A    +     F++P +  +++   LDPP    + W  +A++L + ++L +F  + +PTA +L LWEA++     L  L + +  +G  D A +F
Sbjct:  510 LMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVSCG-PPGVLLTRPVILAMDHCGE-PSPDSWSLRLKKQSCEGSWEDVLHLGE-EAPSHLYYCQLEASACYVFTEQLGRFALVGEALS--------------------VAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWN-GTQRYLHCTFTLERVSPSTSDLACKLWVWQ--VEGDGQSFSINFNITKDTRFAELLALES----EAGVPALVGPSAFKIPFLIRQKIISSLDPPCRRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPD-AGLF 891          
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 153.295 bits (386), Expect = 3.132e-37
Identity = 90/303 (29.70%), Postives = 145/303 (47.85%), Query Frame = 3
Query:  288 VYLKPNK----KSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 1175
            +Y K N     ++D    + + ++    V  V + ++ + VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F  EP    + L   V L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  WA W+ C N C  G           ++R+R C   +       C G + Q  +C T C VDG W+ WS WS C  +C   R REC  P PQ+GG  C    +  + +NCT   C ++
Sbjct:   77 IYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVY-----VNGGWSSWAEWSPCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDC--SGTLLDSKNCTDGLCMQM 356          

HSP 2 Score: 89.3521 bits (220), Expect = 2.413e-17
Identity = 94/402 (23.38%), Postives = 157/402 (39.05%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQ--LSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
             TG+S+ V        K   M L      E  +  S+ TQ  LS  + C     + L +P+IL  PHC    S   W  ++    +   WE  +      + N   YC L+   C+++  +L  +   G+S     Y                  A KRL +  F   L    +  L  Y   DT      ++      G  + + P  L  K+S  N+ +++       W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  +   T   +     S P ST    T +L P +  F++P    +++   LD P    + W M+A++L +   L YF  +++PT  +L LWEA  +++  L  L S L+ +G
Sbjct:  549 GTGVSLLVPNGAIPQGKFYEMYLLINKA-ESTLPLSEGTQTVLSPSVTCG-PTGLLLCRPVILTMPHCAE-VSARDWIFQLKTQAHQGHWEEVVTLDEETL-NTPCYCQLEPRACHILLDQLGTYVFTGES-----YSRS---------------AVKRLQLAVFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWS-GSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLCSAPGST---VTTQLGPYA--FKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMG 920          
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 153.295 bits (386), Expect = 3.361e-37
Identity = 95/327 (29.05%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  288 VYLKPNK----KSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR----IDPPNPQNRYVLRDMVVYVVL 1235
            +Y K N     ++D    + + ++    V  V + ++ + VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F  EP    + L   V L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  WA W+ C N C  G           ++R+R C   +       C G + Q  +C T C VDG W+ WS WS C  +C   R REC  P PQ+GG  C    +  + +NCT   C +    +  PN        D  +Y  L
Sbjct:   77 IYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVY-----VNGGWSSWAEWSPCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDC--SGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALYAGL 380          

HSP 2 Score: 89.3521 bits (220), Expect = 2.453e-17
Identity = 94/402 (23.38%), Postives = 157/402 (39.05%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQ--LSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
             TG+S+ V        K   M L      E  +  S+ TQ  LS  + C     + L +P+IL  PHC    S   W  ++    +   WE  +      + N   YC L+   C+++  +L  +   G+S     Y                  A KRL +  F   L    +  L  Y   DT      ++      G  + + P  L  K+S  N+ +++       W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  +   T   +     S P ST    T +L P +  F++P    +++   LD P    + W M+A++L +   L YF  +++PT  +L LWEA  +++  L  L S L+ +G
Sbjct:  560 GTGVSLLVPNGAIPQGKFYEMYLLINKA-ESTLPLSEGTQTVLSPSVTCG-PTGLLLCRPVILTMPHCAE-VSARDWIFQLKTQAHQGHWEEVVTLDEETL-NTPCYCQLEPRACHILLDQLGTYVFTGES-----YSRS---------------AVKRLQLAVFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWS-GSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLCSAPGST---VTTQLGPYA--FKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMG 931          
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 152.14 bits (383), Expect = 7.298e-37
Identity = 86/277 (31.05%), Postives = 135/277 (48.74%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W+ WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  P
Sbjct:   78 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQTAP 331          

HSP 2 Score: 88.5817 bits (218), Expect = 3.732e-17
Identity = 91/415 (21.93%), Postives = 166/415 (40.00%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWN---------FRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K T    ++ S+ T L+ ++ C     + L +P++L   HC    +   W + +       +WE  +       +    Y  LD E C+++T  L  + L+G S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F  E F    + L     + Q   G   ++Q N         +     + +NT+   + PS+               F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  502 LIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQ-TLLTPVVSCGPPGAL-LTRPVVLTMHHCAD-PNTEDWKILLKNQAAQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGHSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQ-VEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSA---------------FSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 876          
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 151.754 bits (382), Expect = 9.545e-37
Identity = 86/277 (31.05%), Postives = 135/277 (48.74%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W+ WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  P
Sbjct:  119 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQTAP 372          

HSP 2 Score: 88.1965 bits (217), Expect = 4.415e-17
Identity = 91/415 (21.93%), Postives = 166/415 (40.00%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWN---------FRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K T    ++ S+ T L+ ++ C     + L +P++L   HC    +   W + +       +WE  +       +    Y  LD E C+++T  L  + L+G S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F  E F    + L     + Q   G   ++Q N         +     + +NT+   + PS+               F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  543 LIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQ-TLLTPVVSCGPPGAL-LTRPVVLTMHHCAD-PNTEDWKILLKNQAAQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGHSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQ-VEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSA---------------FSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 917          
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 126.331 bits (316), Expect = 7.279e-30
Identity = 95/383 (24.80%), Postives = 163/383 (42.56%), Query Frame = 3
Query:  111 LKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPW-NACPNDCTYGKYCVDSC-----IKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEK---ENCTLDSCFRIDPPNPQNRYVLRDMVVY 1226
            +  I +   P+  YV  +K + ++C    ++ ++  C           ++  +D S+    +  +  S     D      + DV +           S  V  F CQC A+   D      +V +    + +AY+ K F   P +  +  G  ++L C  P+  PK ++ W K+G  ++    + ++ + DGSL++ +  ++D+G Y C A N A  R +   ++++       +G W  W+PW   C  DC   +           +   +RR+R C   +   D   C G    T SC   C++DG WS+WS WS C   C R R R C  P P +GG  C   +  +++   + CT DS          +R V+ D  VY
Sbjct:    1 MDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKC-----------SSKWIDDSRIEKLIGTDSTSGVGYIDASVDISRIDVDT-----------SGHVDAFQCQCYASGDDD----QDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPD--ANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIY-----VDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADS----------SRIVISDTAVY 340          
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 127.872 bits (320), Expect = 9.933e-30
Identity = 96/386 (24.87%), Postives = 165/386 (42.75%), Query Frame = 3
Query:  102 QQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPW-NACPNDCTYGKYCVDSC-----IKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEK---ENCTLDSCFRIDPPNPQNRYVLRDMVVY 1226
            + I+  I +   P+  YV  +K + ++C    ++ ++  C           ++  +D S+    +  +  S     D      + DV +           S  V  F CQC A+   D      +V +    + +AY+ K F   P +  +  G  ++L C  P+  PK ++ W K+G  ++    + ++ + DGSL++ +  ++D+G Y C A N A  R +   ++++       +G W  W+PW   C  DC   +           +   +RR+R C   +   D   C G    T SC   C++DG WS+WS WS C   C R R R C  P P +GG  C   +  +++   + CT DS          +R V+ D  VY
Sbjct:   26 KSIMDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKC-----------SSKWIDDSRIEKLIGTDSTSGVGYIDASVDISRIDVDT-----------SGHVDAFQCQCYASGDDD----QDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPD--ANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIY-----VDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADS----------SRIVISDTAVY 368          
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 125.561 bits (314), Expect = 4.766e-29
Identity = 82/286 (28.67%), Postives = 131/286 (45.80%), Query Frame = 3
Query:  402 SWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPW-NACPNDCTYGKYCVDSC-----IKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEK---ENCTLDSCFRIDPPNPQNRYVLRDMVVY 1226
            S  V  F CQC A+   D      +V +    + +AY+ K F   P +  +  G  ++L C  P+  PK ++ W K+G  ++    + ++ + DGSL++ +  ++D+G Y C A N A  R +   ++++       +G W  W+PW   C  DC   +           +   +RR+R C   +   D   C G    T SC   C++DG WS+WS WS C   C R R R C  P P +GG  C   +  +++   + CT DS          +R V+ D  VY
Sbjct:   76 SGHVDAFQCQCYASGDDD----QDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPD--ANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIY-----VDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADS----------SRIVISDTAVY 340          
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 111.694 bits (278), Expect = 7.948e-25
Identity = 71/249 (28.51%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  513 IDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPW-NACPNDCTYGKYCVDSC-----IKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEK---ENCTLDSCFRIDPPNPQNRYVLRDMVVY 1226
            + K F   P +  +  G  ++L C  P+  PK ++ W K+G  ++    + ++ + DGSL++ +  ++D+G Y C A N A  R +   ++++       +G W  W+PW   C  DC   +           +   +RR+R C   +   D   C G    T SC   C++DG WS+WS WS C   C R R R C  P P +GG  C   +  +++   + CT DS          +R V+ D  VY
Sbjct:    1 MRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPD--ANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIY-----VDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADS----------SRIVISDTAVY 232          
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 86.2705 bits (212), Expect = 6.683e-17
Identity = 55/186 (29.57%), Postives = 82/186 (44.09%), Query Frame = 3
Query:  702 STSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPW-NACPNDCTYGKYCVDSC-----IKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEK---ENCTLDSCFRIDPPNPQNRYVLRDMVVY 1226
            +  ++D+G Y C A N A  R +   ++++       +G W  W+PW   C  DC   +           +   +RR+R C   +   D   C G    T SC   C++DG WS+WS WS C   C R R R C  P P +GG  C   +  +++   + CT DS          +R V+ D  VY
Sbjct:    3 AARLSDSGNYTCEATNVANSRKTDPVEVQIY-----VDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADS----------SRIVISDTAVY 173          
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0339998)

HSP 1 Score: 120.553 bits (301), Expect = 2.690e-27
Identity = 97/341 (28.45%), Postives = 148/341 (43.40%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRN-FWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVD-----------------GEWSTWSGWSLCQPDCTRKRIREC 1079
            PIF+ + PE ++V  ++  +++C  K S  LQ+        I K S +S    S    ++ P+   +    +++T ++  D+           V+ +F    F C+C A       +S  +V+++   + +AYI K+F   P S  L LG   +L C PP G P+PK+ W KN   +       I VS  G+L+    ++     Y C AEN AG R+S +A L V       NG W  W+PW  C   C  GK          R+RSR C          +CPG  +Q  +    C  D                   WS WS WS+C  +C + R R+C
Sbjct:  128 PIFL-IEPESVFVVKNRPAVLKC--KASHSLQV--------IFKCSGSSQPPPSTHETHVDPHTGVN---MEEVTATIHRDL-----------VDEFFGDGPFKCECHAW------SSRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVS-AGTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVY-----VNGGWSTWSPWREC--KCA-GKPSQG------RKRSRTCNNPMPLNGGAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAECIQVRRRKC 422          

HSP 2 Score: 51.9878 bits (123), Expect = 3.311e-6
Identity = 26/64 (40.62%), Postives = 33/64 (51.56%), Query Frame = 3
Query:  975 TESCATFCRVDGEWSTWSGWSLCQ----PDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCT 1154
            ++S      V+G WSTWS W  C+    P   RKR R CNNP P +GG QC P     +  +C 
Sbjct:  314 SDSAVLIVYVNGGWSTWSPWRECKCAGKPSQGRKRSRTCNNPMPLNGGAQC-PGPQIQKSADCA 376          
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0087382)

HSP 1 Score: 120.553 bits (301), Expect = 2.690e-27
Identity = 97/341 (28.45%), Postives = 148/341 (43.40%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRN-FWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVD-----------------GEWSTWSGWSLCQPDCTRKRIREC 1079
            PIF+ + PE ++V  ++  +++C  K S  LQ+        I K S +S    S    ++ P+   +    +++T ++  D+           V+ +F    F C+C A       +S  +V+++   + +AYI K+F   P S  L LG   +L C PP G P+PK+ W KN   +       I VS  G+L+    ++     Y C AEN AG R+S +A L V       NG W  W+PW  C   C  GK          R+RSR C          +CPG  +Q  +    C  D                   WS WS WS+C  +C + R R+C
Sbjct:  128 PIFL-IEPESVFVVKNRPAVLKC--KASHSLQV--------IFKCSGSSQPPPSTHETHVDPHTGVN---MEEVTATIHRDL-----------VDEFFGDGPFKCECHAW------SSRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVS-AGTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVY-----VNGGWSTWSPWREC--KCA-GKPSQG------RKRSRTCNNPMPLNGGAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAECIQVRRRKC 422          

HSP 2 Score: 51.9878 bits (123), Expect = 3.311e-6
Identity = 26/64 (40.62%), Postives = 33/64 (51.56%), Query Frame = 3
Query:  975 TESCATFCRVDGEWSTWSGWSLCQ----PDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCT 1154
            ++S      V+G WSTWS W  C+    P   RKR R CNNP P +GG QC P     +  +C 
Sbjct:  314 SDSAVLIVYVNGGWSTWSPWRECKCAGKPSQGRKRSRTCNNPMPLNGGAQC-PGPQIQKSADCA 376          
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0329985)

HSP 1 Score: 85.1149 bits (209), Expect = 2.397e-16
Identity = 41/124 (33.06%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  420 FWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEV 791
            +WC+ +  +         + R++   ++VA++   F+LEP +  +  G    + C  P GSP+P+I WRKNG+ L L    +I + D G+L I     +D+G+Y+CV +N  G R S  A L+V
Sbjct:  164 YWCEAKNEFG--------VARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKV 279          
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0077941)

HSP 1 Score: 85.1149 bits (209), Expect = 2.471e-16
Identity = 41/124 (33.06%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  420 FWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEV 791
            +WC+ +  +         + R++   ++VA++   F+LEP +  +  G    + C  P GSP+P+I WRKNG+ L L    +I + D G+L I     +D+G+Y+CV +N  G R S  A L+V
Sbjct:  164 YWCEAKNEFG--------VARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKV 279          
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0077921)

HSP 1 Score: 83.9593 bits (206), Expect = 5.152e-16
Identity = 42/126 (33.33%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  420 FWCQCEAAYTQDSSTSNQL--VRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEV 791
            +WC+ +          N+L   R++   ++VA +   F+LEP +  +  G    L C  P G P+P + W+K G+KL+L    ++ + D G+L I     TD GQY+C+A+N  G+R S  A L+V
Sbjct:   96 YWCEAK----------NELGVARSRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKV 211          
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 155.606 bits (392), Expect = 3.279e-38
Identity = 93/297 (31.31%), Postives = 141/297 (47.47%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            ++  N    K+  D IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+GSP  ++ W KN   ++    S  L++ +  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C    S  E +NCT   C R
Sbjct:   59 WVNQNDHVTKESLDHITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNAQCGRG----------WQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHC--SGSMMESKNCTEGLCAR 329          

HSP 2 Score: 101.293 bits (251), Expect = 3.255e-21
Identity = 100/413 (24.21%), Postives = 167/413 (40.44%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRE-LSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC   +    W + +   N+   WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE    +       I V Q        +++     T+I  TL     P  +   A    +P+S+     FRLP V+IR+ +   LD P      W M+A+ L     L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  526 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGML-LSRPVVLTLPHCAQLEP-PDWTLTLKMQNHQGAWEEVLTVGEESLSSP-CYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLVVSQLTCKICVRQVEGEGQIFQLN-----TDIQETL-----PPHSPLPAGGSCLPSSQVGPYAFRLP-VSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 905          
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 155.992 bits (393), Expect = 3.282e-38
Identity = 93/297 (31.31%), Postives = 141/297 (47.47%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            ++  N    K+  D IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+GSP  ++ W KN   ++    S  L++ +  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C    S  E +NCT   C R
Sbjct:   88 WVNQNDHVTKESLDHITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNAQCGRG----------WQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHC--SGSMMESKNCTEGLCAR 358          

HSP 2 Score: 100.523 bits (249), Expect = 4.513e-21
Identity = 100/413 (24.21%), Postives = 167/413 (40.44%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRE-LSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC   +    W + +   N+   WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE    +       I V Q        +++     T+I  TL     P  +   A    +P+S+     FRLP V+IR+ +   LD P      W M+A+ L     L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  555 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGML-LSRPVVLTLPHCAQLEP-PDWTLTLKMQNHQGAWEEVLTVGEESLSSP-CYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLVVSQLTCKICVRQVEGEGQIFQLN-----TDIQETL-----PPHSPLPAGGSCLPSSQVGPYAFRLP-VSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 934          
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 155.606 bits (392), Expect = 3.302e-38
Identity = 93/297 (31.31%), Postives = 141/297 (47.47%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            ++  N    K+  D IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+GSP  ++ W KN   ++    S  L++ +  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C    S  E +NCT   C R
Sbjct:   88 WVNQNDHVTKESLDHITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNAQCGRG----------WQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHC--SGSMMESKNCTEGLCAR 358          

HSP 2 Score: 100.523 bits (249), Expect = 4.664e-21
Identity = 100/413 (24.21%), Postives = 167/413 (40.44%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRE-LSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC   +    W + +   N+   WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE    +       I V Q        +++     T+I  TL     P  +   A    +P+S+     FRLP V+IR+ +   LD P      W M+A+ L     L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  544 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGML-LSRPVVLTLPHCAQLEP-PDWTLTLKMQNHQGAWEEVLTVGEESLSSP-CYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLVVSQLTCKICVRQVEGEGQIFQLN-----TDIQETL-----PPHSPLPAGGSCLPSSQVGPYAFRLP-VSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 923          
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 138.272 bits (347), Expect = 1.139e-34
Identity = 84/291 (28.87%), Postives = 138/291 (47.42%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVV 1223
            +  V + ++ + VE +    ++WC C  A++   +      +++K  + +AY+ K F+ EP    + +   + L C PP+G P  ++ W KN   +   +   I    D +L+I    ++D+G Y C+A N    R S  A + V       NG W  W  W+ C   C  G          +++R+R C   +       C G S+Q  +C + C VDG WS W+ WS C  +C R+R REC +P+P+ GG  C    +  + +NCT D C        Q+R +L D+ V
Sbjct:   71 IREVMINVSRQQVEDFHGPEDYWCLC-VAWSHLGTA-----KSRKATVRIAYLRKNFEQEPQGMEVPINGMIVLHCRPPEGVPAAEVEWLKNEELVHSLEDINIDTRADHNLIINEARLSDSGNYTCLASNIVARRRSATAMVIVF-----VNGGWSSWTDWSECNVRCGRG----------VQKRTRTCTNPAPLNGGAFCEGMSVQKSTCTSPCPVDGGWSEWTMWSECTSECERQRTRECTDPEPKHGGRLC--DGAALDTDNCTGDLCI-------QDRKLLHDVKV 331          
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 143.28 bits (360), Expect = 2.809e-34
Identity = 102/402 (25.37%), Postives = 176/402 (43.78%), Query Frame = 3
Query:   27 FSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVV 1223
            F  + +L + L +  ++   +  S      P F++  P+  Y+  S  + + C  + +  LQI    + + + +    SL     E + L    K                +  V + ++ + VE +    ++WC C  A++   +      +++K  + +AY+ K F+ EP    + +   + L C PP+G P  ++ W KN   +   +   I    D +L+I    ++D+G Y C+A N    R S  A + V       NG W  W  W+ C   C  G          +++R+R C   +       C G S+Q  +C + C VDG WS W+ WS C  +C R+R REC +P+P+ GG  C    +  + +NCT D C        Q+R +L D+ V
Sbjct:   14 FGFLAVLILLLPYAMARGSRDGQSAMSGTLPHFLQ-EPDDAYIVKSNPIKLRCRARPA--LQIFFKCNGEWVHQNQHTSL-----EHIELGTGLK----------------IREVMINVSRQQVEDFHGPEDYWCLC-VAWSHLGT-----AKSRKATVRIAYLRKNFEQEPQGMEVPINGMIVLHCRPPEGVPAAEVEWLKNEELVHSLEDINIDTRADHNLIINEARLSDSGNYTCLASNIVARRRSATAMVIVF-----VNGGWSSWTDWSECNVRCGRG----------VQKRTRTCTNPAPLNGGAFCEGMSVQKSTCTSPCPVDGGWSEWTMWSECTSECERQRTRECTDPEPKHGGRLC--DGAALDTDNCTGDLCI-------QDRKLLHDVKV 361          

HSP 2 Score: 95.5153 bits (236), Expect = 2.089e-19
Identity = 84/350 (24.00%), Postives = 149/350 (42.57%), Query Frame = 3
Query: 1950 ISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISF--LEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESAST-SWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +SL  P+ L   HC    S   W++K+ +   +  WE  +  +    S    YC LD + C+L+      + L+G++             LS         A KRL + +F  +EP      +++ C    DT      ++S     G R+ + P  L  + ++ ++ V+++      W +      QE  F  +W     P      +  +S    Q     I+V Q   ++  +++  +   +E      K + P  T  D T      S+ F++P+   + +    D        W ++A++L I  NL YF RQ++P+A +L LWEAQ++E+  L  L S L+ IG
Sbjct:  612 LSLSCPVALTVAHCADVNS-EDWNIKLKRQTQDNSWEEVMILEEESTS---CYCLLDTQCCHLLVERPGCYALVGEA-------------LSQA-------AGKRLRLAAFGNMEPNFLNYSIRVYC--VDDTPHAFQEVVSVERGRGGRLLEEPKTLLFRANSFSLQVSIQDIPQFLWSIKPFTTCQEFSFSQVWCSSQSPLQCAFSLERYSPAANQ-LSCKISVRQVKGHEQILQVYTTIAESE------KDTVPFFTQSDCTITSQTGSRAFKIPQSIRQRICATFDTANAKGKDWQLLAQKLHIDRNLGYFARQTSPSAVILSLWEAQHQEQGDLDSLASALEEIG 928          
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 162.155 bits (409), Expect = 4.590e-40
Identity = 107/403 (26.55%), Postives = 176/403 (43.67%), Query Frame = 3
Query:   45 LFINLVFICSQDIIENSSIQQILKPIFVKMP----------PEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRD 1214
            ++ +++  C   I++      +L   F   P          PE  Y+  +K V + C    ++ +   C  +                    ++  N    K++ D++T  V   V  V + ++ + VE  F + ++WCQC  A++   +T     ++K+ ++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C        QN+ VL +
Sbjct:    3 VWYDIIGACMPSIMQRIEYSDVLPDSFPSAPAESLPHFLLEPEDAYIVKNKPVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDEVTGLV---VREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCM-------QNKRVLGE 352          

HSP 2 Score: 91.2781 bits (225), Expect = 4.530e-18
Identity = 102/404 (25.25%), Postives = 169/404 (41.83%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKD-IKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTP--SSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+++  +L  +  +G+S     Y                  A KRL +  F   L    +  L  Y   DT D +K+ L  + T  G  + D P  L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  S           KS  P  S T    T +L P +  F++P    +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  546 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADIAT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHILLDQLGTYAFVGES-----YSKS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLVED-PKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENV------KSFDPFCSHTENSVTTQLGPYA--FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 916          
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 162.155 bits (409), Expect = 4.727e-40
Identity = 111/396 (28.03%), Postives = 175/396 (44.19%), Query Frame = 3
Query:   66 ICSQDIIENSSIQQILKPIFVKMP----------PEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRD 1214
            IC Q+I + S I  +L   F   P          PE  Y+  +K V + C    ++ +   C  +                    ++  N    K++ D++T  V   V  V + ++ + VE  F + ++WCQC  A++   +T     ++K+ ++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C        QN+ VL +
Sbjct:   25 ICYQEIRQISKID-VLPDSFPSAPAESLPHFLLEPEDAYIVKNKPVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDEVTGLV---VREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCM-------QNKRVLGE 366          

HSP 2 Score: 88.9669 bits (219), Expect = 2.342e-17
Identity = 99/402 (24.63%), Postives = 167/402 (41.54%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKD-IKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+++  +L  +  +G+     SY                  A KRL +  F   L    +  L  Y   DT D +K+ L  + T  G  + D P  L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  S    E+ N               T +L P +  F++P    +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  560 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADIAT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHILLDQLGTYAFVGE-----SYSKS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLVED-PKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLE--EVRN------------NSVTTQLGPYA--FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 920          
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Match: ndufaf7 (NADH:ubiquinone oxidoreductase complex assembly factor 7 [Source:Xenbase;Acc:XB-GENE-996599])

HSP 1 Score: 161.384 bits (407), Expect = 7.160e-40
Identity = 103/363 (28.37%), Postives = 179/363 (49.31%), Query Frame = 3
Query:  288 VYLKPNK----KSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRY-VLRDMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGG 1346
            +Y K N     + D    +K+ ++    V  V++ ++ + VE  F + ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N  G R S  A + V       NG W  W  W+AC N C  G           ++R+R C   +       C G  +Q  +C + C  DGEW+ WS WS C  +CT  R R+C NP P++GG  C       + +NCT   C ++     + R+ ++ ++ +YV  V+++ + L I V   +  ++K H  F +   + ++  GG
Sbjct:   59 IYFKCNSEWVHQKDHVVNEKVDETSGLIVREVSIEISRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPGAEVEWLKNEDVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVGKRRSTTATVIVY-----VNGGWSTWTEWSACSNRCGKG----------YQKRTRTCTNPAPLNGGYICEGQGVQKMACTSLCPEDGEWTAWSKWSTCGTECTHWRRRDCANPPPRNGGKDC--DGPVLQSKNCTDGLCMQVSKSLTKTRHPLIYNVALYVGIVIAVIVCLAISVIVALFVYRKNHRGFESDIIDTSALNGG 398          

HSP 2 Score: 93.5893 bits (231), Expect = 9.290e-19
Identity = 96/415 (23.13%), Postives = 168/415 (40.48%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWN---------FRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      IE S+ T L+ ++ C     + + +P+IL   HC    +   W M++ + +   +WE  + F   +      Y  ++ E C+++T  L  + L+G+S +  S                     KRL +  F        +  +  Y   DT+D    +I +    G ++ D P  L  K S  N+ +++     S WK     +YQEI F  +W+         F  E F    + L     + Q   G   ++Q              N TE S+ ++     S++    T   I     F +P    ++L   LD P+     W M+A +L +   L YF  + +PT  +L LWEAQN  E  L  L + L+ +G
Sbjct:  519 LIIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKENMRPPIEDSQ-TLLTPVVSCGPPGAL-MTRPVILTMHHCAE-TTGEDWKMQLKEQSVQGQWEDVV-FVGEENFTTPCYIQMESEACHILTETLSTYALVGQSTSKSSA--------------------KRLKLALFGPTSCTSLEYNIRVYCLDDTQDALKEVIQQERKVGGQLLDEPKTLHFKGSTHNLRLSIHDVPHSLWKSKLLAKYQEIPFYHIWSGCQRNLHCTFTLERFSLSTVELVCKLCVRQ-VEGEGQIFQ-------------LNCTEPSSIIDLPLMDSAS----TITTIVGPSAFSIPLTIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKPSPTGVILDLWEAQNYPEGNLSTLAAVLEEMG 891          
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 160.999 bits (406), Expect = 1.037e-39
Identity = 104/369 (28.18%), Postives = 167/369 (45.26%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRD 1214
            P F+ + PE  Y+  +K V + C    ++ +   C  +                    ++  N    K++ D++T  V   V  V + ++ + VE  F + ++WCQC  A++   +T     ++K+ ++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C        QN+ VL +
Sbjct:   51 PHFL-LEPEDAYIVKNKPVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDEVTGLV---VREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCM-------QNKRVLGE 365          

HSP 2 Score: 91.6633 bits (226), Expect = 4.129e-18
Identity = 102/404 (25.25%), Postives = 169/404 (41.83%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKD-IKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTP--SSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+++  +L  +  +G+S     Y                  A KRL +  F   L    +  L  Y   DT D +K+ L  + T  G  + D P  L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  S           KS  P  S T    T +L P +  F++P    +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  559 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADIAT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHILLDQLGTYAFVGES-----YSKS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLVED-PKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENV------KSFDPFCSHTENSVTTQLGPYA--FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 929          
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 160.999 bits (406), Expect = 1.155e-39
Identity = 100/356 (28.09%), Postives = 163/356 (45.79%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 1175
            P F+ + PE  Y+  +K V + C    ++ +   C  +                    ++  N    K++ D++T  V   V  V + ++ + VE  F + ++WCQC  A++   +T     ++K+ ++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C ++
Sbjct:   51 PHFL-LEPEDAYIVKNKPVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDEVTGLV---VREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCMQM 359          

HSP 2 Score: 91.6633 bits (226), Expect = 4.166e-18
Identity = 102/404 (25.25%), Postives = 169/404 (41.83%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKD-IKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTP--SSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+++  +L  +  +G+S     Y                  A KRL +  F   L    +  L  Y   DT D +K+ L  + T  G  + D P  L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  S           KS  P  S T    T +L P +  F++P    +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  548 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADIAT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHILLDQLGTYAFVGES-----YSKS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLVED-PKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENV------KSFDPFCSHTENSVTTQLGPYA--FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 918          
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Match: Unc5a (unc-5 netrin receptor A [Source:MGI Symbol;Acc:MGI:894682])

HSP 1 Score: 155.992 bits (393), Expect = 2.735e-38
Identity = 95/322 (29.50%), Postives = 155/322 (48.14%), Query Frame = 3
Query:  288 VYLKPNKKSDKKQFDKITKSVQGD----VHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVV 1232
            ++ K N +  ++    I +S  G        V + ++ + VE  F +  +WCQC  A++   +T +Q     K +I +AY+ K F+ EP +  + L + + L C PP+G P  ++ W +N   ++ +    + ++ + SLV+    + D   Y CVA+N    R S +A + V       NG W  W  W+ C   C  G           ++RSR C   +       C G ++Q  +CAT C VDG WS WS WS C  DCT  R REC++P P++GG++C  + +  +  NCT D C       P++  +   +V   V
Sbjct:   73 IFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQC-VAWSSSGTTKSQ-----KAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY-----VNGGWSTWTEWSVCSASCGRG----------WQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEEC--RGADLDTRNCTSDLCLHTS-SGPEDVALYIGLVAVAV 370          

HSP 2 Score: 107.071 bits (266), Expect = 4.894e-23
Identity = 99/413 (23.97%), Postives = 175/413 (42.37%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            +++ +TGIS+ + PD     K   + L   K    RL      T LS I+ C     + L +P+IL   HC    S  SW +++ K +    WE  +       S+   YC L+   CY+ T +L  F L+G++ +                      A KRL ++ F        +  +  Y   DT D    ++      G ++   P +L  K+S  N+ +++    +S WK      YQEI F  +WN  T+ ++     LE            + V+Q     D    +++FN T+ +      +  S    +     +     F++P +  +++   LDPP    + W  +A++L + ++L +F  + +PTA +L LWEA++     L  L + +  +G  D A +F
Sbjct:  510 LMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVSCG-PPGVLLTRPVILAMDHCGE-PSPDSWSLRLKKQSCEGSWEDVLHLGEESPSHLY-YCQLEAGACYVFTEQLGRFALVGEALS--------------------VAATKRLRLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWN-GTQQYLHCTFTLERVNASTSDLACKVWVWQ--VEGDGQSFNINFNITKDTRFAEMLALES----EGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLGQLAAAVAGLGQPD-AGLF 891          
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 152.525 bits (384), Expect = 3.384e-37
Identity = 102/339 (30.09%), Postives = 165/339 (48.67%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGF 1361
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W++WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  P +        D+ +YV  V+++ + L I V   +  ++K H  F  +S+ I+S      GGF
Sbjct:  119 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQAAPDS-------DDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDF--ESDIIDSS--ALNGGF 423          

HSP 2 Score: 88.9669 bits (219), Expect = 1.831e-17
Identity = 94/410 (22.93%), Postives = 167/410 (40.73%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTE----PFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P+IL   HC    S   W +++       +WE  +       +    Y  LD E C+++T  L  + L+G+S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F    + L   E + +  +  +      F   ++  +VS   T I   L     P+ST    T         F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  543 LIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQ-TLLTPVVSCGPPGAL-LTRPVILTLHHCAD-PSTEDWKIQLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGQSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIF---QLNCTVSEEPTGIDLPL---LDPASTITTVT-----GPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 917          
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 152.14 bits (383), Expect = 3.925e-37
Identity = 107/351 (30.48%), Postives = 170/351 (48.43%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR--IDPPN----PQNRYVLR------DMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGF 1361
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W++WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  I P +    PQN Y         D+ +YV  V+++ + L I V   +  ++K H  F  +S+ I+S      GGF
Sbjct:   45 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDF--ESDIIDSS--ALNGGF 368          

HSP 2 Score: 88.9669 bits (219), Expect = 1.846e-17
Identity = 94/410 (22.93%), Postives = 167/410 (40.73%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTE----PFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P+IL   HC    S   W +++       +WE  +       +    Y  LD E C+++T  L  + L+G+S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F    + L   E + +  +  +      F   ++  +VS   T I   L     P+ST    T         F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  488 LIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQ-TLLTPVVSCGPPGAL-LTRPVILTLHHCAD-PSTEDWKIQLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGQSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIF---QLNCTVSEEPTGIDLPLLD---PASTITTVT-----GPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 862          
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 152.525 bits (384), Expect = 4.143e-37
Identity = 107/351 (30.48%), Postives = 169/351 (48.15%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR--IDP----PNPQNRYVLR------DMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGF 1361
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W++WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  I P      PQN Y         D+ +YV  V+++ + L I V   +  ++K H  F  +S+ I+S      GGF
Sbjct:  119 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDF--ESDIIDSS--ALNGGF 442          

HSP 2 Score: 88.9669 bits (219), Expect = 2.039e-17
Identity = 94/410 (22.93%), Postives = 167/410 (40.73%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTE----PFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P+IL   HC    S   W +++       +WE  +       +    Y  LD E C+++T  L  + L+G+S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F    + L   E + +  +  +      F   ++  +VS   T I   L     P+ST    T         F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  562 LIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQ-TLLTPVVSCGPPGAL-LTRPVILTLHHCAD-PSTEDWKIQLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGQSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIF---QLNCTVSEEPTGIDLPLLD---PASTITTVT-----GPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 936          
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 152.525 bits (384), Expect = 4.143e-37
Identity = 107/351 (30.48%), Postives = 169/351 (48.15%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR--IDP----PNPQNRYVLR------DMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGF 1361
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W++WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  I P      PQN Y         D+ +YV  V+++ + L I V   +  ++K H  F  +S+ I+S      GGF
Sbjct:  119 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDF--ESDIIDSS--ALNGGF 442          

HSP 2 Score: 88.9669 bits (219), Expect = 2.039e-17
Identity = 94/410 (22.93%), Postives = 167/410 (40.73%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTE----PFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P+IL   HC    S   W +++       +WE  +       +    Y  LD E C+++T  L  + L+G+S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F    + L   E + +  +  +      F   ++  +VS   T I   L     P+ST    T         F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  562 LIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQ-TLLTPVVSCGPPGAL-LTRPVILTLHHCAD-PSTEDWKIQLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGQSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIF---QLNCTVSEEPTGIDLPLLD---PASTITTVT-----GPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 936          
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Match: sp|C5IAW9|UN5BB_XENLA (Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 GN=unc5b-b PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.462e-40
Identity = 106/369 (28.73%), Postives = 168/369 (45.53%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRD 1214
            P F+ + PE  Y+  +KAV + C    ++ +   C  +                    ++  N    K++ D +T  V   V  V + ++ + VE  F + +FWCQC  A++   +T     ++K++++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C        QN+ VL +
Sbjct:   51 PHFL-LEPEDAYIVKNKAVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDDVTGLV---VREVQIEVSRQQVEELFGLEDFWCQC-VAWSSAGTT-----KSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDSTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCM-------QNKRVLGE 365          

HSP 2 Score: 91.2781 bits (225), Expect = 3.129e-17
Identity = 93/401 (23.19%), Postives = 163/401 (40.65%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+++  +L  +  +G+S     Y                  A KRL +  F   L    +  L  Y   DT D    ++      G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++  S           KS  P  ++ + +         F++P +  +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  558 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADITT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHILLDQLGTYAFVGES-----YSRS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLIEEPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHVWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENV------KSFDPFCSHAENSVTTQLGPYAFKIPFLIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 928          
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Match: sp|Q8JGT4|UN5BA_XENLA (Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 GN=unc5b-a PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.050e-38
Identity = 103/369 (27.91%), Postives = 167/369 (45.26%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRD 1214
            P F+ + PE  Y+  +K V + C    ++ +   C  +                    ++  N    K++ D +T  V   V  V + ++ + VE  F + ++WCQC  A++   +T     ++K++++ +AY+ K F  EP    + L +   L C PP+G P  ++ W KN   ++ T  +  L++ D +L+I    ++D   Y CV++N    R S  A + V       NG W  W  W+ C N C +G           ++R+R C   +       C G   Q  +C T C VDG W+ WS WS C  +CT  R RECN P P++GG  C       + +NCT   C        QN+ VL +
Sbjct:   51 PHFL-LEPEDAYIVKNKPVELVCKANPATQIYFKCNGE--------------------WVNQNDHITKERVDDVTGLV---VREVQIEVSRQQVEELFGLEDYWCQC-VAWSSAGTT-----KSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVSKNIVAKRRSTTATVIVF-----VNGGWSSWTEWSPCNNRCGHG----------WQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACSTECTHWRSRECNAPTPKNGGKDC--SGMLLDSKNCTDGLCM-------QNKRVLGE 365          

HSP 2 Score: 87.8113 bits (216), Expect = 3.568e-16
Identity = 96/403 (23.82%), Postives = 162/403 (40.20%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTP--SSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TG+S+ +        K   M L  +K  +  L      T LS II C     + L KP+IL  PHC    + S W +++   ++   WE  +   N +  N   YC L+   C+ +  +L  +  +G+     SY                  A KRL +  F   L    +  L  Y   DT D    ++      G  + + P +L  K+S  N+ +++     S W+     +YQEI F  +W+  ++  +     LE            I V Q        ++              KS  P  S      T  L P +  F++P    +++   LD P    + W ++A++L +   L YF  +++PT  +L LWEA ++++  L  L S L+ +G
Sbjct:  559 NTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCG-PTGLLLCKPVILTVPHCADINT-SDWILQLKTQSHQGNWEEVVTL-NEETLNTPCYCQLESHSCHTLLDQLGTYAFVGE-----SYSRS---------------AIKRLQLAIFAPMLCTSLEYNLKVYCVEDTPDALKEVLELEKTLGGYLVEEPKLLMFKDSYHNLRLSIHDIPHSLWRSKLMAKYQEIPFYHIWS-GSQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTLLEENV------KSFDPFCSQAENSVTTHLGPYA--FKIPFSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMG 929          
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Match: sp|Q761X5|UNC5C_RAT (Netrin receptor UNC5C OS=Rattus norvegicus OX=10116 GN=Unc5c PE=1 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.350e-37
Identity = 104/339 (30.68%), Postives = 166/339 (48.97%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYV--VLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGF 1361
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  WA W+ C + C  G           ++R+R C   +       C G S+Q  +C T C VDG W++WS WS C  +CT  R REC  P P++GG  C       + +NCT   C +  P +        D+ +YV  V+++ + L I V   +  ++K H  F  +SN I+S      GGF
Sbjct:  119 VREVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPMAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWAEWSVCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--DGLVLQSKNCTDGLCMQAAPDS-------DDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDF--ESNIIDSS--ALNGGF 423          

HSP 2 Score: 87.8113 bits (216), Expect = 3.113e-16
Identity = 93/410 (22.68%), Postives = 167/410 (40.73%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTE----PFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P+IL   HC    +   W +++       +WE  +       +    Y  LD E C+++T  L  + L+G+S    +         + +  L +F     LC  S         +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   + S WK     +YQEI F  +W+         F    + L   E + +  +  +      F   ++  +VS   T I   L     P+ST    T         F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  543 LIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQ-TLLTPVVSCGPPGAL-LTRPVILTLHHCAD-PNTEDWKIQLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVGQSTTKAA---------AKRLKLAIF---GPLCCSSL--------EYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDITHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIF---QLNCTVSEEPTGIDLPL---LDPASTITTVT-----GPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 917          
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Match: sp|Q8K1S4|UNC5A_MOUSE (Netrin receptor UNC5A OS=Mus musculus OX=10090 GN=Unc5a PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.913e-37
Identity = 95/322 (29.50%), Postives = 155/322 (48.14%), Query Frame = 3
Query:  288 VYLKPNKKSDKKQFDKITKSVQGD----VHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVV 1232
            ++ K N +  ++    I +S  G        V + ++ + VE  F +  +WCQC  A++   +T +Q     K +I +AY+ K F+ EP +  + L + + L C PP+G P  ++ W +N   ++ +    + ++ + SLV+    + D   Y CVA+N    R S +A + V       NG W  W  W+ C   C  G           ++RSR C   +       C G ++Q  +CAT C VDG WS WS WS C  DCT  R REC++P P++GG++C  + +  +  NCT D C       P++  +   +V   V
Sbjct:   73 IFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQC-VAWSSSGTTKSQ-----KAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY-----VNGGWSTWTEWSVCSASCGRG----------WQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEEC--RGADLDTRNCTSDLCLHTS-SGPEDVALYIGLVAVAV 370          

HSP 2 Score: 107.071 bits (266), Expect = 3.423e-22
Identity = 99/413 (23.97%), Postives = 175/413 (42.37%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            +++ +TGIS+ + PD     K   + L   K    RL      T LS I+ C     + L +P+IL   HC    S  SW +++ K +    WE  +       S+   YC L+   CY+ T +L  F L+G++ +                      A KRL ++ F        +  +  Y   DT D    ++      G ++   P +L  K+S  N+ +++    +S WK      YQEI F  +WN  T+ ++     LE            + V+Q     D    +++FN T+ +      +  S    +     +     F++P +  +++   LDPP    + W  +A++L + ++L +F  + +PTA +L LWEA++     L  L + +  +G  D A +F
Sbjct:  510 LMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVSCG-PPGVLLTRPVILAMDHCGE-PSPDSWSLRLKKQSCEGSWEDVLHLGEESPSHLY-YCQLEAGACYVFTEQLGRFALVGEALS--------------------VAATKRLRLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWN-GTQQYLHCTFTLERVNASTSDLACKVWVWQ--VEGDGQSFNINFNITKDTRFAEMLALES----EGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLGQLAAAVAGLGQPD-AGLF 891          
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Match: sp|Q7T2Z5|UNC5C_CHICK (Netrin receptor UNC5C OS=Gallus gallus OX=9031 GN=UNC5C PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.012e-37
Identity = 86/277 (31.05%), Postives = 139/277 (50.18%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            V  V++ ++ + VE  F   ++WCQC  A++   +T     +++K ++ +AY+ KTF+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+AC + C  G           ++R+R C   +       C G ++Q  +C T C VDG+W++WS WS C  +CT  R REC  P P++GG  C  +    + +NCT   C +  P
Sbjct:  119 VCEVSIEISRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEEVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVY-----VNGGWSTWTEWSACNSRCGRG----------FQKRTRTCTNPAPLNGGAFCEGQNVQKIACTTLCPVDGKWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDC--EGLVLQSKNCTDGLCMQAAP 372          

HSP 2 Score: 87.4261 bits (215), Expect = 4.532e-16
Identity = 94/415 (22.65%), Postives = 164/415 (39.52%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWN---------FRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +++ ++G+S+ +        +   M   ++ K      +E S+ T L+ ++ C     + L +P++L   HC    +   W +++        WE  +       +    Y  LD E C+++T  L  + L+G+S                        A KRL +  F        +  +  Y   DT+D    ++      G ++ + P  L  K S  N+ +++   A + WK     +YQEI F  +W+         F  E F    + L     + Q   G   ++Q N        SVS   T I   +  S+   +T        I     F +P    ++L   LD P+     W M+A +L +   L YF  +S+PT  +L LWEAQN  +  L  L + L+ +G
Sbjct:  543 LVIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKEGMRPPVEDSQ-TLLTPVVSCGPPGAL-LTRPVVLTMHHCAE-PNMDDWQIQLKHQAGQGPWEDVVVVGEENFTTP-CYIQLDPEACHILTETLSTYALVGQSITKA--------------------AAKRLKLAIFGPLSCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKTLHFKGSTHNLRLSIHDIAHSLWKSKLPAKYQEIPFYHIWSGCQRNLHCTFTLERFSLNTLELVCKLCVRQ-VEGEGQIFQLN-------CSVSEEPTGIDYPIMDSAGSITT--------IVGPNAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMG 917          
BLAST of Netrin receptor UNC5C vs. TrEMBL
Match: A0A4D6FZQ1 (ZU5 domain-containing protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 3.089e-168
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = 3
Query: 1542 TVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAG 2387
            TVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISL PIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAG
Sbjct:    1 TVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLXPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAG 282          
BLAST of Netrin receptor UNC5C vs. TrEMBL
Match: A0A3Q3AVK7 (Unc-5 netrin receptor B OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.029e-59
Identity = 231/921 (25.08%), Postives = 377/921 (40.93%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDN----NSESVTTYXXXXXXXXXPLINEANMKHDSSNST-ICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKD-IKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTL-NKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            ++  N    ++  D+IT  V   V  V ++++   VE  F + ++WCQC A  +  ++ SN      + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   +  +  S  L++ D  L++    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G  +Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R  PP      V   +VV ++LSI + L + V             +  +   ++  I             GN     +DN    +S +     + +G    PL +      DS +   + TS  +D L ++ + + N              S     +ELP    L +   L  + + T         +      G  ++  + + GGR+ + +TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT   +KD L  + +  G  + D P  L  K+S  N+ +++     T W+     +YQEI F  +W+    P       LE +          I V Q        ++      T+I  TL   S  PS +    + ++ P +  FRLP    +++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:   90 WVNQNDHITRESLDQITGLV---VREVEISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSN------RAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVINPSQDSNFLITIDHDLIVKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPINGGKHC--SGSMMESKNCTEGLCARTIPPG-MGVAVYTGLVVALLLSIIMALCVGV-----------LAYRRRCRHLHGDITDSSSALTAAFHPGNYKPPRQDNPHPLHSSAPPDLTATAGTFRGPLFSLPQGVSDSPHKIPMTTSPLLDPLPSLKIKVYN--------------SSTLSSLELPADMSLGDGEILSLKSVGTVGRERDFHSHTLSREPGLSTSATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCG-PSGMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGAWEEVLTVGEETLSSP-CYLQLEEECCHVLMEQLGTYGLVGQSCPPRPACKRLQLAL---------FAPRAPCL---------SLDYSLRIYCIHDTPHALKDVLDLERSLGGVLLED-PKPLLFKDSYHNLRLSIHDIPHTYWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERASLAVSQLACKICVRQVEGEGQIFQL-----HTDIQETLPPHSPLPSGSSCLPSSQVGPYA--FRLPDSIRQKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 929          
BLAST of Netrin receptor UNC5C vs. TrEMBL
Match: A0A3P8TET5 (Unc-5 netrin receptor B OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.620e-58
Identity = 227/923 (24.59%), Postives = 373/923 (40.41%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDN----NSESVTTYXXXXXXXXXPLINEANMKHDSSNST-ICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC A  +  ++ SN      + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ +  S  L++ D  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G  +Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R   P      V   +VV ++LS+ + L + V             +  +   ++  I             GN     +DN    +  +     + +G    PL +     +DS +   + TS  +D L ++ + + N              S     +ELP    +++   L  + + T         +      G  ++  + N GGR+ + +TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL     P S      C L P+S+     FRLP     ++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:   61 WVNQNDHITRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSN------RAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSQDSNFLITIDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPINGGKHC--SGSMMESKNCTEGLCARTLAPG-MGVAVYTGLVVALLLSVIMVLCVGV-----------LAYRRRCRHLHGDITDSSSALTAAFHPGNYKPPRQDNPHPLHPSAPPDLTATAGAFRGPLFSLQQGVNDSPHKIPMTTSPLLDPLPSLKIKVYN--------------SSTLSSLELPADMCISDGEILSLKSVGTVGRDREYPSHTLSREPGLSTSATLGNLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCG-PSGMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGAWEEVLTVGEETLSSP-CYLQLEEECCHVLMEQLGTYGLVGQSCPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRIYCIHDTPHALKEVLDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLTCKICVRQVEGEGQIFQL-----LTDIQETL----PPHSPLPSGGCCL-PSSQVGPYAFRLPDSIRHKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 900          
BLAST of Netrin receptor UNC5C vs. TrEMBL
Match: A0A3B4T615 (Unc-5 netrin receptor B OS=Seriola dumerili OX=41447 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.983e-58
Identity = 226/923 (24.49%), Postives = 370/923 (40.09%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDN----NSESVTTYXXXXXXXXXPLINEANMKHDSSNST-ICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC A  +  ++ SN      + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ +  S  L++ D  L+I    + D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R   P      V   +VV ++L            + LC       +  +   ++  I             GN     +DN    +  +     + +G    PL +  +  +DS +   + TS  +D L ++ + + N              S     +ELP   +  +   L  + + T         +      G  ++  + N GGR+ + +TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     T W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL   S   S     TC  +P+S+     FRLP    +++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  109 WVNQNDHITRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSN------RAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSQDSNFLITIDHDLIIKQARLLDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSQCNAQCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPMNGGKHC--SGSMMESKNCTEGLCTRTLAPG-MGVAVYAGLVVALLLC---------VILALCVGG--LAYRRRRRHLHGDITDSSSALTTAFHPGNYKPPRQDNPHPLHPSAPPDLTATAGAFRGPLFSLQHGVNDSPHKIPMTTSPLLDPLPSLKIKVYN--------------SSTLSSLELPADMVSGDGEILSLKSVGTVGREREYHSHTLSREPGLSTSATLGNLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCG-PSGMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGAWEEVLTVGEETLSSP-CYLQLEEECCHVLMEQLGTYGLVGQSCPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRIYCIHDTPHALKEVLDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHTHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLTCKICVRQVEGEGQIFQL-----HTDIQETLPPHSPLPS---GGTC--LPSSQVGPYAFRLPDSIRQKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 948          
BLAST of Netrin receptor UNC5C vs. TrEMBL
Match: A0A3Q1AJ02 (Unc-5 netrin receptor B OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.006e-57
Identity = 226/923 (24.49%), Postives = 374/923 (40.52%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDN----NSESVTTYXXXXXXXXXPLINEANMKHDSSNST-ICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC A  +  ++ SN      + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ +  S  L++ D  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G  +Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R   P      V   +VV ++LS+ + L + V             +  +   ++  I             GN     +DN    +  +     + +G    PL +     +DS +   + TS  +D L ++ + + N              S     +ELP    +++   L  + + T         +      G  ++  + N GGR+ + +TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL   S   S     +C  +P+S+     FRLP     ++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:   61 WVNQNDHITRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSN------RAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSQDSNFLITIDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPINGGKHC--SGSMMESKNCTEGLCARTLAPG-MGVAVYTGLVVALLLSVIMVLCVGV-----------LAYRRRCRHLHGDITDSSSALTAAFHPGNYKPPRQDNPHPLHPSAPPDLTATAGAFRGPLFSLQQGVNDSPHKIPMTTSPLLDPLPSLKIKVYN--------------SSTLSSLELPADMCISDGEILSLKSVGTVGRDREYPSHTLSREPGLSTSATLGNLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCG-PSGMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGAWEEVLTVGEETLSSP-CYLQLEEECCHVLMEQLGTYGLVGQSCPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRIYCIHDTPHALKEVLDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLTCKICVRQVEGEGQIFQL-----LTDIQETLPPHSPLPS---GGSC--LPSSQVGPYAFRLPDSIRHKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 900          
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 159.844 bits (403), Expect = 1.753e-39
Identity = 101/321 (31.46%), Postives = 150/321 (46.73%), Query Frame = 3
Query:  288 VYLKPNKK---SDKKQFDKITKSVQG-DVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYV 1229
            +Y K N +    D    ++      G  V  V + ++ + VE  F + ++WCQC A     S+T  Q  +++K ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W++N   ++        ++ D +L+I    + D G Y CVA+N    R S +A + V       NG W  WA W+AC   C  G           ++RSR C   +       C G S+QT +C   C VDG WS WS WS C  DCT  R REC  P P +GG  C  +    +  NCT + C       PQ      D+ +YV
Sbjct:   71 IYFKCNGEWVHQDDHLIERTVDPATGLPVMQVKIDISRQQVEKIFGLEDYWCQCVAW----STTGTQ--KSQKAYVRIAYLRKNFEEEPLGKEVALDQEVLLRCHPPEGVPTAEVEWQRNEELIDPKADPNFFITVDHNLIIKQARLADTGNYTCVAKNIVARRKSSSAAVIVY-----VNGGWSTWATWSACSAVCGRG----------WQKRSRSCTNPAPLNGGTACEGQSVQTSACTATCPVDGGWSEWSKWSACGTDCTMWRSRECTQPAPGTGGKSC--QGLDLQSLNCTSEQC-------PQTVSGAEDVALYV 361          

HSP 2 Score: 96.6709 bits (239), Expect = 6.166e-20
Identity = 88/405 (21.73%), Postives = 173/405 (42.72%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISMELYSKHTHE-RLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            + L +TGIS+ + P+     K   + L  +   + RL      T +S +I C     + L +P+I+   HC       +W +++ K +    WE  +     ++ ++  YC L+ E C + T +L  F L+G+S +                      A KRL ++ F        +  +  Y   DT+D+   ++      G R+ D PH+L  K+S  N+ +++       W+      YQEI F  +W+  ++ ++     LE            + V+Q     +    S+ FN ++ +  L+          D +   +     F++P +  +++   LD P    + W ++A++L +  ++ +F  +++PT+ +L LWE Q+     L  L + +  IG
Sbjct:  507 LTLPNTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLMSPVISCG-PPGVVLTRPVIISMDHCSD-ACPENWAIRLKKQSYEGTWEDVL-LLGEELVSEPYYCQLEAETCRVFTEQLGRFALVGESLS--------------------MAAAKRLKLLLFAPAYCSTLEYTIRVYCTDDTQDLIKEVMQMEAQLGGRLIDEPHVLLFKDSYHNLRLSIHDLPQAHWRSKLLTGYQEIPFYHIWS-GSQRYLHCTFTLERLSVSTCELSCTLCVWQ--VEGEGQSFSLDFNISKDNRPLDSDFL----LVDNSTPALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLERHMSFFASKASPTSVILDLWEVQHFHSGNLNQLAAVMAEIG 881          
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 159.073 bits (401), Expect = 2.647e-39
Identity = 105/390 (26.92%), Postives = 170/390 (43.59%), Query Frame = 3
Query:   48 FINLVFICSQDI--IENSSIQQILKPIFVKMP----------PEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
             + LV +C   +   + S   ++L   F   P          PE  ++  ++ V + C    ++ +   C  +                    ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ T  S  L++ D  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C+   S  E +NCT   C R
Sbjct:   15 LLALVLVCGSFVYGADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGE--------------------WVNQNDHVTRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCI--GSIMESKNCTEGLCAR 358          

HSP 2 Score: 95.9005 bits (237), Expect = 1.112e-19
Identity = 99/412 (24.03%), Postives = 162/412 (39.32%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P+IL  PHC   +    W +  +K   N  WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL     P  +   A    +P+S+     FRLP    +++   LD P      W ++A  LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  556 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGML-LSRPVILTLPHCAQLEP-PDWSL-TLKTQTNQAWEEVLTVGEESLSSP-CYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIHDTPHALKEVLELERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLSCKICVRQVEGEGQIFQLH-----TDIQETL-----PPHSPLPAGGTCLPSSQVGPYAFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 934          
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 158.688 bits (400), Expect = 3.165e-39
Identity = 105/390 (26.92%), Postives = 170/390 (43.59%), Query Frame = 3
Query:   48 FINLVFICSQDI--IENSSIQQILKPIFVKMP----------PEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
             + LV +C   +   + S   ++L   F   P          PE  ++  ++ V + C    ++ +   C  +                    ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ T  S  L++ D  L+I    ++D   Y CVA N    R S  A L V       +G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C+   S  E +NCT   C R
Sbjct:   15 LLALVLVCGSFVYGADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVKNRPVKLSCKAAPATQIYFKCNGE--------------------WVNQNDHVTRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCI--GSIMESKNCTEGLCAR 358          

HSP 2 Score: 96.2857 bits (238), Expect = 9.606e-20
Identity = 99/412 (24.03%), Postives = 162/412 (39.32%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P+IL  PHC   +    W +  +K   N  WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL     P  +   A    +P+S+     FRLP    +++   LD P      W ++A  LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  545 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGML-LSRPVILTLPHCAQLEP-PDWSL-TLKTQTNQAWEEVLTVGEESLSSP-CYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIHDTPHALKEVLELERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLSCKICVRQVEGEGQIFQLH-----TDIQETL-----PPHSPLPAGGTCLPSSQVGPYAFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 923          
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 156.762 bits (395), Expect = 1.074e-38
Identity = 93/297 (31.31%), Postives = 143/297 (48.15%), Query Frame = 3
Query:  291 YLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++++ ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ T  S  L++ D  L+I    ++D   Y CVA N    R S  A L V  +     G W  W  W+ C   C  G           +RR+R C   +       C G   Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P++GG  C+   S  E +NCT   C R
Sbjct:   63 WVNQNDHVTRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVS-----GGWSSWTEWSECNARCGRG----------WQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPPPRNGGRHCI--GSIMESKNCTEGLCAR 333          

HSP 2 Score: 67.781 bits (164), Expect = 5.429e-11
Identity = 82/362 (22.65%), Postives = 135/362 (37.29%), Query Frame = 3
Query: 1797 TGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGI 2864
            TG+S+ V P T    K   M L  +K     L      T LS ++ C     + L +P+IL  PHC   +    W +  +K   N  WE  +      +S+   Y  ++E+ C+++  +L  + L+G+S  P     +    L          A +  C+              L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE            I V Q        ++      T+I  TL     P  +   A    +P+S+     FRLP    +++   LD P      W ++A  LG 
Sbjct:  522 TGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGML-LSRPVILTLPHCAQLEP-PDWSL-TLKTQTNQAWEEVLTVGEESLSSP-CYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLAL---------FAPRAPCL---------SLDYSLRVYCIHDTPHALKEVLELERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERGSLAVSQLSCKICVRQVEGEGQIFQLH-----TDIQETL-----PPHSPLPAGGTCLPSSQVGPYAFRLPASIRQKICASLDAPSARGCDWRLLAHSLGF 850          
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Match: unc5c (unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-030131-9196])

HSP 1 Score: 153.68 bits (387), Expect = 1.263e-37
Identity = 99/353 (28.05%), Postives = 161/353 (45.61%), Query Frame = 3
Query:  132 MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            M PE  Y+  +K V + C    ++ +   C            +  + Q + TV         +++ D+ +  V   V   ++ +T + VE  F + +FWCQC  A++   +T     +++K  + +AY+ KTF  EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+AC + C  G           ++R+R C   +       C G  +Q  +C   C VDG W+ WS WS C  +CT  R REC+ P P++GG  C  +    + +NCT   C +  P
Sbjct:   62 MEPEEAYIVKNKPVNLYCKATPATQIYFKC-----------NSEWVHQKEHTV---------EERVDETSGLV---VREASIEITRQQVEELFGLEDFWCQC-VAWSSAGTT-----KSRKAHVRIAYLRKTFDQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVY-----VNGGWSTWTEWSACNSRCGRG----------FQKRTRSCTNPAPLNGGAICEGQPIQKLACNPLCPVDGLWTEWSKWSTCGTECTHWRRRECSAPAPKNGGKDC--EGMVLQSKNCTDGLCMQTAP 368          

HSP 2 Score: 98.9821 bits (245), Expect = 1.168e-20
Identity = 93/418 (22.25%), Postives = 172/418 (41.15%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISM--ELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESA-STSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATC----KLIPASK--------TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +I+ ++G+S+ V        +   M   ++ K T    ++ ++ T LS ++ C     + L +P+I+   HC    S   W +++   +   +WE  +       +    Y  +DEE C+++T  L  +CL+G+S +  +                     KRL +  F        +  +  Y   DT+D    ++      G ++ D P  L+ K+S  N+ +++     T WK     +YQE+ F+ +W+        RN+              H T     F    +E+       ++          ++  +D+ C     L PAS          FR+P    ++L   LD P+   + W M+A +L +   L YF  +S+PT  +L LWEAQ+  +  L  L + L+ +G
Sbjct:  540 LIVPNSGVSLLVPAGAIPQGRVYEMYVTVHRKETMRPSVDDTQ-TVLSPVVSCGPPGAL-LTRPVIITMHHCAEADS-EDWLIQLRSQSQQGQWEDVVVVGEENFTTP-CYIQMDEEACHILTETLGTYCLVGQSVSAAT--------------------TKRLKLAVFGPVTCTALEYNIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLNFKDSTHNLRLSLHDVPHTLWKSKLLAKYQELSFQHVWSGSQ-----RNL--------------HCTFTLERFSAGTLELGCKLCVRQVEGEGQIFQLNTTLSEDSQCIDTSLLDPASNITTLVGPNAFRIPLSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLNRLAAVLEEMG 914          
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010609.1 (pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1 gene:ENSPMAG00000009605.1 transcript:ENSPMAT00000010609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 2.725e-37
Identity = 95/348 (27.30%), Postives = 151/348 (43.39%), Query Frame = 3
Query:  138 PEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCK--TSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            PE  Y+  +K V + C    ++ +   C               L Q    +             +++ ++    V  V   ++ + VE  F + ++WCQC A     +S      +++K ++ +AY+ K F+ EP    + L   V L C PPD  P+ ++ W KN   ++        ++ D +L+I  T + D+  Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   T       C G  ++   C++ C VDG W  WS WS C PDCT  R REC+NP P +GG  C    S  + +NC+   C +
Sbjct:   64 PEDAYIVRNKPVTMSCAASPATQIYFKC-----------NGEWLHQKAHHIE------------ERVDETTGRSVREVQTDVSRQQVEELFGLEDYWCQCVAWSAAGTS------KSRKAYVRIAYLRKNFEQEPLGKDVLLDHEVLLHCRPPDAIPQAEVEWLKNEEIIDPVIDQNFYITVDHNLIIKQTRLADSANYTCVAKNLVAKRRSSTATITVY-----VNGGWSQWTEWSPCNSKCGRGT----------QKRTRSCSNPTPLNGGAVCDGQGVEKMPCSSLCPVDGGWVEWSKWSTCGPDCTHWRSRECSNPAPVNGGKDC--HGSPLQSQNCSDALCLQ 365          

HSP 2 Score: 95.9005 bits (237), Expect = 2.399e-20
Identity = 89/406 (21.92%), Postives = 168/406 (41.38%), Query Frame = 3
Query: 1782 VILGSTGISVTVMPDTFGSEKTISMEL-YSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGI-SNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +++ ++G+S+ V P    S +   M L   +   +R +     T LS ++ C    ++ L  P+IL   HC    S   W + + +  ++  WE  +            +  L+E  C+++T     + +LG++  P                     A KRL + +F   +    +  L  Y   D  +    ++      G R+ + P  LS K ++ N+ +++ +     W     + +QEI F  +W    +  +     LE +      F   + V Q       +++      T + N  + +    +    A   L+   + F+LP    ++L   LD P    + W ++A +LGI S ++EYF  + +PT  +L LWEAQ+ E+  L  L S L+ +G
Sbjct:  588 LVIPNSGLSLLVPPGAIPSGQFYQMYLTVHRDEDKRPVLEGSQTLLSPVVSCG-PPSVPLLSPVILSLRHCAELNS-EDWALGLKRQLDSGHWEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEALGPA--------------------AVKRLRLAAFAPSVCPSLEYSLRLYCLNDDAESLAEVVELEKQLGGRLLEEPTTLSFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPG-CQRLLHCTFALERAGLSSTEFSCKLCVQQLEGEGQVLQLR-----TTLLNAPSATDDSPTEAASAGSALV-GPQAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINSASMEYFETRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMG 964          
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 2.611e-36
Identity = 98/355 (27.61%), Postives = 162/355 (45.63%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVES-WFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            PIF+  P +  ++  +K V ++C    ++ +   C  +                    +L       ++   +IT  V  +VH+    ++ + VE  + + +FWCQC  A++   +T     +++K F++VA++ K F+ EP    + L   V L C PP+  P  ++ W K+   ++  + S   ++ D +L+I    ++D+  Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   +       C G   Q   C+T C VDG W  WS WS C PDCT  R REC+NP P +GG  C    S  + +NC+   C +
Sbjct:   11 PIFLTEPNDG-FIVQNKPVTLDCSASPATQIYFKCNGE--------------------WLHQKALYTQEHLSEITGKVVREVHT---NVSRQQVEDPYRLEDFWCQC-VAWSASGTT-----KSRKAFVKVAHLRKNFEQEPLGKDVPLNHEVLLHCRPPEAIPPAEVEWMKDKELIDPEEDSNFYITVDHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVY-----VNGGWSLWTEWSPCNSKCGRGT----------QKRTRSCTNPAPLNGGAVCNGQGTQKIPCSTICPVDGGWVEWSKWSTCGPDCTHWRSRECSNPAPVNGGKDC--HGSPLQSQNCSDALCIQ 318          

HSP 2 Score: 63.929 bits (154), Expect = 1.501e-10
Identity = 87/408 (21.32%), Postives = 160/408 (39.22%), Query Frame = 3
Query: 1788 LGSTGISVTVMPDTF--GSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLM--TFELFPFCLLGKSQNPLSYD--NKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVES-ASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +  +G+S+ V P     G    + + ++ +      +E S+ T LS ++ C    ++ L  P+IL   HC    S   W + + +  ++  WE  +  +  +   +   CH       +   T  L  FC    S   +     ++D F        P      R+C        HQ        Y    T D    ++      G R+ + P  L+ K ++ N+ +++ +     W     + +QEI F  +W    +  +     LE +      F   + V Q       +++      T + N  + +    +    A   L+   + F+LP    ++L   LD P    + W ++A +LGI+    YF  + +PT  +L LWEAQ+ E+  L  L S L+ +G
Sbjct:  525 IAHSGVSLLVPPGAIPPGQFYQMYITIHREKEKRPALENSQ-TLLSPVVSCG-APSVPLLSPVILSLRHCAEL-SPEDWALSLKRQLSSGPWEEVL--RQGEEPARPPSCHWQRVSVSVTSTTAHLVSFCYYCSSFMSVCGRVCHQDYFS-------PCLCVCGRVC--------HQY-------YCSSSTHDQFKEVVELEKQLGGRLLEEPTTLNFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPG-CQRLLHCTFALERASLSSTEFSCKLCVQQLEGEGQVLQLR-----TTLLNAPSATDDSPTEAASAGSALV-GPQAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINRYGNYFEMRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMG 898          
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003861.1 (pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 gene:ENSPMAG00000003466.1 transcript:ENSPMAT00000003861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 2.447e-34
Identity = 96/331 (29.00%), Postives = 150/331 (45.32%), Query Frame = 3
Query:  204 FLQINCVEDQDTI-SKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSV-QG---DVHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            FLQ   +ED   + +K  T S        +Y K N +   +Q   + +   QG    V  V   ++ + VE ++    +WCQC A     +S      +++K ++ +AY+ K F++EP       G+ ++L C PPD  P  ++ W KN   ++  + S   ++ D +L+I    ++D+  Y CVA+N    R S  A + V        G W  W  W  C + C  G           ++R R C   +       C G + +   C + C VDG W  WS WS C PDCT  R REC+NP P +GG  C    S  + +NC+   C +
Sbjct:   39 FLQE--LEDAYIVRNKPVTMSCAASPATQIYFKCNAEWVSQQAHHVQQRTDQGTGRSVREVQTDVSRQQVEVYYGPEPYWCQCVAWSAAGTS------KSRKAYVRIAYLHKNFEMEPQGKEEPQGQKIQLHCRPPDAVPPAEVEWLKNEMLIDPEEDSNFHITADHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVY-----VEGGWSLWNEWAPCNSKCGRGT----------QKRIRTCTNPAPLNGGPFCDGQASENTPCTSACPVDGGWVEWSKWSTCGPDCTHWRSRECSNPAPVNGGKDC--HGSPLQSQNCSDALCIQ 344          
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 72.4034 bits (176), Expect = 4.844e-13
Identity = 46/143 (32.17%), Postives = 66/143 (46.15%), Query Frame = 3
Query:  768 SKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESCATF-CRVDGEWSTWSGWSLCQPDCT---RKRIRECNNPKPQSGGDQCLPKNSFSE---KENCTLDSCF 1169
             +  +L+  D    ++G W  W+PW++C   C  G          +  R RLC +        +C GS  + + C    C VDG++  WS WS C   C    R+R R CNNPKPQ  G  CL  +  +E   K+ C +D C 
Sbjct:  416 GRTCQLKACDKRVRQDGGWSFWSPWSSCSVTCGAG----------VNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEPCPVDGQYGPWSPWSACPVTCGGALRERARLCNNPKPQYNGKDCLGSDRETEICNKKPCPVDGCL 548          

HSP 2 Score: 64.6994 bits (156), Expect = 8.815e-11
Identity = 42/123 (34.15%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  822 WLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQT-----ESCATFCRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            W PW+ W  C   C  G           ++R R C + +     C G S+Q      ++C    R DG WS WS WS C   C      RIR CN+P PQ GGD+C    S  E + C ++ C
Sbjct:  378 WSPWSEWTECSVTCGSG----------TQQRGRSCDSVNN---PCEGPSIQGRTCQLKACDKRVRQDGGWSFWSPWSSCSVTCGAGVNTRIRLCNSPVPQMGGDEC--DGSGRENQKCEMEPC 485          
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 5.028e-11
Identity = 47/151 (31.13%), Postives = 60/151 (39.74%), Query Frame = 3
Query:  684 GSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESCATF-CRVDGEWSTWSGWSLCQPDC----TRKRIRECNNPKPQSGGDQC 1115
            G  V    S    G  +C  EN       +AA+   +D D   +G W  W+PW  C   C  G          ++RR R C     + +   C G   +   C T  C  DG WS WS W+ C   C     R R R C+ P P  GGD C
Sbjct:  908 GGSVYLPRSPIQIGCTKCTCEN------GEAARCVSVDCDV--DGAWSDWSPWTPCSAPCGLG----------VQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYC 1040          

HSP 2 Score: 55.8398 bits (133), Expect = 6.162e-8
Identity = 42/140 (30.00%), Postives = 58/140 (41.43%), Query Frame = 3
Query:  813 NGDWLPWAPWNACPNDC---TYGKYCVDSCIKYLRRRSRLCKTSSKDRV-KCPGSSLQTESCA--TFCRVDGEWSTWSGWSLCQPDCTRK--RIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVL 1208
            +G W  W+PW  C   C   T  +Y   +C    R     C  + +    +  G  L+ + C    FC  DG W  WS WS C         R RECN+P P+ GG +C   ++ S        SC    P  P+ + VL
Sbjct: 1157 DGGWCEWSPWTPCSRTCGSETASRYRTCAC-PLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAGGAAVRTRECNSPTPRFGGAECEGNSTVSRPCQGDPSSC----PDCPEGQVVL 1291          

HSP 3 Score: 55.4546 bits (132), Expect = 8.006e-8
Identity = 33/114 (28.95%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  795 DTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCP---GSSLQTESCAT-FCRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQC 1115
            D D + +  W  W  W+ C   C  G+          ++R R       +   CP     + +   C T  C+VDG WS+WS W+ C   C      R+R C NP  ++GG  C
Sbjct: 1712 DGDCSVDCSWNAWTAWSTCSRPCGVGQ----------QQRMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPC 1815          

HSP 4 Score: 53.5286 bits (127), Expect = 2.700e-7
Identity = 36/130 (27.69%), Postives = 52/130 (40.00%), Query Frame = 3
Query:  828 PWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESC-ATFCRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYV 1205
            PW  W+ C   C  G           R+R  L +  +     C  + + + +C    C V+G+W  WS WS C   C    R R R C+ P P++GG  C       + E C +  C R     P   +V
Sbjct:  254 PWTEWSQCSRSCGLGVM--------FRQRDVLREEQTGG--SCNRTLMGSRACFMQACPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRAC--AGDGVQPERCNVRPCARPSDCGPDMVFV 371          
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Match: EDO33294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL1])

HSP 1 Score: 78.1814 bits (191), Expect = 7.096e-16
Identity = 65/220 (29.55%), Postives = 86/220 (39.09%), Query Frame = 3
Query:  525 FKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESC-ATFCRVDGEWSTWSGWSLCQPDCT---RKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            F   P    + LG  +   C    G P P + W+KNG+         I +  + SL+I      D G Y+C A   +   +S A +  ++       G W  W  W  C   C  G          LR R R C     +     CPGS+   E C A  C V G WS W  W+ C   C    R R R C+NP P  GG  C   N   ++E C+   C
Sbjct:    1 FTRTPQDTAIDLGSVLLWHCTA-TGYPTPVLTWQKNGQGFNPWWPPHIRILANNSLLINGVKREDAGSYQCRATINS---LSNAIQAVLI---VRVPGGWSAWQSWTPCTQSCGTG----------LRYRYRACDNPFPAHGGATCPGSNEDRERCSAQPCPVPGGWSAWQSWTPCTQSCGTGLRYRYRACDNPFPAHGGATCPGSN--EDRERCSAQPC 201          
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Match: EDO49968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RET0])

HSP 1 Score: 68.5514 bits (166), Expect = 6.822e-14
Identity = 46/124 (37.10%), Postives = 65/124 (52.42%), Query Frame = 3
Query:  813 NGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLC-KTSSKDRVK-CPGSSLQTESCATF-CRVDGEWSTWSGWSLCQPDCT---RKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            +G W  W+ W  C   C  G          ++ RSR+C K S +D  + CPG +++T SC +  C +DG+WS+WS W  C   C    RKR R C NP P+ GG  C  ++  SE++ C   SC
Sbjct:    1 DGGWSSWSWWARCTKTCGGG----------VQARSRMCNKPSPRDGGRTCPGKTVETRSCNSRDCPIDGKWSSWSSWQTCSRTCGGGMRKRTRSCTNPAPKGGGRGCYGRS--SEQQICNRQSC 112          
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Match: EDO49967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES9])

HSP 1 Score: 63.1586 bits (152), Expect = 3.973e-12
Identity = 44/119 (36.97%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  813 NGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSS--KDRVKCPGSSLQTESCATF-CRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENC 1151
            +G W  W+ W  C   C  G           + R+R C   +       C GSS   +SC    CRVDG+WS+WSGW  C   C   T+ R R CN+P P++GG QC P  S  +  NC
Sbjct:    5 DGKWSSWSSWQTCSRTCGGG----------AQMRTRTCTNPAPIGGGRSCYGSSTDKQSCNPIPCRVDGQWSSWSGWDSCSMSCGGGTQSRTRACNSPAPRNGGRQC-PGQS-GQTRNC 111          
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Match: EDO47848 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL00])

HSP 1 Score: 60.4622 bits (145), Expect = 7.341e-11
Identity = 43/134 (32.09%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  813 NGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLC---KTSSKDRVKCPGSSLQTESC-ATFCR---------VDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            +G W PWA W  C   C  G          L+ R+R C   + S + +  C G SLQ + C    C          ++G+WS+W GW  C   C    +KR+R+CNNP P +GG  C  ++   ++  C + SC
Sbjct:    6 DGQWSPWASWTTCSRPCGGG----------LQSRARTCSNPRPSYRGKY-CVGDSLQRQRCNEQKCEARIPEVARPINGQWSSWEGWQACSKSCGGGVQKRMRKCNNPIPSNGGRTCRGRD--LDERACNIKSC 126          
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Match: EDO40760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S664])

HSP 1 Score: 65.4698 bits (158), Expect = 9.118e-11
Identity = 45/155 (29.03%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  720 NGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESCA-TFCRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            +G  ECV + +     S+AA           NG W  ++ W++C   C  G           + R+R C     +    +C G + +T  C+   C V+G WS +S WS C   C   T+ R R C NPKP  GG +C+      E  +C+  +C
Sbjct:  206 HGGKECVGDAKETRHCSEAA--------CAVNGGWSDYSSWSSCTKTCGGG----------TQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECV--GDAKETRHCSEAAC 340          

HSP 2 Score: 63.929 bits (154), Expect = 3.289e-10
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  813 NGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESCA-TFCRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            NG W  ++ W++C   C  G           + R+R C     +    +C G + +T  C+   C V+G WS +S WS C   C   T+ R R C NPKP  GG +C+      E  +C+  +C
Sbjct:  172 NGGWSDYSSWSSCTKTCGGG----------TQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECV--GDAKETRHCSEAAC 283          

HSP 3 Score: 59.3066 bits (142), Expect = 7.118e-9
Identity = 44/163 (26.99%), Postives = 67/163 (41.10%), Query Frame = 3
Query:  720 NGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTS--SKDRVKCPGSSLQTESCA-TFCRVDGEWSTWSGWSLCQPDCT---RKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNP 1190
            +G  ECV + +     S+AA           NG W  ++ W++C   C  G           + R+R C     +    +C G + +T  C+   C V+G WS +S W+ C   C    ++R R C +P P   G +C       E+  C  D C    PP P
Sbjct:  263 HGGKECVGDAKETRHCSEAA--------CAVNGGWSDYSSWSSCTKTCGGG----------TQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDFSKWTKCSKTCGGGKQERTRTCTSPAPSHNGKKCA--GDAREERECNTDKC----PPKP 401          

HSP 4 Score: 50.0618 bits (118), Expect = 5.618e-6
Identity = 24/60 (40.00%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  996 CRVDGEWSTWSGWSLCQPDC---TRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSC 1166
            C V+G WS +S WS C   C   T+ R R C NPKP  GG +C+      E  +C+  +C
Sbjct:  169 CEVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECV--GDAKETRHCSEAAC 226          
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Match: unc5a (unc-5 netrin receptor A [Source:NCBI gene;Acc:101167051])

HSP 1 Score: 158.688 bits (400), Expect = 3.063e-39
Identity = 97/295 (32.88%), Postives = 143/295 (48.47%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCK--TSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVVYVVL 1235
            V  V + +T + VE  F +  +WCQC A     S+T  Q  +++K +I +AY+ K F+ EP S  + L + V L C PP+G P  ++ W++N   ++ T     +++ D +LVI +  + D G Y CVA+N    R S +A + V       NG W  W  W++C   C  G           ++RSR C   T       C G ++Q  +C   C VDG WS WS WS C  DC+  R REC  P P +GG  C  +    +  NCT + C       PQ      D+ +YV +
Sbjct:  107 VMWVTIDITRQQVEKIFGLDEYWCQCVAW----STTGTQ--KSQKAYIRIAYLRKNFEEEPQSKEVALDQEVSLRCHPPEGVPPAEVEWQRNEDLVDPTSDPNFVITPDHNLVIKAARLADTGNYTCVAKNIVARRKSNSATVLVF-----VNGGWSTWTTWSSCSAVCGRG----------WQKRSRSCTNPTPLNGGTSCEGQNVQKSACVATCPVDGGWSEWSKWSACGADCSMWRSRECTQPSPGTGGKDC--QGLDLQSLNCTSEQC-------PQTVRGAEDVALYVGM 371          

HSP 2 Score: 109.383 bits (272), Expect = 8.200e-24
Identity = 89/401 (22.19%), Postives = 173/401 (43.14%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELYSKHTHE-RLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIG 2990
            +TGIS+ + P+     K   + L  +   + RL      T LS ++ C     + L +P+IL   HC       +W +++ K N    WE  +     ++ ++  YC L+ E C L + +L  F ++G+S +                      A KRL ++ F +      +  +  Y   DT+D+   ++      G R+ D PH+L  K+S  N+ +++     + W+      YQEI F  +WN  ++ ++     LE            + V+Q     +    S+ FN  + +  ++          D+    +     F++P +  +++   LD P    + W M+A++L +  ++ +F  +++PT+ +L LWEAQ+     +  L + +  IG
Sbjct:  519 NTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLLSPVVSCG-PPGVVLSRPVILSMDHCFD-ACLDNWAVRLKKQNYEGTWEDVL-LMGEELVSEPFYCQLEAETCRLFSEQLGTFAVVGESLH--------------------MGAAKRLRLVLFSDAYCSTLEYNIRVYCMDDTQDVFKEVMQMERQLGGRLIDEPHVLLFKDSYHNLRLSIHDMPQAHWRSKLLAGYQEIPFYHIWN-GSQRYLHCTFTLERLSLSTCELTCQLCVWQ--VEGEGQSFSLDFNIAKDTRAVDSEFL----VMDSNATALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRMLAQRLKLERHMSFFASKASPTSGILDLWEAQHFHSGNINQLAAVMADIG 889          
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 155.992 bits (393), Expect = 2.552e-38
Identity = 87/277 (31.41%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCK--TSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            V   ++ +T + VE  F   ++WCQC  A++   +T     +++K  + +AY+ K+F+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   T     + C G ++Q   C T C VDG W+ WS WS C  +CT+ R RECNNP P++GG  C  +    + +NCT   C +  P
Sbjct:  122 VREASIEITRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVY-----VNGGWSTWTEWSPCNSRCGRG----------FQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSACGTECTQWRRRECNNPAPKNGGKDC--EGLVLQSQNCTDGLCMQTAP 375          

HSP 2 Score: 90.8929 bits (224), Expect = 3.884e-18
Identity = 85/365 (23.29%), Postives = 146/365 (40.00%), Query Frame = 3
Query: 1908 TQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESA-STSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLD 2999
            T LS ++ C     + L +P+IL   HC        W +++    +  +WE  +       +    Y  +D E C+++T  L  +CL+G+S                        A KRL +  F           +  Y   DT+D    ++   T  G ++ D P  L+ K+S  N+ +++       WK     +YQEI F  +W+  ++  +     LE            + V Q        ++S +    E+         P+S     T         FR+P    ++L   LD P+   + W M+A +L +   L YF  +S+PT  +L LWEAQ+  +  L +L + L+ +G  D
Sbjct:  592 TVLSPVVSCGPAGAL-LTRPVILTIHHCAD-NVQEDWLIQLKNRLSMGEWEDVVVVGEENFTTP-CYVQMDSEACHILTETLGTYCLVGQSIGK--------------------AAAKRLKLAVFGPVSCTTLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWS-GSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEE-ELQCIDTSLMDPASNITTLT-----GPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 926          
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 155.606 bits (392), Expect = 2.942e-38
Identity = 87/277 (31.41%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  360 VHSVNLTLTEKTVESWFV-RNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCK--TSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDP 1181
            V   ++ +T + VE  F   ++WCQC  A++   +T     +++K  + +AY+ K+F+ EP    + L + V L C PP+G P  ++ W KN   ++  +     ++ D +L+I    ++D   Y CVA+N    R S  A + V       NG W  W  W+ C + C  G           ++R+R C   T     + C G ++Q   C T C VDG W+ WS WS C  +CT+ R RECNNP P++GG  C  +    + +NCT   C +  P
Sbjct:  107 VREASIEITRQQVEELFGPEDYWCQC-VAWSSAGTT-----KSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVY-----VNGGWSTWTEWSPCNSRCGRG----------FQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSACGTECTQWRRRECNNPAPKNGGKDC--EGLVLQSQNCTDGLCMQTAP 360          

HSP 2 Score: 90.8929 bits (224), Expect = 4.218e-18
Identity = 85/365 (23.29%), Postives = 146/365 (40.00%), Query Frame = 3
Query: 1908 TQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESA-STSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLD 2999
            T LS ++ C     + L +P+IL   HC        W +++    +  +WE  +       +    Y  +D E C+++T  L  +CL+G+S                        A KRL +  F           +  Y   DT+D    ++   T  G ++ D P  L+ K+S  N+ +++       WK     +YQEI F  +W+  ++  +     LE            + V Q        ++S +    E+         P+S     T         FR+P    ++L   LD P+   + W M+A +L +   L YF  +S+PT  +L LWEAQ+  +  L +L + L+ +G  D
Sbjct:  577 TVLSPVVSCGPAGAL-LTRPVILTIHHCAD-NVQEDWLIQLKNRLSMGEWEDVVVVGEENFTTP-CYVQMDSEACHILTETLGTYCLVGQSIGK--------------------AAAKRLKLAVFGPVSCTTLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWS-GSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEE-ELQCIDTSLMDPASNITTLT-----GPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 911          
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:101163686])

HSP 1 Score: 155.606 bits (392), Expect = 3.354e-38
Identity = 100/360 (27.78%), Postives = 162/360 (45.00%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCK--TSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPN 1187
            P+F+ + PE  ++  ++ V + C    ++ +   C  +                    ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++ + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ +  S  L++ D +L+I    ++D   Y CVA N    R S  A + V       +G W  W  W+ C   C  G           +RR+R C   T       C G  +Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R   P 
Sbjct:   54 PVFL-LEPEDAFIVKNRPVQLRCRASPATQIYFKCNGE--------------------WVNQNDHVTRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSVRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSKDSNFLITIDHNLIIKQARLSDTANYTCVARNVVAKRRSSTATVIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPTPLNGGAFCDGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPSPINGGKHC--SGSMMESKNCTEGLCARTLAPG 366          

HSP 2 Score: 98.9821 bits (245), Expect = 1.318e-20
Identity = 101/414 (24.40%), Postives = 166/414 (40.10%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVF 3014
            STG+S+ V P T    K   M L  +K            T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+            L L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE S          I V Q        ++      T+I  TL   S   S     +C  +P+S+     FRLP    +++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA ++ +  LV L + L+ +G  ++  V 
Sbjct:  546 STGVSLLVPPGTIPQGKFYEMYLIINKWDKTTSPSEGSQTVLSPVVSCGPSGML-LNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGGWEEVLTVGEETLSSP-CYVQLEEESCHVLLEQLGTYGLVGQSCPPQPACKRLQLAL---------FAPRAPCL---------SLDLSLRIYCIHDTPHALKEVMDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERSSLAVSQLTCKICVRQVEGEGQIFQLL-----TDIQETLPPHSPLPS---GGSC--LPSSQVGPYAFRLPDSIRQKICTSLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 928          
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:101163686])

HSP 1 Score: 154.836 bits (390), Expect = 5.721e-38
Identity = 99/355 (27.89%), Postives = 161/355 (45.35%), Query Frame = 3
Query:  117 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWF-VRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLC--KTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFR 1172
            P+F+ + PE  ++  ++ V + C    ++ +   C  +                    ++  N    ++  D+IT  V   V  V+++++   VE  F + ++WCQC  A++   +T     ++ + ++ +AY+ K F+ EP    + L + V L C PP+G P  ++ W KN   ++ +  S  L++ D +L+I    ++D   Y CVA N    R S  A + V       +G W  W  W+ C   C  G           +RR+R C   T       C G  +Q  +C T C VDG W+ W+ WS C  +CT  R REC  P P +GG  C    S  E +NCT   C R
Sbjct:   54 PVFL-LEPEDAFIVKNRPVQLRCRASPATQIYFKCNGE--------------------WVNQNDHVTRESLDQITGLV---VREVDISVSRTQVEELFGLEDYWCQC-VAWSSAGTT-----KSVRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSKDSNFLITIDHNLIIKQARLSDTANYTCVARNVVAKRRSSTATVIVY-----VSGGWSSWTEWSECNARCGRG----------WQRRTRSCTNPTPLNGGAFCDGPPVQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAPSPINGGKHC--SGSMMESKNCTEGLCAR 361          

HSP 2 Score: 90.5077 bits (223), Expect = 5.023e-18
Identity = 95/387 (24.55%), Postives = 152/387 (39.28%), Query Frame = 3
Query: 1794 STGISVTVMPDTFGSEKTISMELY-SKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFS-SWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTS-WKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASK----TFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEA 2933
            STG+S+ V P T    K   M L  +K            T LS ++ C     + L +P++L  PHC    + +  W + +    +   WE  +      +S+   Y  L+EE C+++  +L  + L+G+S  P     +    L          A +  C+            L L  Y   DT      ++    + G  + + P  L  K+S  N+ +++     S W+     +YQEI F  +W+    P       LE S          I V Q        ++      T+I  TL   S   S     +C  +P+S+     FRLP    +++   LD P      W ++A+ LG    L YF  + +PT  LL LWEA
Sbjct:  557 STGVSLLVPPGTIPQGKFYEMYLIINKWDKTTSPSEGSQTVLSPVVSCGPSGML-LNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGGWEEVLTVGEETLSSP-CYVQLEEESCHVLLEQLGTYGLVGQSCPPQPACKRLQLAL---------FAPRAPCL---------SLDLSLRIYCIHDTPHALKEVMDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHC-TFSLERSSLAVSQLTCKICVRQVEGEGQIFQLL-----TDIQETLPPHSPLPS---GGSC--LPSSQVGPYAFRLPDSIRQKICTSLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVLLDLWEA 912          
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 1916.35 bits (4963), Expect = 0.000e+0
Identity = 996/1009 (98.71%), Postives = 997/1009 (98.81%), Query Frame = 3
Query:   24 MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRID-----------PPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYXXXXXXXXXPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 3017
            MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEW+TWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRID            PNPQNRYVLRDMVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK
Sbjct:    1 MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWNTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDKSKFSENIEIRSPNPQNRYVLRDMVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 1009          
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 1846.25 bits (4781), Expect = 0.000e+0
Identity = 960/973 (98.66%), Postives = 961/973 (98.77%), Query Frame = 3
Query:  132 MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRID-----------PPNPQNRYVLRDMVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYXXXXXXXXXPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 3017
            MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEW+TWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRID            PNPQNRYVLRDMVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK
Sbjct:    1 MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWNTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDKSKFSENIEIRSPNPQNRYVLRDMVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 973          
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 1098.58 bits (2840), Expect = 0.000e+0
Identity = 601/601 (100.00%), Postives = 601/601 (100.00%), Query Frame = 3
Query: 1215 MVVYVVLSXXXXXXXXXXXXXXCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYXXXXXXXXXPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 3017
            MVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK
Sbjct:    1 MVVYVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLIYQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILEHSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 601          
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 383/384 (99.74%), Postives = 384/384 (100.00%), Query Frame = 3
Query:   24 MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 1175
            MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEW+TWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI
Sbjct:    1 MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWNTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 384          
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 347/348 (99.71%), Postives = 348/348 (100.00%), Query Frame = 3
Query:  132 MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 1175
            MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEW+TWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI
Sbjct:    1 MPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWNTWSGWSLCQPDCTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRI 348          
The following BLAST results are available for this feature:
BLAST of Netrin receptor UNC5C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5A7.668e-3830.67unc-5 netrin receptor A [Source:HGNC Symbol;Acc:HG... [more]
UNC5B3.132e-3729.70unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5B3.361e-3729.05unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5C7.298e-3731.05unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5C9.545e-3731.05unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-57.279e-3024.80Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-59.933e-3024.87Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-54.766e-2928.67Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-57.948e-2528.51Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-56.683e-1729.57Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-52.690e-2728.45gene:FBgn0034013 transcript:FBtr0339998[more]
unc-52.690e-2728.45gene:FBgn0034013 transcript:FBtr0087382[more]
robo22.397e-1633.06gene:FBgn0002543 transcript:FBtr0329985[more]
robo22.471e-1633.06gene:FBgn0002543 transcript:FBtr0077941[more]
robo35.152e-1633.33gene:FBgn0041097 transcript:FBtr0077921[more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5b3.279e-3831.31unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b3.282e-3831.31unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b3.302e-3831.31unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5da1.139e-3428.87unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5da2.809e-3425.37unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5B4.590e-4026.55unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B4.727e-4028.03unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
ndufaf77.160e-4028.37NADH:ubiquinone oxidoreductase complex assembly fa... [more]
UNC5B1.037e-3928.18unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B1.155e-3928.09unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc5a2.735e-3829.50unc-5 netrin receptor A [Source:MGI Symbol;Acc:MGI... [more]
Unc5c3.384e-3730.09unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c3.925e-3730.48unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c4.143e-3730.48unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c4.143e-3730.48unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Netrin receptor UNC5C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|C5IAW9|UN5BB_XENLA5.462e-4028.73Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 ... [more]
sp|Q8JGT4|UN5BA_XENLA2.050e-3827.91Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 ... [more]
sp|Q761X5|UNC5C_RAT1.350e-3730.68Netrin receptor UNC5C OS=Rattus norvegicus OX=1011... [more]
sp|Q8K1S4|UNC5A_MOUSE1.913e-3729.50Netrin receptor UNC5A OS=Mus musculus OX=10090 GN=... [more]
sp|Q7T2Z5|UNC5C_CHICK9.012e-3731.05Netrin receptor UNC5C OS=Gallus gallus OX=9031 GN=... [more]
back to top
BLAST of Netrin receptor UNC5C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZQ13.089e-16899.65ZU5 domain-containing protein (Fragment) OS=Schmid... [more]
A0A3Q3AVK72.029e-5925.08Unc-5 netrin receptor B OS=Kryptolebias marmoratus... [more]
A0A3P8TET51.620e-5824.59Unc-5 netrin receptor B OS=Amphiprion percula OX=1... [more]
A0A3B4T6152.983e-5824.49Unc-5 netrin receptor B OS=Seriola dumerili OX=414... [more]
A0A3Q1AJ021.006e-5724.49Unc-5 netrin receptor B OS=Amphiprion ocellaris OX... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5a1.753e-3931.46unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b2.647e-3926.92unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5b3.165e-3926.92unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5b1.074e-3831.31unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5c1.263e-3728.05unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010609.12.725e-3727.30pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1... [more]
ENSPMAT00000008404.12.611e-3627.61pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
ENSPMAT00000003861.12.447e-3429.00pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 g... [more]
thbs1a4.844e-1332.17thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
ENSPMAT00000000917.15.028e-1131.13pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332947.096e-1629.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499686.822e-1437.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499673.973e-1236.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478487.341e-1132.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407609.118e-1129.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5a3.063e-3932.88unc-5 netrin receptor A [Source:NCBI gene;Acc:1011... [more]
si:ch73-72b7.12.552e-3831.41netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.12.942e-3831.41netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
unc5b3.354e-3827.78unc-5 netrin receptor B [Source:NCBI gene;Acc:1011... [more]
unc5b5.721e-3827.89unc-5 netrin receptor B [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Netrin receptor UNC5C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000615.10.000e+098.71SMESG000000615.1[more]
SMESG000000615.10.000e+098.66SMESG000000615.1[more]
SMESG000000615.10.000e+0100.00SMESG000000615.1[more]
SMESG000000615.10.000e+099.74SMESG000000615.1[more]
SMESG000000615.10.000e+099.71SMESG000000615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021806 ID=SMED30021806|Name=Netrin receptor UNC5C|organism=Schmidtea mediterranea sexual|type=transcript|length=3061bp
ATAATAATTAATAATCAAATGAAATGTTTTCGATAATTTGTATTTTATTC
ATCAATTTGGTCTTTATCTGTTCTCAAGATATAATTGAAAACTCTTCCAT
TCAGCAAATTCTTAAACCAATTTTTGTAAAAATGCCTCCAGAACATCTAT
ATGTAACACCTTCAAAGGCTGTTATGATTGAATGCGTGGTAAAACAAAGC
AGCTTCTTGCAAATAAACTGCGTTGAAGACCAAGATACTATTAGCAAAAC
ATCAACAGCTTCTCTCTTGGACCAAAGCAAAGAAACAGTTTATCTCAAAC
CAAACAAAAAATCAGACAAGAAACAATTCGACAAAATTACTAAATCTGTC
CAAGGAGATGTACATTCTGTTAATTTAACATTGACTGAGAAAACTGTCGA
ATCTTGGTTCGTGCGAAATTTCTGGTGCCAATGTGAAGCGGCCTATACAC
AAGATTCAAGCACTTCAAATCAGTTAGTAAGAACAAAAAAAACATTTATC
GAAGTGGCATACATTGATAAAACTTTCAAGCTTGAACCAAATTCTGCAAC
TCTTTATCTTGGCCGATATGTTAAATTAACATGCATTCCTCCAGATGGAA
GTCCAAAACCTAAAATTCATTGGAGAAAAAACGGAAGAAAACTAGAATTA
ACCGATTTGAGTAAAATACTTGTGTCTGATGACGGTTCACTTGTTATTTT
TTCAACGTCAATAACGGACAATGGCCAATATGAATGCGTTGCGGAAAATG
AAGCTGGGATCAGAATATCAAAAGCAGCAAAATTAGAAGTTCTTGATACC
GATTCTACTGAAAATGGAGATTGGTTACCATGGGCTCCATGGAATGCATG
CCCCAATGATTGTACTTATGGAAAGTATTGTGTCGATTCTTGTATTAAAT
ATCTACGAAGACGGTCACGACTGTGCAAGACATCTAGTAAAGATAGGGTA
AAATGTCCCGGTTCATCGCTTCAAACCGAATCTTGCGCAACATTCTGCCG
AGTTGACGGCGAATGGAGTACTTGGTCCGGATGGTCACTTTGTCAACCCG
ATTGCACAAGAAAAAGAATTCGAGAGTGTAATAATCCCAAACCCCAATCA
GGAGGTGATCAGTGTTTACCGAAAAACAGTTTTTCTGAGAAAGAGAATTG
TACATTAGATTCGTGCTTTAGAATAGATCCCCCTAATCCTCAGAACCGCT
ACGTTTTAAGGGATATGGTTGTCTATGTGGTTTTGTCAATTGCATTGTTT
CTATTGATATTGGTGACAACGATTATTCTATGTTTTCAAAAGAAACATTT
TCTCTTTTCCACACAATCTAATGAAATAAATTCAAAAATTGGTGGGGATA
AAGGTGGATTCATTTTGCTGAAATCCCTTGGAAATAAAAACGCAATTGTA
AAAGATAACAATTCAGAATCAGTGACAACATACAACAGTGGAAGTGGAAA
TAATTCTTCTCCATTAATAAACGAAGCCAACATGAAACACGATTCCTCAA
ATTCGACGATATGCACTAGTCGATTTGTCGACAATCTCTCCACTGTTGAT
GTGACTCTGAAAAATACTCCCGCCTCAAAGCAAGTCTCATTTCAGCATCC
CCCAATCAGTTGCCATTATAAAGAAGTGGAATTGCCGACATCCCCAATTC
TAGCCAACTATCCGTCTTTGATCTATCAACCAATTTCCACGCCAATTTCT
TTGCCTCCGATTATTGAAAACCGAAATCTCATTTCCAATGGTTCAGGTTC
CAATTTGTTGATCTCAAATTCCGGTGGACGAGTCATCCTTGGCAGCACCG
GAATATCGGTAACAGTTATGCCGGATACGTTTGGGAGTGAAAAAACAATT
TCCATGGAACTTTATTCCAAACATACTCATGAAAGATTGATTGAATTCAG
TAAATATACCCAGTTGAGCTCAATTATATTTTGTAGCTTAAAGGAAACCA
TTTCTTTGCAAAAGCCCTTGATATTAGTATTTCCTCATTGCGTTACTTGG
AAATCTTTCTCCAGCTGGGATATGAAAGTTGTGAAGATGAATAATAACTT
CAAGTGGGAAGTTTACATTGACTTCCAGAATCCTCAAATGTCAAATAAAC
AAGCATATTGTCATTTAGATGAAGAATTTTGCTACTTAATGACTTTTGAG
TTGTTCCCATTCTGTTTGCTGGGCAAGTCACAAAACCCTTTATCCTATGA
TAACAAGGACAACTTTGATTTATCCAACCAGTTTCCTTTACCGGTGTTTC
TTGCAGATAAACGGTTATGTGTTATTTCGTTTCTTGAACCTCTTCATCAG
CAAAAGCAACTCCAATTGAGCTGTTATTTATTTATTGACACAAAAGACAT
TAAAGATTATTTGATATCCAAAATCACAGCTGCCGGATGCCGAATATTTG
ATATTCCTCATATTTTATCCCTAAAAGAATCAGCAGCTAATGTGTCGGTT
ACCGTTGAAAGTGCCTCTACGAGTTGGAAAGTTCACGCCAAGCACAGATA
TCAAGAAATACTTTTTGAAGATCTATGGAATTTCAGAACCGAGCCTTTCA
TCACTAGAAATATAATATTAGAACATTCTGAAACAATATTCCAACCTTTT
ATTGGCCATATAACCGTATATCAAAACAATTTTTATCAGGATCGAATCGA
AATATCTGTTTCATTCAACTCGACAGAGATATCAAACACTCTAAACAAAA
GTTCTACTCCATCAAGCACTTATAAAGATGCGACATGCAAACTTATTCCA
GCTTCTAAAACATTCAGATTGCCCAGAGTCACAATTAGAGAGCTCTCCAT
CCATTTAGATCCCCCTAAAATTCCAGTGTCCCAATGGTCAATGATTGCTA
AACAATTAGGAATTTCTAATAATCTGGAATACTTCCACAGACAGTCCAAC
CCAACCGCATATCTTCTGATGCTCTGGGAAGCTCAAAATAGAGAAGAAAC
CGCATTAGTTGATTTAAAAAGCACTTTGAAAATTATTGGCTTACTTGACA
TTGCAAATGTATTTAAATAACGCAAATGTGTATTTATTATTTGATACTAT
TTATTATAGAG
back to top

protein sequence of SMED30021806-orf-1

>SMED30021806-orf-1 ID=SMED30021806-orf-1|Name=SMED30021806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=999bp
MFSIICILFINLVFICSQDIIENSSIQQILKPIFVKMPPEHLYVTPSKAV
MIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKK
QFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQ
LVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHW
RKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISK
AAKLEVLDTDSTENGDWLPWAPWNACPNDCTYGKYCVDSCIKYLRRRSRL
CKTSSKDRVKCPGSSLQTESCATFCRVDGEWSTWSGWSLCQPDCTRKRIR
ECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDPPNPQNRYVLRDMVV
YVVLSIALFLLILVTTIILCFQKKHFLFSTQSNEINSKIGGDKGGFILLK
SLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSR
FVDNLSTVDVTLKNTPASKQVSFQHPPISCHYKEVELPTSPILANYPSLI
YQPISTPISLPPIIENRNLISNGSGSNLLISNSGGRVILGSTGISVTVMP
DTFGSEKTISMELYSKHTHERLIEFSKYTQLSSIIFCSLKETISLQKPLI
LVFPHCVTWKSFSSWDMKVVKMNNNFKWEVYIDFQNPQMSNKQAYCHLDE
EFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCV
ISFLEPLHQQKQLQLSCYLFIDTKDIKDYLISKITAAGCRIFDIPHILSL
KESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEPFITRNIILE
HSETIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTY
KDATCKLIPASKTFRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNN
LEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005042netrin receptor activity
GO:0005043netrin receptor activity involved in chemorepulsion
GO:0015631tubulin binding
GO:0019901protein kinase binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0030027lamellipodium
GO:0030175filopodium
GO:0030424axon
GO:0030425dendrite
GO:0030426growth cone
GO:0043025neuronal cell body
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007411axon guidance
GO:0007420brain development
GO:0030334regulation of cell migration
GO:0033564anterior/posterior axon guidance
GO:0038007netrin-activated signaling pathway
GO:0043065positive regulation of apoptotic process
GO:0061643chemorepulsion of axon
GO:1990791dorsal root ganglion development
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033772UPA
IPR037936UNC5
IPR000884TSP1_rpt
IPR003599Ig_sub
IPR003598Ig_sub2
IPR011029DEATH-like_dom_sf
IPR000488Death_domain
IPR000906ZU5_dom
IPR013783Ig-like_fold
IPR007110Ig-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033772UPA domainPFAMPF17217UPAcoord: 349..470
e-value: 5.7E-6
score: 26.3
IPR000488Death domainPFAMPF00531Deathcoord: 526..599
e-value: 4.9E-8
score: 33.0
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 540..601
score: 8.946
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 512..601
e-value: 7.4E-17
score: 63.0
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 177..318
e-value: 1.7E-7
score: 32.8
NoneNo IPR availablePANTHERPTHR12582:SF4NETRIN RECEPTOR UNC5Acoord: 186..593
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
IPR000906ZU5 domainPFAMPF00791ZU5coord: 182..273
e-value: 4.2E-7
score: 30.2
IPR037936Netrin receptor UNC5PANTHERPTHR12582NETRIN RECEPTOR UNC5coord: 186..593
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 517..599