NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6

Overview
NameNADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6
Smed IDSMED30021774
Length (bp)755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 (SMED30021774) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 (SMED30021774) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 (SMED30021774) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 (SMED30021774) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021774

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021774h1SMcG0019052 dd_Smed_v4_1994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Celegans
Match: ZK809.3 (pep chromosome:WBcel235:IV:11652403:11653461:1 gene:WBGene00014086.1 transcript:ZK809.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK809.3)

HSP 1 Score: 48.521 bits (114), Expect = 9.798e-7
Identity = 51/165 (30.91%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  188 FHFDRERLSGA-YGEEDRKLRKQYLQDLTLSNREPVFVEGAY-PVNFFRKAYMKPFHAV-VNLLXXXXXXXXXXXXRHSFHKYF--FIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPI--------RYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTET 643
             H   ER+  A     +R+ RK+++ D  L   EPV V+  +  +N  R AY  P+    ++ L+P FG  +G   R +  K    F+   + Y Y+K  Y  KDWTH  RGL  M  +  I        ++P   D  + N   DD+Y   F  RT  ++  ET
Sbjct:   45 LHMADERVRAAGLSPAEREWRKKWVHDQHLHADEPVVVDAVHRQLNPIRTAYRLPWDKFYLHYLKPTFGVYYGTAIRVTAPKLLMAFVVVQTAYYYWK--YEVKDWTH-LRGLESMPQKEVIASAPAIEEKFPGLMDKGLANPSKDDYYTPTFNKRTAYLDVGET 206          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Celegans
Match: ZK809.3 (pep chromosome:WBcel235:IV:11652403:11653432:1 gene:WBGene00014086.1 transcript:ZK809.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK809.3)

HSP 1 Score: 48.521 bits (114), Expect = 9.798e-7
Identity = 51/165 (30.91%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  188 FHFDRERLSGA-YGEEDRKLRKQYLQDLTLSNREPVFVEGAY-PVNFFRKAYMKPFHAV-VNLLXXXXXXXXXXXXRHSFHKYF--FIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPI--------RYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTET 643
             H   ER+  A     +R+ RK+++ D  L   EPV V+  +  +N  R AY  P+    ++ L+P FG  +G   R +  K    F+   + Y Y+K  Y  KDWTH  RGL  M  +  I        ++P   D  + N   DD+Y   F  RT  ++  ET
Sbjct:   45 LHMADERVRAAGLSPAEREWRKKWVHDQHLHADEPVVVDAVHRQLNPIRTAYRLPWDKFYLHYLKPTFGVYYGTAIRVTAPKLLMAFVVVQTAYYYWK--YEVKDWTH-LRGLESMPQKEVIASAPAIEEKFPGLMDKGLANPSKDDYYTPTFNKRTAYLDVGET 206          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Match: A0A4S2MAU1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001437 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.097e-31
Identity = 73/192 (38.02%), Postives = 104/192 (54.17%), Query Frame = 2
Query:   80 DDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTETSTMI 655
            D +  E +QK LY+DQL+R    KKGSK+ P NIEP   +R+RL+  + ++DR LRKQ+L DL LS REPV V     VN FR+AY KPF  + +L++P  GP    + R + HK+         ++YK  Y  KDW +  RG+   +Y  P+ +P              F D    +R F +E+ E  T +
Sbjct:   13 DPEVLE-IQKKLYKDQLIRQAIAKKGSKYYPVNIEPTPLERDRLALPFTDQDRALRKQWLDDLVLSEREPVAVPEWTRVNIFRRAYRKPFDVLADLVKPVIGPTSARYFRWTLHKFTLGLLAGWVIWYKAKYAPKDWEYGLRGIRVDKYTKPVYFPGQ----------PGFPDNVVLTREFAMEDFELRTAL 193          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Match: A0A504YGF8 (NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 OS=Fasciola gigantica OX=46835 GN=FGIG_08379 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.333e-29
Identity = 75/190 (39.47%), Postives = 110/190 (57.89%), Query Frame = 2
Query:   80 DDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSR-TFQVENTETS 646
            D +  E LQK LY++QL++  TIK+GSK+ P +IEPF  +R+RL+  + +EDR LRKQ++ D  LS REPV V     VN FR+ Y KPF A+ ++++P  GP++  + R +  K F+  A S  ++Y+  Y+ K W +  RG+   Q   P  +P   D     +   DF  E F  R TF+  N  TS
Sbjct:   18 DPEVLE-LQKKLYKEQLIKQATIKRGSKYYPVSIEPFALERDRLALPFTDEDRALRKQWITDQALSAREPVAVPEWTRVNIFRRIYRKPFDALTSMIKPIVGPEYSRYFRWTAPKVFWTLALSWTLWYQVKYVPKTWEYSRRGIRIEQAYKPKIHPGQPDFPNSPRLTRDFAMEDFDRRVTFRGPNLVTS 206          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Match: A0A419QHL1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_8531s PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.290e-29
Identity = 73/192 (38.02%), Postives = 104/192 (54.17%), Query Frame = 2
Query:   80 DDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTETSTMI 655
            D +  E +QK LY+DQL+R    KKGSK+ P NIEP   +R+RL+  + ++DR LRKQ+L DL LS REPV V     VN FR+AY KPF  + +L++P  GP    + R + HK+         ++YK  Y  KDW +  RG+   +Y  P+ +P              F D    +R F +E+ E  T +
Sbjct:  151 DPEVLE-IQKKLYKDQLIRQAIAKKGSKYYPVNIEPTPLERDRLALPFNDQDRALRKQWLDDLVLSEREPVAVPEWTRVNIFRRAYRKPFDIIADLVKPVIGPTSARYFRWTLHKFTLGLLAGWVIWYKAKYAPKDWEYNARGIRVDRYTKPVYFPGQ----------PGFPDNVALTREFAMEDFELRTAL 331          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Match: A0A2H1CEU7 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_004160 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.064e-28
Identity = 73/190 (38.42%), Postives = 109/190 (57.37%), Query Frame = 2
Query:   80 DDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSR-TFQVENTETS 646
            D +  E LQK LY++QL++  TIK+GSK+ P +IEPF  +R+RL+  + +EDR LRKQ++ D  LS REPV V     VN FR+ Y KPF  + ++++P  GP++  + R +  K F+  A S  ++Y+  Y+ K W +  RG+   +   P  +P   D     +   DF  E F  R TF+  N  TS
Sbjct:   18 DPEVLE-LQKKLYKEQLIKQATIKRGSKYYPVSIEPFALERDRLALPFTDEDRALRKQWITDQALSAREPVAVPEWTRVNIFRRIYRKPFDILTSMIKPIVGPEYSRYFRWTAPKVFWTLALSWTLWYQVKYVPKTWEYSRRGIRIEKAYKPRIHPGQSDFPNSPRLTRDFAMEDFDRRVTFRGPNLVTS 206          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Match: A0A4Z2DTV9 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005660 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.234e-23
Identity = 64/178 (35.96%), Postives = 99/178 (55.62%), Query Frame = 2
Query:  101 LQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPI-----RYPDSFDPAIINKHGDDFYDEGFKSRT 619
            +QK +YR+ L++   +K+GS+F P  +EP+ F+R RL+  +  +DR  R+QYL+D  LS+REPV +     VN FR+ Y KPF A+ NL+ P  G ++  + R++  K   +  FS +++Y H+    +W    + L    Y+  I      YPD +      K  DDF  EGF  RT
Sbjct:   19 IQKKIYRELLIKQACVKRGSEFFPVTLEPYQFERHRLAQPFTNKDRAARRQYLEDQLLSDREPVNIPEWNRVNIFRRMYRKPFDAMTNLIRPLVGDQYSRYFRYTMPKITGMLLFSWFLWY-HVKYHDNWEKHAKSLKSGAYRGSIWPGEPGYPDRW------KEVDDFGMEGFNRRT 189          
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Planmine SMEST
Match: SMESG000026865.1 (SMESG000026865.1)

HSP 1 Score: 407.912 bits (1047), Expect = 2.957e-146
Identity = 212/213 (99.53%), Postives = 212/213 (99.53%), Query Frame = 2
Query:   29 MKAKSDEVKFDLPKKESDDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLXXXXXXXXXXXXRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTETSTMISTPV 667
            MKA SDEVKFDLPKKESDDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLEPFFGPKFGEFGRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTETSTMISTPV
Sbjct:    1 MKATSDEVKFDLPKKESDDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFNIEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFRKAYMKPFHAVVNLLEPFFGPKFGEFGRHSFHKYFFIAAFSLYVYYKHIYLEKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQVENTETSTMISTPV 213          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZK809.39.798e-730.91pep chromosome:WBcel235:IV:11652403:11653461:1 gen... [more]
ZK809.39.798e-730.91pep chromosome:WBcel235:IV:11652403:11653432:1 gen... [more]
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MAU12.097e-3138.02Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YGF81.333e-2939.47NADH dehydrogenase ubiquinone 1 beta subcomplex su... [more]
A0A419QHL13.290e-2938.02Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A2H1CEU73.064e-2838.42Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4Z2DTV91.234e-2335.96Uncharacterized protein OS=Schistosoma japonicum O... [more]
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026865.12.957e-14699.53SMESG000026865.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021774 ID=SMED30021774|Name=NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 6|organism=Schmidtea mediterranea sexual|type=transcript|length=755bp
AATCTATATAAATCTTATATGTTAACCTATGAAAGCAAAGTCAGATGAAG
TTAAATTTGATCTTCCAAAGAAAGAGTCTGATGATCAGGCTTTCGAAATG
CTACAGAAAAATCTTTACAGAGATCAATTGATGAGAGATTATACTATTAA
GAAAGGTAGTAAATTCAATCCATTCAATATAGAGCCATTTCACTTTGATC
GTGAAAGACTTTCGGGGGCTTATGGTGAAGAAGACCGGAAATTACGAAAG
CAATATCTTCAAGATCTAACTTTATCCAATCGAGAGCCAGTATTTGTTGA
AGGTGCATATCCTGTTAATTTTTTTCGTAAAGCCTATATGAAACCTTTTC
ACGCGGTTGTTAATTTATTGGAACCTTTTTTTGGTCCCAAATTTGGAGAA
TTTGGACGTCATTCTTTCCACAAGTATTTCTTCATTGCTGCGTTTTCTTT
ATATGTTTATTATAAACATATTTATCTTGAAAAGGATTGGACTCATCGAT
TTAGAGGACTGACGTTCATGCAATATCAAGTTCCTATTCGATATCCCGAT
TCGTTCGATCCCGCCATTATTAATAAGCACGGGGATGATTTTTACGATGA
AGGATTTAAAAGCCGCACATTTCAGGTAGAGAATACAGAAACAAGCACGA
TGATATCTACTCCAGTCAAGAAAAAATAATTAGAATATTGAAATAATTAT
AAATTAGTTTTCTACTAGGTTTATAATAATATGAAAAAATTTGACTTATT
TTCTC
back to top

protein sequence of SMED30021774-orf-1

>SMED30021774-orf-1 ID=SMED30021774-orf-1|Name=SMED30021774-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MKAKSDEVKFDLPKKESDDQAFEMLQKNLYRDQLMRDYTIKKGSKFNPFN
IEPFHFDRERLSGAYGEEDRKLRKQYLQDLTLSNREPVFVEGAYPVNFFR
KAYMKPFHAVVNLLEPFFGPKFGEFGRHSFHKYFFIAAFSLYVYYKHIYL
EKDWTHRFRGLTFMQYQVPIRYPDSFDPAIINKHGDDFYDEGFKSRTFQV
ENTETSTMISTPVKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005747mitochondrial respiratory chain complex I
Vocabulary: biological process
TermDefinition
GO:0006120mitochondrial electron transport, NADH to ubiquinone
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR019174NADH_DH_b-subcmplx_su6
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019174NADH dehydrogenase 1, beta subcomplex, subunit 6PFAMPF09782NDUF_B6coord: 57..192
e-value: 1.8E-13
score: 50.9
NoneNo IPR availablePANTHERPTHR21106UNCHARACTERIZEDcoord: 28..198