Histone H3

Overview
NameHistone H3
Smed IDSMED30021776
Length (bp)651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H3 (SMED30021776) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H3 (SMED30021776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H3 (SMED30021776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H3 (SMED30021776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021776

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30021776SMESG000074574.1 SMESG000074479.1 SmedASXL_008003SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30021776SMESG000074574.1 SMESG000074479.1 SmedASXL_008003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021776SMESG000074574.1 SMESG000074479.1 SmedASXL_008003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021776SMESG000074574.1 SMESG000074479.1 dd_Smed_v4_8630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021776SMESG000074574.1 SMESG000074479.1 Contig43868newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021776SMESG000074574.1 SMESG000074479.1 Contig43868uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021776SMESG000074574.1 SMESG000074479.1 SMESG000036236.1 Contig8630newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021776SMESG000074574.1 SMESG000074479.1 SMESG000036236.1 Contig8630uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30021776SMESG000074574.1 SMESG000074479.1 OX_Smed_1.0.19518ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30021776SMESG000074574.1 SMESG000074479.1 KC916782smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
chromatoid bodySMED30021776SMESG000074574.1 SMESG000074479.1 KC916782smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30021776SMESG000074574.1 SMESG000074479.1 SMED_05200_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021776SMESG000074574.1 SMESG000074479.1 SMED_05200_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H3 vs. Ensembl Human
Match: H3C15 (H3 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:20505])

HSP 1 Score: 271.937 bits (694), Expect = 7.565e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3C14 (H3 clustered histone 14 [Source:HGNC Symbol;Acc:HGNC:20503])

HSP 1 Score: 271.937 bits (694), Expect = 7.565e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3C13 (H3 clustered histone 13 [Source:HGNC Symbol;Acc:HGNC:25311])

HSP 1 Score: 271.937 bits (694), Expect = 7.565e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3C8 (H3 clustered histone 8 [Source:HGNC Symbol;Acc:HGNC:4772])

HSP 1 Score: 269.626 bits (688), Expect = 4.821e-93
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3C7 (H3 clustered histone 7 [Source:HGNC Symbol;Acc:HGNC:4773])

HSP 1 Score: 269.626 bits (688), Expect = 4.821e-93
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-71 (Histone H3.3 type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q10453])

HSP 1 Score: 268.085 bits (684), Expect = 7.161e-93
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-72 (Histone H3.3 type 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U281])

HSP 1 Score: 267.314 bits (682), Expect = 1.778e-92
Identity = 131/136 (96.32%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-63 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 265.388 bits (677), Expect = 9.824e-92
Identity = 131/136 (96.32%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-59 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 265.388 bits (677), Expect = 9.824e-92
Identity = 131/136 (96.32%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-55 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 265.388 bits (677), Expect = 9.824e-92
Identity = 131/136 (96.32%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3:CG33809 (gene:FBgn0053809 transcript:FBtr0091813)

HSP 1 Score: 271.937 bits (694), Expect = 3.624e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3:CG33866 (gene:FBgn0053866 transcript:FBtr0091870)

HSP 1 Score: 271.937 bits (694), Expect = 3.624e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3:CG33857 (gene:FBgn0053857 transcript:FBtr0091861)

HSP 1 Score: 271.937 bits (694), Expect = 3.624e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3:CG31613 (gene:FBgn0051613 transcript:FBtr0085894)

HSP 1 Score: 271.937 bits (694), Expect = 3.624e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3:CG33842 (gene:FBgn0053842 transcript:FBtr0091846)

HSP 1 Score: 271.937 bits (694), Expect = 3.624e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: zgc:173552 (zgc:173552 [Source:ZFIN;Acc:ZDB-GENE-080220-24])

HSP 1 Score: 271.937 bits (694), Expect = 4.813e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: CR762436.1 (Histone H3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q4QRF4])

HSP 1 Score: 271.937 bits (694), Expect = 4.813e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: CR762436.2 (si:dkey-261m9.8 [Source:NCBI gene;Acc:100329422])

HSP 1 Score: 271.937 bits (694), Expect = 4.813e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: FQ312024.1 (si:ch73-36p18.2 [Source:NCBI gene;Acc:100334933])

HSP 1 Score: 271.937 bits (694), Expect = 4.813e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: CU457819.2 (Histone H3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q4QRF4])

HSP 1 Score: 271.937 bits (694), Expect = 4.813e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: lamtor2 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [Source:Xenbase;Acc:XB-GENE-992364])

HSP 1 Score: 271.937 bits (694), Expect = 6.858e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: hist2h3c (histone H3 [Source:NCBI gene;Acc:100493100])

HSP 1 Score: 271.937 bits (694), Expect = 6.858e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: hist2h3c (histone H3 [Source:NCBI gene;Acc:100493100])

HSP 1 Score: 271.937 bits (694), Expect = 6.858e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: psmd1 (proteasome 26S subunit, non-ATPase 1 [Source:Xenbase;Acc:XB-GENE-989959])

HSP 1 Score: 271.937 bits (694), Expect = 6.858e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: hist2h3c (histone H3 [Source:NCBI gene;Acc:100493100])

HSP 1 Score: 271.937 bits (694), Expect = 6.858e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c13 (H3 clustered histone 13 [Source:MGI Symbol;Acc:MGI:2448351])

HSP 1 Score: 271.937 bits (694), Expect = 5.194e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c14 (H3 clustered histone 14 [Source:MGI Symbol;Acc:MGI:2448355])

HSP 1 Score: 271.937 bits (694), Expect = 5.194e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c15 (H3 clustered histone 15 [Source:MGI Symbol;Acc:MGI:2448357])

HSP 1 Score: 271.937 bits (694), Expect = 5.194e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c4 (H3 clustered histone 4 [Source:MGI Symbol;Acc:MGI:2448322])

HSP 1 Score: 271.937 bits (694), Expect = 5.194e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c6 (H3 clustered histone 6 [Source:MGI Symbol;Acc:MGI:2448326])

HSP 1 Score: 271.937 bits (694), Expect = 5.194e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84239|H3_URECA (Histone H3 OS=Urechis caupo OX=6431 PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 3.633e-93
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84237|H3_TIGCA (Histone H3 OS=Tigriopus californicus OX=6832 PE=3 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 3.633e-93
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84235|H3_PLADU (Histone H3 OS=Platynereis dumerilii OX=6359 PE=3 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 3.633e-93
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P02299|H3_DROME (Histone H3 OS=Drosophila melanogaster OX=7227 GN=His3 PE=1 SV=4)

HSP 1 Score: 271.937 bits (694), Expect = 3.633e-93
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84236|H3_DROHY (Histone H3 OS=Drosophila hydei OX=7224 GN=His3 PE=3 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 3.633e-93
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. TrEMBL
Match: A7S708 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g229551 PE=3 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 2.501e-92
Identity = 141/169 (83.43%), Postives = 148/169 (87.57%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*GVM*ECVTALFRATSFGCK*LLLIDSVINSHF 557
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA     E +  +   T    K + +++S +N  F
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA----HEVLKQVHHDTGISSKAMGIMNSFVNDIF 165          
BLAST of Histone H3 vs. TrEMBL
Match: A0A448WJX7 (Histone H3 OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS7035 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.402e-91
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. TrEMBL
Match: A0A1S8WU03 (Histone H3 (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06324 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.402e-91
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. TrEMBL
Match: A0A430QQC2 (Histone H3 OS=Schistosoma bovis OX=6184 GN=DC041_0006034 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.402e-91
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. TrEMBL
Match: A0A3R7JG51 (Histone H3 OS=Clonorchis sinensis OX=79923 GN=CSKR_1228s PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.402e-91
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: ENSAMXT00000056477.1 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 269.24 bits (687), Expect = 4.495e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: si:ch1073-429i10.3 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 269.24 bits (687), Expect = 4.495e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: h3f3d (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 269.24 bits (687), Expect = 4.495e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: ENSAMXT00000051731.1 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 269.24 bits (687), Expect = 4.495e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: si:dkey-23a13.21 (si:dkey-23a13.21 [Source:ZFIN;Acc:ZDB-GENE-160113-53])

HSP 1 Score: 249.98 bits (637), Expect = 1.771e-85
Identity = 128/137 (93.43%), Postives = 129/137 (94.16%), Query Frame = 3
Query:   51 MARTKQT-ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQT  +     KAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    6 MARTKQTRPQVHRLAKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 142          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011162.1 (pep scaffold:Pmarinus_7.0:GL476820:703693:704103:-1 gene:ENSPMAG00000010135.1 transcript:ENSPMAT00000011162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 7.087e-94
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011073.1 (pep scaffold:Pmarinus_7.0:GL476925:255214:255624:-1 gene:ENSPMAG00000010047.1 transcript:ENSPMAT00000011073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 7.087e-94
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011065.1 (pep scaffold:Pmarinus_7.0:GL476925:237524:237934:-1 gene:ENSPMAG00000010039.1 transcript:ENSPMAT00000011065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 7.087e-94
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011058.1 (pep scaffold:Pmarinus_7.0:GL476925:218306:218716:1 gene:ENSPMAG00000010032.1 transcript:ENSPMAT00000011058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 7.087e-94
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011054.1 (pep scaffold:Pmarinus_7.0:GL476925:202427:202837:1 gene:ENSPMAG00000010029.1 transcript:ENSPMAT00000011054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 7.087e-94
Identity = 134/136 (98.53%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: HHT1 (Histone H3; core histone protein required for chromatin assembly, part of heterochromatin-mediated telomeric and HM silencing; one of two identical histone H3 proteins (see HHT2); regulated by acetylation, methylation, and phosphorylation; H3K14 acetylation plays an important role in the unfolding of strongly positioned nucleosomes during repair of UV damage [Source:SGD;Acc:S000000214])

HSP 1 Score: 248.054 bits (632), Expect = 1.393e-85
Identity = 121/136 (88.97%), Postives = 130/136 (95.59%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHRY+PGTVALREIRR+QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI  KDI+LARR+RGER+
Sbjct:    1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: HHT2 (Histone H3; core histone protein required for chromatin assembly, part of heterochromatin-mediated telomeric and HM silencing; one of two identical histone H3 proteins (see HHT1); regulated by acetylation, methylation, and phosphorylation; H3K14 acetylation plays an important role in the unfolding of strongly positioned nucleosomes during repair of UV damage [Source:SGD;Acc:S000004976])

HSP 1 Score: 248.054 bits (632), Expect = 1.393e-85
Identity = 121/136 (88.97%), Postives = 130/136 (95.59%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHRY+PGTVALREIRR+QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI  KDI+LARR+RGER+
Sbjct:    1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: CSE4 (Histone H3-like centromere protein; associated with promoters, accessible chromatin, RNAPII-bound regions; phosphorylated Cse4p associates with centromeres; required for proper kinetochore function; levels regulated by E3 ubiquitin ligase Psh1p; phosphorylation may destabilize defective kinetochores to promote bi-orientation; ubiquitination of N-terminus regulates proteolysis for faithful chromosome segregation; yeast CSE4 can complement mutations in human homolog CENPA [Source:SGD;Acc:S000001532])

HSP 1 Score: 133.65 bits (335), Expect = 2.181e-39
Identity = 64/97 (65.98%), Postives = 79/97 (81.44%), Query Frame = 3
Query:  171 RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 452
            +Y P  +AL EIR+YQ+ST+LLI K+PF RLV+E+  +F T   DLR+QS A+ ALQEASEAYLVGL E TNL A+HAKR+TIM KD+QLARRIRG+
Sbjct:  131 KYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQ 227          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO40554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S708])

HSP 1 Score: 278.87 bits (712), Expect = 3.459e-96
Identity = 141/169 (83.43%), Postives = 148/169 (87.57%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*GVM*ECVTALFRATSFGCK*LLLIDSVINSHF 557
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA     E +  +   T    K + +++S +N  F
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA----HEVLKQVHHDTGISSKAMGIMNSFVNDIF 165          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO27768 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 271.937 bits (694), Expect = 1.489e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO26659 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 271.937 bits (694), Expect = 1.489e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO26704 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 271.937 bits (694), Expect = 1.489e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO46464 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 271.937 bits (694), Expect = 1.489e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000001654.2 (histone H3 [Source:NCBI gene;Acc:101168343])

HSP 1 Score: 271.937 bits (694), Expect = 4.053e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000030026.1 (histone H3.3 [Source:NCBI gene;Acc:101175183])

HSP 1 Score: 269.24 bits (687), Expect = 4.468e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000046325.1 (pep primary_assembly:ASM223467v1:13:17992240:17994436:1 gene:ENSORLG00000028044.1 transcript:ENSORLT00000046325.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 4.468e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000029477.1 (pep primary_assembly:ASM223467v1:13:17996287:18000034:1 gene:ENSORLG00000024385.1 transcript:ENSORLT00000029477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.24 bits (687), Expect = 4.468e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: h3f3d (histone H3.3 [Source:NCBI gene;Acc:101163693])

HSP 1 Score: 269.24 bits (687), Expect = 4.468e-93
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074937.1 (SMESG000074937.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.900e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074574.1 (SMESG000074574.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.900e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074479.1 (SMESG000074479.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.900e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000067905.1 (SMESG000067905.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.900e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000067898.1 (SMESG000067898.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.900e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   51 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 458
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
The following BLAST results are available for this feature:
BLAST of Histone H3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H3C157.565e-9499.26H3 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H3C147.565e-9499.26H3 clustered histone 14 [Source:HGNC Symbol;Acc:HG... [more]
H3C137.565e-9499.26H3 clustered histone 13 [Source:HGNC Symbol;Acc:HG... [more]
H3C84.821e-9398.53H3 clustered histone 8 [Source:HGNC Symbol;Acc:HGN... [more]
H3C74.821e-9398.53H3 clustered histone 7 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Histone H3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-717.161e-9397.06Histone H3.3 type 1 [Source:UniProtKB/Swiss-Prot;... [more]
his-721.778e-9296.32Histone H3.3 type 2 [Source:UniProtKB/Swiss-Prot;... [more]
his-639.824e-9296.32Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
his-599.824e-9296.32Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
his-559.824e-9296.32Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
back to top
BLAST of Histone H3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His3:CG338093.624e-9499.26gene:FBgn0053809 transcript:FBtr0091813[more]
His3:CG338663.624e-9499.26gene:FBgn0053866 transcript:FBtr0091870[more]
His3:CG338573.624e-9499.26gene:FBgn0053857 transcript:FBtr0091861[more]
His3:CG316133.624e-9499.26gene:FBgn0051613 transcript:FBtr0085894[more]
His3:CG338423.624e-9499.26gene:FBgn0053842 transcript:FBtr0091846[more]
back to top
BLAST of Histone H3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1735524.813e-9499.26zgc:173552 [Source:ZFIN;Acc:ZDB-GENE-080220-24][more]
CR762436.14.813e-9499.26Histone H3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q4Q... [more]
CR762436.24.813e-9499.26si:dkey-261m9.8 [Source:NCBI gene;Acc:100329422][more]
FQ312024.14.813e-9499.26si:ch73-36p18.2 [Source:NCBI gene;Acc:100334933][more]
CU457819.24.813e-9499.26Histone H3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q4Q... [more]
back to top
BLAST of Histone H3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lamtor26.858e-9499.26late endosomal/lysosomal adaptor, MAPK and MTOR ac... [more]
hist2h3c6.858e-9499.26histone H3 [Source:NCBI gene;Acc:100493100][more]
hist2h3c6.858e-9499.26histone H3 [Source:NCBI gene;Acc:100493100][more]
psmd16.858e-9499.26proteasome 26S subunit, non-ATPase 1 [Source:Xenba... [more]
hist2h3c6.858e-9499.26histone H3 [Source:NCBI gene;Acc:100493100][more]
back to top
BLAST of Histone H3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H3c135.194e-9499.26H3 clustered histone 13 [Source:MGI Symbol;Acc:MGI... [more]
H3c145.194e-9499.26H3 clustered histone 14 [Source:MGI Symbol;Acc:MGI... [more]
H3c155.194e-9499.26H3 clustered histone 15 [Source:MGI Symbol;Acc:MGI... [more]
H3c45.194e-9499.26H3 clustered histone 4 [Source:MGI Symbol;Acc:MGI:... [more]
H3c65.194e-9499.26H3 clustered histone 6 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Histone H3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P84239|H3_URECA3.633e-9399.26Histone H3 OS=Urechis caupo OX=6431 PE=1 SV=2[more]
sp|P84237|H3_TIGCA3.633e-9399.26Histone H3 OS=Tigriopus californicus OX=6832 PE=3 ... [more]
sp|P84235|H3_PLADU3.633e-9399.26Histone H3 OS=Platynereis dumerilii OX=6359 PE=3 S... [more]
sp|P02299|H3_DROME3.633e-9399.26Histone H3 OS=Drosophila melanogaster OX=7227 GN=H... [more]
sp|P84236|H3_DROHY3.633e-9399.26Histone H3 OS=Drosophila hydei OX=7224 GN=His3 PE=... [more]
back to top
BLAST of Histone H3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7S7082.501e-9283.43Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A448WJX71.402e-91100.00Histone H3 OS=Protopolystoma xenopodis OX=117903 G... [more]
A0A1S8WU031.402e-91100.00Histone H3 (Fragment) OS=Opisthorchis viverrini OX... [more]
A0A430QQC21.402e-91100.00Histone H3 OS=Schistosoma bovis OX=6184 GN=DC041_0... [more]
A0A3R7JG511.402e-91100.00Histone H3 OS=Clonorchis sinensis OX=79923 GN=CSKR... [more]
back to top
BLAST of Histone H3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056477.14.495e-9397.06histone H3.3 [Source:NCBI gene;Acc:103046944][more]
si:ch1073-429i10.34.495e-9397.06histone H3.3 [Source:NCBI gene;Acc:103046944][more]
h3f3d4.495e-9397.06histone H3.3 [Source:NCBI gene;Acc:103046944][more]
ENSAMXT00000051731.14.495e-9397.06histone H3.3 [Source:NCBI gene;Acc:103046944][more]
si:dkey-23a13.211.771e-8593.43si:dkey-23a13.21 [Source:ZFIN;Acc:ZDB-GENE-160113-... [more]
back to top
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011162.17.087e-9498.53pep scaffold:Pmarinus_7.0:GL476820:703693:704103:-... [more]
ENSPMAT00000011073.17.087e-9498.53pep scaffold:Pmarinus_7.0:GL476925:255214:255624:-... [more]
ENSPMAT00000011065.17.087e-9498.53pep scaffold:Pmarinus_7.0:GL476925:237524:237934:-... [more]
ENSPMAT00000011058.17.087e-9498.53pep scaffold:Pmarinus_7.0:GL476925:218306:218716:1... [more]
ENSPMAT00000011054.17.087e-9498.53pep scaffold:Pmarinus_7.0:GL476925:202427:202837:1... [more]
back to top
BLAST of Histone H3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HHT11.393e-8588.97Histone H3; core histone protein required for chro... [more]
HHT21.393e-8588.97Histone H3; core histone protein required for chro... [more]
CSE42.181e-3965.98Histone H3-like centromere protein; associated wit... [more]
back to top
BLAST of Histone H3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405543.459e-9683.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277681.489e-9499.26Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
EDO266591.489e-9499.26Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
EDO267041.489e-9499.26Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
EDO464641.489e-9499.26Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
back to top
BLAST of Histone H3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001654.24.053e-9499.26histone H3 [Source:NCBI gene;Acc:101168343][more]
ENSORLT00000030026.14.468e-9397.06histone H3.3 [Source:NCBI gene;Acc:101175183][more]
ENSORLT00000046325.14.468e-9397.06pep primary_assembly:ASM223467v1:13:17992240:17994... [more]
ENSORLT00000029477.14.468e-9397.06pep primary_assembly:ASM223467v1:13:17996287:18000... [more]
h3f3d4.468e-9397.06histone H3.3 [Source:NCBI gene;Acc:101163693][more]
back to top
BLAST of Histone H3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074937.13.900e-95100.00SMESG000074937.1[more]
SMESG000074574.13.900e-95100.00SMESG000074574.1[more]
SMESG000074479.13.900e-95100.00SMESG000074479.1[more]
SMESG000067905.13.900e-95100.00SMESG000067905.1[more]
SMESG000067898.13.900e-95100.00SMESG000067898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021776 ID=SMED30021776|Name=Histone H3|organism=Schmidtea mediterranea sexual|type=transcript|length=651bp
CCGATCTTGTATATAAGAAAAATTTGTTTATTTAATTATTATATAAATAA
ATGGCTCGAACTAAGCAGACTGCGAGAAAAAGTACTGGTGGAAAAGCTCC
AAGAAAGCAGTTGGCAACTAAAGCTGCACGTAAAAGTGCACCTGCAACTG
GTGGTGTTAAGAAACCACATAGATATCGTCCAGGAACTGTAGCTCTAAGA
GAAATTCGTAGGTATCAAAAGAGTACTGAATTGTTGATTAGAAAGTTGCC
ATTTCAGCGTCTGGTGCGAGAAATCGCTCAAGATTTCAAGACGGATTTGC
GATTTCAAAGTTCTGCTGTTTCTGCTCTTCAAGAGGCTAGTGAAGCATAC
TTAGTTGGTTTGTTTGAAGATACTAATTTGTGTGCAATTCACGCTAAACG
TGTTACAATTATGCCGAAGGATATCCAATTAGCTAGGAGAATAAGAGGAG
AACGTGCATAAGGTGTTATGTGAGAATGCGTTACGGCCCTCTTTAGGGCC
ACAAGCTTTGGTTGTAAATAGCTATTATTGATTGATAGTGTTATAAATTC
ACATTTTTTATTAATTCAATCTTTTCTTAATGGTAACATAAATGTTTAGA
AATGTAATGGAAGTTAGTTAAGTGGATTTTATTAATCATTTATACTATTA
A
back to top

protein sequence of SMED30021776-orf-1

>SMED30021776-orf-1 ID=SMED30021776-orf-1|Name=SMED30021776-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALR
EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002020chromatoid body
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000164Histone_H3/CENP-A
IPR007125Histone_H2A/H2B/H3
IPR009072Histone-fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000164Histone H3/CENP-APRINTSPR00622HISTONEH3coord: 34..55
score: 93.58
coord: 114..135
score: 94.86
coord: 98..114
score: 96.93
coord: 80..98
score: 85.47
coord: 3..17
score: 97.1
coord: 17..31
score: 92.32
coord: 58..75
score: 97.46
IPR000164Histone H3/CENP-ASMARTSM00428h35coord: 34..136
e-value: 9.8E-75
score: 264.3
IPR000164Histone H3/CENP-APANTHERPTHR11426HISTONE H3coord: 1..136
IPR000164Histone H3/CENP-APROSITEPS00959HISTONE_H3_2coord: 67..75
IPR000164Histone H3/CENP-APROSITEPS00322HISTONE_H3_1coord: 15..21
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 1..132
e-value: 1.1E-53
score: 181.1
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..136
e-value: 1.5E-79
score: 266.5
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 2..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availablePANTHERPTHR11426:SF224coord: 1..136