AMP deaminase

Overview
NameAMP deaminase
Smed IDSMED30021767
Length (bp)2635
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AMP deaminase (SMED30021767) t-SNE clustered cells

Violin plots show distribution of expression levels for AMP deaminase (SMED30021767) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AMP deaminase (SMED30021767) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AMP deaminase (SMED30021767) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021767

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021767h1SMcG0006228 SmedASXL_014006SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30021767h1SMcG0006228 Contig5055GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021767h1SMcG0006228 Contig54158newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021767h1SMcG0006228 Contig54158uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021767h1SMcG0007273 Contig5055GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30021767h1SMcG0006228 dd_Smed_v6_9436_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021767h1SMcG0006228 dd_Smed_v4_9436_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  165 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 796          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  165 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 796          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  138 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 769          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  219 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 850          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  101 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 732          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 356/647 (55.02%), Postives = 453/647 (70.02%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKD--GVMAVYNPSDGSK----IHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            NYQR+AI G E + + LE+++  +  L+ A  +R +YM      F  TT  +LS      N   H   N + T+Q                  FN P    D +  +    K+E  +  +   GV  + N  DGS      +  V   EF+ D   L+  + DGPLKSFCF+RL++L  +F++H LLNE +E  EQK V+HRDFYNIRKVDTHIHA+SSMNQKHLLRFIKK IK   +  V+    +G  +++ EVFK M +  YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+F+KTDNY  G++FA ++KEV++DLE+SKYQ+AE RLS+YGR  NEWD+LAKWA+T+ V+S N +W++Q PR+YD++R K ++K+F +ML N+FTPLFEVT DPSSHPELH FL  +SG DSVDDESK E    D++T  P  +   +NPPY YYL+YMY N+  LN  R  RG++ F  RPHCGEAG V HL+ G+L   +I HG+LLRK PVLQYLYYL QIGIAMSPLSNNSLF+ YQRNPL +++ +GL+VSLSTDDPLQFH+TKE LMEE+SIAAQVWK +S DMCELARNSVM SGF D +K  WLG  +KEEGV GND+ RTNVP+IR++FR EAL  E
Sbjct:  208 NYQRMAITGEELSGVPLEDLKTASGHLIEALHLRSKYMERIGNQFPSTTRNFLS-GHYPANLPKHRVKNTETTVQTS----------------FNPPDPPKDHWGKNDPLPKYEKIYHLRRNRGVTEICN-DDGSIDQQFKNVNVTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVL--NNNGTKVTMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDE 834          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 356/647 (55.02%), Postives = 453/647 (70.02%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKD--GVMAVYNPSDGSK----IHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            NYQR+AI G E + + LE+++  +  L+ A  +R +YM      F  TT  +LS      N   H   N + T+Q                  FN P    D +  +    K+E  +  +   GV  + N  DGS      +  V   EF+ D   L+  + DGPLKSFCF+RL++L  +F++H LLNE +E  EQK V+HRDFYNIRKVDTHIHA+SSMNQKHLLRFIKK IK   +  V+    +G  +++ EVFK M +  YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+F+KTDNY  G++FA ++KEV++DLE+SKYQ+AE RLS+YGR  NEWD+LAKWA+T+ V+S N +W++Q PR+YD++R K ++K+F +ML N+FTPLFEVT DPSSHPELH FL  +SG DSVDDESK E    D++T  P  +   +NPPY YYL+YMY N+  LN  R  RG++ F  RPHCGEAG V HL+ G+L   +I HG+LLRK PVLQYLYYL QIGIAMSPLSNNSLF+ YQRNPL +++ +GL+VSLSTDDPLQFH+TKE LMEE+SIAAQVWK +S DMCELARNSVM SGF D +K  WLG  +KEEGV GND+ RTNVP+IR++FR EAL  E
Sbjct:  145 NYQRMAITGEELSGVPLEDLKTASGHLIEALHLRSKYMERIGNQFPSTTRNFLS-GHYPANLPKHRVKNTETTVQTS----------------FNPPDPPKDHWGKNDPLPKYEKIYHLRRNRGVTEICN-DDGSIDQQFKNVNVTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVL--NNNGTKVTMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDE 771          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 359/650 (55.23%), Postives = 458/650 (70.46%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLT--MQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI-DKLPEKFEVEFAFKD--GVMAVYNPSDGSK----IHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            NYQR+AI G E + + LE+++  +  L+ A  +R +YM      F  TT  +LS      N   H   N + T  +         +++  S    FN P    D +   D LP K+E  +  +   GV  + N  DGS      +  V   EF+ D   L+  + DGPLKSFCF+RL++L  +F++H LLNE +E  EQK V+HRDFYNIRKVDTHIHA+SSMNQKHLLRFIKK IK   +  V+    +G  +++ EVFK M +  YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+F+KTDNY  G++FA ++KEV++DLE+SKYQ+AE RLS+YGR  NEWD+LAKWA+T+ V+S N +W++Q PR+YD++R K ++K+F +ML N+FTPLFEVT DPSSHPELH FL  +SG DSVDDESK E    D++T  P  +   +NPPY YYL+YMY N+  LN  R  RG++ F  RPHCGEAG V HL+ G+L   +I HG+LLRK PVLQYLYYL QIGIAMSPLSNNSLF+ YQRNPL +++ +GL+VSLSTDDPLQFH+TKE LMEE+SIAAQVWK +S DMCELARNSVM SGF D +K  WLG  +KEEGV GND+ RTNVP+IR++FR EAL  E
Sbjct:  295 NYQRMAITGEELSGVPLEDLKTASGHLIEALHLRSKYMERIGNQFPSTTRNFLSG-HYPANLPKHRVKNTETTQVLFHPPSVPDLEAVQTS----FNPPDPPKDHWGKNDPLP-KYEKIYHLRRNRGVTEICN-DDGSIDQQFKNVNVTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVL--NNNGTKVTMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDE 935          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 357/647 (55.18%), Postives = 456/647 (70.48%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKD--GVMAVYNPSDGSK----IHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            NYQR+AI G E + + LE+++  +  L+ A  +R +YM      F  TT  +LS      N   H  + N  T Q      S   + ++    FN P    D +  +    K+E  +  +   GV  + N  DGS      +  V   EF+ D   L+  + DGPLKSFCF+RL++L  +F++H LLNE +E  EQK V+HRDFYNIRKVDTHIHA+SSMNQKHLLRFIKK IK   +  V+    +G  +++ EVFK M +  YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+F+KTDNY  G++FA ++KEV++DLE+SKYQ+AE RLS+YGR  NEWD+LAKWA+T+ V+S N +W++Q PR+YD++R K ++K+F +ML N+FTPLFEVT DPSSHPELH FL  +SG DSVDDESK E    D++T  P  +   +NPPY YYL+YMY N+  LN  R  RG++ F  RPHCGEAG V HL+ G+L   +I HG+LLRK PVLQYLYYL QIGIAMSPLSNNSLF+ YQRNPL +++ +GL+VSLSTDDPLQFH+TKE LMEE+SIAAQVWK +S DMCELARNSVM SGF D +K  WLG  +KEEGV GND+ RTNVP+IR++FR EAL  E
Sbjct:  169 NYQRMAITGEELSGVPLEDLKTASGHLIEALHLRSKYMERIGNQFPSTTRNFLS-GHYPANLPKHR-VKNTETTQVLFHPPSVPDL-EAVQTSFNPPDPPKDHWGKNDPLPKYEKIYHLRRNRGVTEICN-DDGSIDQQFKNVNVTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVL--NNNGTKVTMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDE 809          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0303292)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 375/646 (58.05%), Postives = 476/646 (73.68%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKED--DSQSGKSINQSKD-HPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            N+QR++I G + + + LE+++  +  L+ A R+R  YM +S Q F  TT R+L      V   D   INN    +  D     S  +I +S D H  ++P    +P+N++  P   + +    +GV  +Y N  + S+I     D  +FV D   +   ++DGPLKSFC++RL +L+ +++MH LLNE +E A QK+V HRDFYN RKVDTHIHA+S MNQKHLLRFIKK +K + NE V +   +G+ ++L +VF+SM+LT YDLT+D LDVH DR+TFHRFDKFN+KYNP+G+S LREVFLKTDNY NG++FA +IKEV  DLEESKYQNAELRLS+YG+  +EW  LAKWA+ N VYS N++W+IQ PR++DIF++  ++KSFQE+L+NIF PLFE T  PS HPELH FL +V GFDSVDDESK E+ + D +   PE W  ++NPPYAYY+YYMYANM+VLN+ R  R M+ F  RPHCGEAGPVQHLV GFL+  NI+HGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSVMMSGF   IK  WLG  + E+G+ GND+ RTNVP IR+A+R+E L  E
Sbjct:  134 NFQRVSISGEDTSGVPLEDLERASTLLIEALRLRSHYMAMSDQSFPSTTARFLK----TVKLKDR--INNLPVKEVSDIIRKMSVANIQESADVHLRHSPMKITNPWNVE-FPNDEDFKIKPLNGVFHIYENDDESSEIKYEYPDMSQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTV--TNGQQMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDE 770          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0340445)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 372/643 (57.85%), Postives = 472/643 (73.41%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            N+QR++I G + + + LE+++  +  L+ A R+R  YM +S Q F  TT R+L      V   D   INN    +  D  +     N    H  ++P    +P+N++  P   + +    +GV  +Y N  + S+I     D  +FV D   +   ++DGPLKSFC++RL +L+ +++MH LLNE +E A QK+V HRDFYN RKVDTHIHA+S MNQKHLLRFIKK +K + NE V +   +G+ ++L +VF+SM+LT YDLT+D LDVH DR+TFHRFDKFN+KYNP+G+S LREVFLKTDNY NG++FA +IKEV  DLEESKYQNAELRLS+YG+  +EW  LAKWA+ N VYS N++W+IQ PR++DIF++  ++KSFQE+L+NIF PLFE T  PS HPELH FL +V GFDSVDDESK E+ + D +   PE W  ++NPPYAYY+YYMYANM+VLN+ R  R M+ F  RPHCGEAGPVQHLV GFL+  NI+HGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSVMMSGF   IK  WLG  + E+G+ GND+ RTNVP IR+A+R+E L  E
Sbjct:  134 NFQRVSISGEDTSGVPLEDLERASTLLIEALRLRSHYMAMSDQSFPSTTARFLK----TVKLKDR--INNLPVKEVSDIIRKMSVANIQDVHLRHSPMKITNPWNVE-FPNDEDFKIKPLNGVFHIYENDDESSEIKYEYPDMSQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTV--TNGQQMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDE 767          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0309246)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 368/644 (57.14%), Postives = 475/644 (73.76%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKD-HPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            N+QR++I G + + + LE+++  +  L+ A R+R  YM +S Q F  TT R+L  ++                ++   ++   K +++S D H  ++P    +P+N++  P   + +    +GV  +Y N  + S+I     D  +FV D   +   ++DGPLKSFC++RL +L+ +++MH LLNE +E A QK+V HRDFYN RKVDTHIHA+S MNQKHLLRFIKK +K + NE V +   +G+ ++L +VF+SM+LT YDLT+D LDVH DR+TFHRFDKFN+KYNP+G+S LREVFLKTDNY NG++FA +IKEV  DLEESKYQNAELRLS+YG+  +EW  LAKWA+ N VYS N++W+IQ PR++DIF++  ++KSFQE+L+NIF PLFE T  PS HPELH FL +V GFDSVDDESK E+ + D +   PE W  ++NPPYAYY+YYMYANM+VLN+ R  R M+ F  RPHCGEAGPVQHLV GFL+  NI+HGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSVMMSGF   IK  WLG  + E+G+ GND+ RTNVP IR+A+R+E L  E
Sbjct:  134 NFQRVSISGEDTSGVPLEDLERASTLLIEALRLRSHYMAMSDQSFPSTTARFLKTVK----------------LKDRINNLPVKEVSESADVHLRHSPMKITNPWNVE-FPNDEDFKIKPLNGVFHIYENDDESSEIKYEYPDMSQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTV--TNGQQMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDE 758          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0301046)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 368/644 (57.14%), Postives = 470/644 (72.98%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKD-HPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            N+QR++I G + + + LE+++  +  L+ A R+R  YM +S Q F  TT R+L  +                   K  D  +   + +  D H  ++P    +P+N++  P   + +    +GV  +Y N  + S+I     D  +FV D   +   ++DGPLKSFC++RL +L+ +++MH LLNE +E A QK+V HRDFYN RKVDTHIHA+S MNQKHLLRFIKK +K + NE V +   +G+ ++L +VF+SM+LT YDLT+D LDVH DR+TFHRFDKFN+KYNP+G+S LREVFLKTDNY NG++FA +IKEV  DLEESKYQNAELRLS+YG+  +EW  LAKWA+ N VYS N++W+IQ PR++DIF++  ++KSFQE+L+NIF PLFE T  PS HPELH FL +V GFDSVDDESK E+ + D +   PE W  ++NPPYAYY+YYMYANM+VLN+ R  R M+ F  RPHCGEAGPVQHLV GFL+  NI+HGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSVMMSGF   IK  WLG  + E+G+ GND+ RTNVP IR+A+R+E L  E
Sbjct:  134 NFQRVSISGEDTSGVPLEDLERASTLLIEALRLRSHYMAMSDQSFPSTTARFLKTV-------------------KLKDRINNLPVKEVSDVHLRHSPMKITNPWNVE-FPNDEDFKIKPLNGVFHIYENDDESSEIKYEYPDMSQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTV--TNGQQMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDE 755          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0073833)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 368/644 (57.14%), Postives = 475/644 (73.76%), Query Frame = 1
Query:  394 NYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKD-HPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            N+QR++I G + + + LE+++  +  L+ A R+R  YM +S Q F  TT R+L  ++                ++   ++   K +++S D H  ++P    +P+N++  P   + +    +GV  +Y N  + S+I     D  +FV D   +   ++DGPLKSFC++RL +L+ +++MH LLNE +E A QK+V HRDFYN RKVDTHIHA+S MNQKHLLRFIKK +K + NE V +   +G+ ++L +VF+SM+LT YDLT+D LDVH DR+TFHRFDKFN+KYNP+G+S LREVFLKTDNY NG++FA +IKEV  DLEESKYQNAELRLS+YG+  +EW  LAKWA+ N VYS N++W+IQ PR++DIF++  ++KSFQE+L+NIF PLFE T  PS HPELH FL +V GFDSVDDESK E+ + D +   PE W  ++NPPYAYY+YYMYANM+VLN+ R  R M+ F  RPHCGEAGPVQHLV GFL+  NI+HGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSVMMSGF   IK  WLG  + E+G+ GND+ RTNVP IR+A+R+E L  E
Sbjct:   64 NFQRVSISGEDTSGVPLEDLERASTLLIEALRLRSHYMAMSDQSFPSTTARFLKTVK----------------LKDRINNLPVKEVSESADVHLRHSPMKITNPWNVE-FPNDEDFKIKPLNGVFHIYENDDESSEIKYEYPDMSQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTV--TNGQQMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDE 688          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2b (adenosine monophosphate deaminase 2b [Source:ZFIN;Acc:ZDB-GENE-070713-5])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 377/647 (58.27%), Postives = 478/647 (73.88%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKED----DSQSGKSINQSKDHPFNAPGTQGDPY-NID--KLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK ++ A  +R +Y+++S Q F +TT RYL                 +L+ Q  D    D  S  SI  S D   + P ++  PY ++D   +P          DGV+ VY  +         D  E++ D + +   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +P E V +E+  G+  +L EVF+SM+LT +DL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN+  G++F H+IKEVMADLEESKYQN ELRLS+YGR  +EWD LA+WAVT+KVYSDNV+W++Q PR++D++ TK  + +FQEML NIF PLFEVT +PSSHPELH FL HV GFDSVDDESK E  + + ++  P NW  +DNPPY+YYLYYMYANM+VLN LR QR M+ F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS+ +KS+WLG  + +EG +GND+ RTNVP+IR+A+RFE L  E
Sbjct:  101 YQRVTISGEEKCGVPFTDLLDAAKCVVKALFIREKYISLSLQSFCRTTARYL---------------QEELSEQTPDISTFDEMSESSI--SADATVHPPVSKTHPYESLDPANMPPALGYTCKMVDGVVHVYTHNSSELDLPYPDLQEYIADMNMMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPGEIVHVEQGRGQ--TLTEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIEGKYFGHIIKEVMADLEESKYQNVELRLSIYGRSRDEWDKLAQWAVTHKVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLANIFMPLFEVTVNPSSHPELHLFLQHVVGFDSVDDESKPEHHIFNLDSPKPVNWTDEDNPPYSYYLYYMYANMTVLNHLRRQRNMNSFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSNQVKSYWLGPHYIKEGQEGNDIRRTNVPDIRVAYRFETLCEE 728          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2b (adenosine monophosphate deaminase 2b [Source:ZFIN;Acc:ZDB-GENE-070713-5])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 377/647 (58.27%), Postives = 478/647 (73.88%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKED----DSQSGKSINQSKDHPFNAPGTQGDPY-NID--KLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK ++ A  +R +Y+++S Q F +TT RYL                 +L+ Q  D    D  S  SI  S D   + P ++  PY ++D   +P          DGV+ VY  +         D  E++ D + +   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +P E V +E+  G+  +L EVF+SM+LT +DL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN+  G++F H+IKEVMADLEESKYQN ELRLS+YGR  +EWD LA+WAVT+KVYSDNV+W++Q PR++D++ TK  + +FQEML NIF PLFEVT +PSSHPELH FL HV GFDSVDDESK E  + + ++  P NW  +DNPPY+YYLYYMYANM+VLN LR QR M+ F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS+ +KS+WLG  + +EG +GND+ RTNVP+IR+A+RFE L  E
Sbjct:  101 YQRVTISGEEKCGVPFTDLLDAAKCVVKALFIREKYISLSLQSFCRTTARYL---------------QEELSEQTPDISTFDEMSESSI--SADATVHPPVSKTHPYESLDPANMPPALGYTCKMVDGVVHVYTHNSSELDLPYPDLQEYIADMNMMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPGEIVHVEQGRGQ--TLTEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIEGKYFGHIIKEVMADLEESKYQNVELRLSIYGRSRDEWDKLAQWAVTHKVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLANIFMPLFEVTVNPSSHPELHLFLQHVVGFDSVDDESKPEHHIFNLDSPKPVNWTDEDNPPYSYYLYYMYANMTVLNHLRRQRNMNSFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSNQVKSYWLGPHYIKEGQEGNDIRRTNVPDIRVAYRFETLCEE 728          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 366/645 (56.74%), Postives = 470/645 (72.87%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY---NPSDGS-KIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR++I G E+  +   ++ + AK ++ A  +R +YM++S Q F +TT  +LS +          F++                     D   + P ++  PY    LP       A  DGV  VY   NP D S ++     D  E++ D + +   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +P+E V IE   G+  +L++VF++M+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN+ +G++F H++KEVM+DLEESKYQNAELRLSVYGR  +EWD LAKWAVT+ VYSDNV+W++Q PR++D++RTK  + +FQ+ML NIF PLFEVT +PSSHP+LH FL HV GFDSVDDESK E  + + ++ +P  W   DNPPY+YYLYYMYANM+VLN LR +RG   F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS   KS WLG  + +EG   ND+ RTNVP+IR+A+R+E +  E
Sbjct:  123 FQRVSISGEEKCGVPFTDLVDAAKCVVKALFIREKYMSLSLQNFSRTTLSFLSHLRLVCV-----FVS---------------------DVSVHPPVSKTHPYEEQNLPSDLGYSCAMVDGVFHVYTTQNPKDKSTELDLPYPDLQEYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPDEIVHIENGRGQ--TLMDVFENMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSVYGRSMDEWDKLAKWAVTHSVYSDNVRWLVQIPRLFDVYRTKKQLSNFQQMLENIFLPLFEVTINPSSHPQLHLFLQHVVGFDSVDDESKPEHHIFNLDSPSPARWCDDDNPPYSYYLYYMYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKSKSHWLGPDYTKEGPISNDIRRTNVPDIRVAYRYETMCEE 739          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 368/645 (57.05%), Postives = 474/645 (73.49%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYL-SLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY---NPSDGSKIHCGV-DYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR++I G E+  +   ++ + AK ++ A  +R +YM++S Q F +TT R L  L E  ++TN +  ++       E    S  S+     HP   P ++  PY    LP       A  DGV  VY   NP D +++     D  E++ D + +   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +P+E V IE  +GR  +L++VF++M+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN+ +G++F H++KEVM+DLEESKYQNAELRLSVYGR  +EWD LAKWAVT+ VYSDNV+W++Q PR++D++RTK  + +FQ+ML NIF PLFEVT +PSSHP+LH FL HV GFDSVDDESK E  + + ++ +P  W   DNPPY+YYLYYMYANM+VLN LR +RG   F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTK     EYSIA QVWK +S DMCELARNSV+MSGFS   KS WLG  + +EG   ND+ RTNVP+IR+A+R+E +  E
Sbjct:  144 FQRVSISGEEKCGVPFTDLVDAAKCVVKALFIREKYMSLSLQNFSRTTARCLRELNERPLDTNIYEELH-------ESPVDSDVSV-----HP---PVSKTHPYEEQNLPSDLGYSCAMVDGVFHVYTTQNPKDNTELDLPYPDLQEYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPDEIVHIE--NGRGQTLMDVFENMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSVYGRSMDEWDKLAKWAVTHSVYSDNVRWLVQIPRLFDVYRTKKQLSNFQQMLENIFLPLFEVTINPSSHPQLHLFLQHVVGFDSVDDESKPEHHIFNLDSPSPARWCDDDNPPYSYYLYYMYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTK-----EYSIATQVWKLSSCDMCELARNSVLMSGFSHKSKSHWLGPDYTKEGPISNDIRRTNVPDIRVAYRYETMCEE 766          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd3b (adenosine monophosphate deaminase 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5929])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 327/647 (50.54%), Postives = 444/647 (68.62%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG-----VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P +QR+ I G     + +E+ ++ AK+LLTA  +R +Y  ++   F +T  ++L               NN+   +  +D +    I  S       P    DPY+++ LP+        KDG++ VY+  D  K          D   F  D   +   ++DGP K++C +RLNFL  +F++H +LNE  E  E K V HRDFYN+RKVDTHIHA++ MNQKHLL+FI+   +   + +V++EK  G+  +L +VF+++ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG +ELRE++LKTDNY NG +FA +IKEV  DLEESKYQ+AE RLS+YGR   EW+SL+KW +  K++S N++WMIQ PRIYDIFR+K II +F +ML NIF PLF+ T +P  H E+H FL HV+GFDSVDDESK    + +  +  PE W  ++NPPY YYL++MYAN+ VLN LR +RG++ F FRPHCGEAG + HLV+ FL   NI+HGL L+K+PVLQYLYYL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL VSLSTDDPLQFH+TKE LMEEY+IAAQ+WK ++ D CE+ARNSV+ SG S   K ++LG+++ ++G +GND+ +TNV  IR+A+R E L  E
Sbjct:  139 PEFQRVTISGDYCAGITVEDYEQAAKSLLTALFIREKYSRLAYHRFPRTAAKFL------------RSANNE---KWSEDEEVLPDICPS-------PSEGEDPYSMEDLPQNLNYSLKMKDGIIYVYDNEDALKQDLPRSLPYPDLETFAIDLSHVLAMIADGPTKTYCHRRLNFLTSKFQLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLKFIQDSYQTEAD-RVVLEKG-GKKFTLKQVFENLKMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGANELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQHAEPRLSIYGRAPEEWESLSKWFIMQKLHSPNMRWMIQVPRIYDIFRSKKIIANFAKMLENIFLPLFQATVNPQKHKEMHVFLKHVTGFDSVDDESKHSDHIFNYKSPKPEEWTSEENPPYTYYLFHMYANIMVLNNLRKERGLNTFLFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLYYLAQVPIAMSPLSNNSLFLEYSKNPLREFLQKGLCVSLSTDDPLQFHYTKEALMEEYAIAAQLWKLSTCDTCEIARNSVLQSGLSHQEKKYFLGEKYLDDGPEGNDIRKTNVAQIRMAYRHETLCNE 761          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 368/648 (56.79%), Postives = 470/648 (72.53%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI---DKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK+++ A  +R++YMN+S Q F +TT R+L  +  G   +                 + G     + D P + P     PY +     +P          +GV+ VY   D + ++  +D       EFV D + L   + +GP+KSFC++RL +L+ RF+MH LLNE KE A QK V HRDFYNIRKVDTHIHA+S MNQKHLLRFIK+ +K +  E V +E   G+  +L +VF++M+LT YDL++D LDVH DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN  +G +FAH+IKEVM+DLEESKYQNAELRLS+YGR   EWDSLA WAV +KV+S+NV+W++Q PR++D++R+K  I  FQEML NIF PLFEVT +P+SHPELH FL HV GFDSVDDESKSE  + + ++  PENW  +DNPPY+YYLYYMYANM+VLN +R +RG   F  RPHCGEAGP+ HLV+ ++L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL DF+ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGF   +KS+WLG ++ ++G + ND+ RTNVP+IR+ FR+E L  E
Sbjct:  153 YQRVTISGDEKCGVPFTDLLDAAKSVVRALFIRQKYMNMSMQSFCRTTARHLKELSEGALDSP--------------PQEEGPDTPVAPDAPVHPPFAVQHPYEVCDPSIMPPDLGFGLKMMNGVVHVYTKRDVTDMNTELDLPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKKNCEEIVHVE--GGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEE 784          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 368/648 (56.79%), Postives = 469/648 (72.38%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI---DKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK+++ A  +R++YMN+S Q F +TT R+L  +  G                     + G     + D P + P     PY +     +P          +GV+ VY   D + ++  +D       EFV D + L   + +GP+KSFC++RL +L+ RF+MH LLNE KE A QK V HRDFYNIRKVDTHIHA+S MNQKHLLRFIK+ +K +  E V +E   G+  +L +VF++M+LT YDL++D LDVH DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN  +G +FAH+IKEVM+DLEESKYQNAELRLS+YGR   EWDSLA WAV +KV+S+NV+W++Q PR++D++R+K  I  FQEML NIF PLFEVT +P+SHPELH FL HV GFDSVDDESKSE  + + ++  PENW  +DNPPY+YYLYYMYANM+VLN +R +RG   F  RPHCGEAGP+ HLV+ ++L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL DF+ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGF   +KS+WLG ++ ++G + ND+ RTNVP+IR+ FR+E L  E
Sbjct:  137 YQRVTISGDEKCGVPFTDLLDAAKSVVRALFIRQKYMNMSMQSFCRTTARHLKELSEGA--------------LDSPPQEEGPDTPVAPDAPVHPPFAVQHPYEVCDPSIMPPDLGFGLKMMNGVVHVYTKRDVTDMNTELDLPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKKNCEEIVHVE--GGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEE 768          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 368/648 (56.79%), Postives = 469/648 (72.38%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI---DKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK+++ A  +R++YMN+S Q F +TT R+L  +  G                     + G     + D P + P     PY +     +P          +GV+ VY   D + ++  +D       EFV D + L   + +GP+KSFC++RL +L+ RF+MH LLNE KE A QK V HRDFYNIRKVDTHIHA+S MNQKHLLRFIK+ +K +  E V +E   G+  +L +VF++M+LT YDL++D LDVH DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN  +G +FAH+IKEVM+DLEESKYQNAELRLS+YGR   EWDSLA WAV +KV+S+NV+W++Q PR++D++R+K  I  FQEML NIF PLFEVT +P+SHPELH FL HV GFDSVDDESKSE  + + ++  PENW  +DNPPY+YYLYYMYANM+VLN +R +RG   F  RPHCGEAGP+ HLV+ ++L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL DF+ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGF   +KS+WLG ++ ++G + ND+ RTNVP+IR+ FR+E L  E
Sbjct:  137 YQRVTISGDEKCGVPFTDLLDAAKSVVRALFIRQKYMNMSMQSFCRTTARHLKELSEGA--------------LDSPPQEEGPDTPVAPDAPVHPPFAVQHPYEVCDPSIMPPDLGFGLKMMNGVVHVYTKRDVTDMNTELDLPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKKNCEEIVHVE--GGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEE 768          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 368/643 (57.23%), Postives = 467/643 (72.63%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI---DKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK+++ A  +R++YMN+S Q F +TT R+L  +  G   +                 + G     + D P + P     PY +     +P          +GV+ VY   D    +   D  EFV D + L   + +GP+KSFC++RL +L+ RF+MH LLNE KE A QK V HRDFYNIRKVDTHIHA+S MNQKHLLRFIK+ +K +  E V +E   G+  +L +VF++M+LT YDL++D LDVH DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN  +G +FAH+IKEVM+DLEESKYQNAELRLS+YGR   EWDSLA WAV +KV+S+NV+W++Q PR++D++R+K  I  FQEML NIF PLFEVT +P+SHPELH FL HV GFDSVDDESKSE  + + ++  PENW  +DNPPY+YYLYYMYANM+VLN +R +RG   F  RPHCGEAGP+ HLV+ ++L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL DF+ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGF   +KS+WLG ++ ++G + ND+ RTNVP+IR+ FR+E L  E
Sbjct:  136 YQRVTISGDEKCGVPFTDLLDAAKSVVRALFIRQKYMNMSMQSFCRTTARHLKELSEGALDSP--------------PQEEGPDTPVAPDAPVHPPFAVQHPYEVCDPSIMPPDLGFGLKMMNGVVHVYTKRDLDLPY--PDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKKNCEEIVHVE--GGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEE 760          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 368/643 (57.23%), Postives = 466/643 (72.47%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNI---DKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            YQR+ I G E+  +   ++ + AK+++ A  +R++YMN+S Q F +TT R+L  +  G                     + G     + D P + P     PY +     +P          +GV+ VY   D    +   D  EFV D + L   + +GP+KSFC++RL +L+ RF+MH LLNE KE A QK V HRDFYNIRKVDTHIHA+S MNQKHLLRFIK+ +K +  E V +E   G+  +L +VF++M+LT YDL++D LDVH DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDN  +G +FAH+IKEVM+DLEESKYQNAELRLS+YGR   EWDSLA WAV +KV+S+NV+W++Q PR++D++R+K  I  FQEML NIF PLFEVT +P+SHPELH FL HV GFDSVDDESKSE  + + ++  PENW  +DNPPY+YYLYYMYANM+VLN +R +RG   F  RPHCGEAGP+ HLV+ ++L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL DF+ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGF   +KS+WLG ++ ++G + ND+ RTNVP+IR+ FR+E L  E
Sbjct:  136 YQRVTISGDEKCGVPFTDLLDAAKSVVRALFIRQKYMNMSMQSFCRTTARHLKELSEGA--------------LDSPPQEEGPDTPVAPDAPVHPPFAVQHPYEVCDPSIMPPDLGFGLKMMNGVVHVYTKRDLDLPY--PDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKKNCEEIVHVE--GGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEE 760          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 379/650 (58.31%), Postives = 470/650 (72.31%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T          T ++  D+        S D P + P  +  PY       +P    +      GV+ VY   D  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVMADLEESKYQNAELRLS+YGR  +EWD LA+WAV +KV+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  165 FQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETR---------TYEQSPDTPV------SADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTRRDPDE-HCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 796          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 379/650 (58.31%), Postives = 470/650 (72.31%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T          T ++  D+        S D P + P  +  PY       +P    +      GV+ VY   D  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVMADLEESKYQNAELRLS+YGR  +EWD LA+WAV +KV+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  139 FQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETR---------TYEQSPDTPV------SADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTRRDPDE-HCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 770          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 379/650 (58.31%), Postives = 470/650 (72.31%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T          T ++  D+        S D P + P  +  PY       +P    +      GV+ VY   D  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVMADLEESKYQNAELRLS+YGR  +EWD LA+WAV +KV+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  139 FQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETR---------TYEQSPDTPV------SADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTRRDPDE-HCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 770          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd3 (adenosine monophosphate deaminase 3 [Source:MGI Symbol;Acc:MGI:1096344])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 354/777 (45.56%), Postives = 486/777 (62.55%), Query Frame = 1
Query:   52 KEFPKIMDSELDKITNLY--RMRSRDGQQPFSKEIGSEFNMPK-FPIEKHELKSHIL--DLKFHSEVEFSETEDSSNLI------MDSPIMND----PLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHP-FNAPG-TQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPS---DGSKIHC--GVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            ++FPK+  S+LD+   L   ++ ++  ++  SK++ S F +P+  PI + E K   L  +L     VE ++ + S  +I      +  P   D    P     M     L    +             P YQR+ I G     + +E+ ++ AK+L  A  +R +Y  ++   F +TT +YL                          +  G+S+   +  P F+ P   Q DPY +D  P           GV+ VY+     +  + H     D   ++ D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E KS  HRDFYN+RKVDTHIHA++ MNQKHLLRFIK   +  P+  V   +  GR ++L +VF S+ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELR+++LKT+NY  G +FA ++KEV  +LE+SKYQ +E RLS+YGR   EW SLA+W + +KVYS N++W+IQ PRIYDIFR+K ++ +F +ML NIF PLF+ T +P  H ELH FL +V+GFDSVDDESK    +    + +P+ W  + NPPY+YYLYYMYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGLLL+K+PVLQYLYYL QI IAMSPLSNNSLFL+Y +NPL +F+ +GLHVSLSTDDP+QFH+TKE LMEEY+IAAQVWK ++ D+CE+ARNSV+ SG S   K  +LG+ + +EG +GND+ +TNV  IR+AFR+E L  E
Sbjct:   12 RQFPKLNMSDLDEHVRLLAEKVFAKVLREEDSKDVMSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPTQQDWKGPPTASPAMSPATPLVPGATSKPGPAPYAM---PEYQRVTISGDYCAGITVEDYEQAAKSLAKALMIREKYARLAYHRFPRTTAQYL--------------------------AHQGESVPLEEGLPDFHPPPLPQEDPYCLDDAPPNLGYLVRMHGGVLFVYDNQTMLERQEPHSLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVA--EKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNE 757          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd3 (adenosine monophosphate deaminase 3 [Source:MGI Symbol;Acc:MGI:1096344])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 354/777 (45.56%), Postives = 486/777 (62.55%), Query Frame = 1
Query:   52 KEFPKIMDSELDKITNLY--RMRSRDGQQPFSKEIGSEFNMPK-FPIEKHELKSHIL--DLKFHSEVEFSETEDSSNLI------MDSPIMND----PLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHP-FNAPG-TQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPS---DGSKIHC--GVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            ++FPK+  S+LD+   L   ++ ++  ++  SK++ S F +P+  PI + E K   L  +L     VE ++ + S  +I      +  P   D    P     M     L    +             P YQR+ I G     + +E+ ++ AK+L  A  +R +Y  ++   F +TT +YL                          +  G+S+   +  P F+ P   Q DPY +D  P           GV+ VY+     +  + H     D   ++ D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E KS  HRDFYN+RKVDTHIHA++ MNQKHLLRFIK   +  P+  V   +  GR ++L +VF S+ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELR+++LKT+NY  G +FA ++KEV  +LE+SKYQ +E RLS+YGR   EW SLA+W + +KVYS N++W+IQ PRIYDIFR+K ++ +F +ML NIF PLF+ T +P  H ELH FL +V+GFDSVDDESK    +    + +P+ W  + NPPY+YYLYYMYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGLLL+K+PVLQYLYYL QI IAMSPLSNNSLFL+Y +NPL +F+ +GLHVSLSTDDP+QFH+TKE LMEEY+IAAQVWK ++ D+CE+ARNSV+ SG S   K  +LG+ + +EG +GND+ +TNV  IR+AFR+E L  E
Sbjct:    3 RQFPKLNMSDLDEHVRLLAEKVFAKVLREEDSKDVMSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPTQQDWKGPPTASPAMSPATPLVPGATSKPGPAPYAM---PEYQRVTISGDYCAGITVEDYEQAAKSLAKALMIREKYARLAYHRFPRTTAQYL--------------------------AHQGESVPLEEGLPDFHPPPLPQEDPYCLDDAPPNLGYLVRMHGGVLFVYDNQTMLERQEPHSLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVA--EKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNE 748          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q01433|AMPD2_HUMAN (AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 375/650 (57.69%), Postives = 468/650 (72.00%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T  +               + G     S D P + P  +  PY       +P    +      GV+ VY   +  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  219 FQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTY---------------EQGPDTPVSADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDE-HCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 850          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q9DBT5|AMPD2_MOUSE (AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 PE=1 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 379/650 (58.31%), Postives = 470/650 (72.31%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T          T ++  D+        S D P + P  +  PY       +P    +      GV+ VY   D  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVMADLEESKYQNAELRLS+YGR  +EWD LA+WAV +KV+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  139 FQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETR---------TYEQSPDTPV------SADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTRRDPDE-HCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 770          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q02356|AMPD2_RAT (AMP deaminase 2 OS=Rattus norvegicus OX=10116 GN=Ampd2 PE=1 SV=2)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 377/650 (58.00%), Postives = 470/650 (72.31%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLS-LIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYN---IDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCG------VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G E+  +   ++ + AK+++ A  +R +YM +S Q F  TT RYL  L E  + T          T ++  D+        S D P + P  +  PY       +P    +      GV+ VY   D  + HC        D  EFV D + L   + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K H  E V +E+  GR  +L EVF+SM+LT YDL++D LDVH DR+TFHRFDKFNAKYNP+G+S LRE+F+KTDN  +G++FAH+IKEVM+DLEESKYQNAELRLS+YGR  +EWD LA+WAV ++V+S NV+W++Q PR++D++RTKG + +FQEML NIF PLFE T  P+SHPELH FL HV GFDSVDDESK E+ V +  +  PE WV +DNPPYAYYLYY +ANM++LN LR QRG   F  RPHCGEAGP+ HLV+ F+L  NI+HGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIA QVWK +S DMCELARNSV+MSGFS  +KS WLG  + +EG +GND+ RTNVP+IR+ +R+E L  E
Sbjct:  165 FQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETR---------TYEQSPDTPV------SADAPVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRRDPDE-HCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQ--GREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQE 796          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|O09178|AMPD3_RAT (AMP deaminase 3 OS=Rattus norvegicus OX=10116 GN=Ampd3 PE=1 SV=2)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 358/785 (45.61%), Postives = 491/785 (62.55%), Query Frame = 1
Query:   52 KEFPKIMDSELDKITNLY--RMRSRDGQQPFSKEIGSEFNMPK-FPIEKHELKSHIL--DLKFHSEVEFSETEDSSNLIMD------------------SPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHP-FNAPG-TQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPS---DGSKIHC--GVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            ++FPK+  S+LD+   L   ++ ++  ++  SK++ S F +PK  PI + E K   L  +L     VE ++ + S  +I                    SP M+ P   L      +LG A+   ++         P YQR  I G     + +E+ ++ AK+L  A  +R +Y  ++   F +TT +YL                          +  G+S+   +  P F+ P   Q DPY +D  P         + GV+ VY+     +  + H     D   ++ D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E KS  HRDFYN+RKVDTHIHA++ MNQKHLLRFIK   +  P+  V   +  GR ++L +VF S+ + PYDLT+D LDVH  R TFH FDKFN+KYNPVG SELR+++LKT+NY  G +FA ++KEV  +LE+SKYQ +E RLS+YGR   EW SLA+W + +KVYS N++W+IQ PRIYDIFR+K ++ SF +ML NIF PLF+ T +P  H ELH FL +V+GFDSVDDESK    +    + +P+ W  + NPPY+YYLYYMYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGLLL+K+PVLQYLYYL QI IAMSPLSNNSLFL+Y +NPL +F+ +GLHVSLSTDDP+QFH+TKE LMEEY+IAAQVWK ++ D+CE+ARNSV+ SG S   K  +LG+ + +EG +GND+ +TNV  IR+AFR+E L  E
Sbjct:    3 RQFPKLNMSDLDEHVRLLAEKVFAKVLREEDSKDVMSLFTVPKDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSMSLQMPTQDWKGPPSVSPAMS-PTTPL------VLGAASKPGLAPYDM-----PEYQRATISGDYCAGITMEDYEQAAKSLAKALMIREKYARLAYHRFPRTTAQYL--------------------------AHQGESVPLEEGLPDFHPPPLPQEDPYCLDDAPPNLGYLVRMQGGVLFVYDNQTMLERQEPHSLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKYTYQTEPDRTVA--EKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHGFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPSFGKMLENIFLPLFQATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNE 747          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|O08739|AMPD3_MOUSE (AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 PE=1 SV=2)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 354/777 (45.56%), Postives = 486/777 (62.55%), Query Frame = 1
Query:   52 KEFPKIMDSELDKITNLY--RMRSRDGQQPFSKEIGSEFNMPK-FPIEKHELKSHIL--DLKFHSEVEFSETEDSSNLI------MDSPIMND----PLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHP-FNAPG-TQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPS---DGSKIHC--GVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            ++FPK+  S+LD+   L   ++ ++  ++  SK++ S F +P+  PI + E K   L  +L     VE ++ + S  +I      +  P   D    P     M     L    +             P YQR+ I G     + +E+ ++ AK+L  A  +R +Y  ++   F +TT +YL                          +  G+S+   +  P F+ P   Q DPY +D  P           GV+ VY+     +  + H     D   ++ D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E KS  HRDFYN+RKVDTHIHA++ MNQKHLLRFIK   +  P+  V   +  GR ++L +VF S+ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELR+++LKT+NY  G +FA ++KEV  +LE+SKYQ +E RLS+YGR   EW SLA+W + +KVYS N++W+IQ PRIYDIFR+K ++ +F +ML NIF PLF+ T +P  H ELH FL +V+GFDSVDDESK    +    + +P+ W  + NPPY+YYLYYMYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGLLL+K+PVLQYLYYL QI IAMSPLSNNSLFL+Y +NPL +F+ +GLHVSLSTDDP+QFH+TKE LMEEY+IAAQVWK ++ D+CE+ARNSV+ SG S   K  +LG+ + +EG +GND+ +TNV  IR+AFR+E L  E
Sbjct:    3 RQFPKLNMSDLDEHVRLLAEKVFAKVLREEDSKDVMSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPTQQDWKGPPTASPAMSPATPLVPGATSKPGPAPYAM---PEYQRVTISGDYCAGITVEDYEQAAKSLAKALMIREKYARLAYHRFPRTTAQYL--------------------------AHQGESVPLEEGLPDFHPPPLPQEDPYCLDDAPPNLGYLVRMHGGVLFVYDNQTMLERQEPHSLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVA--EKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNE 748          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A4V3SDY7 (AMP deaminase OS=Opisthorchis felineus OX=147828 GN=CRM22_007443 PE=3 SV=1)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 387/662 (58.46%), Postives = 488/662 (73.72%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESG----VNTNDHHF---------INNQLTMQKEDDSQSGK-SINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFV--------RDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G +   + ++E+   A+AL+ A ++R++YM IS Q FH+TT RYL  + SG    + + +  F            ++++   + S +G    N +KDHP N P T GDP+ +   PE  +V   F+ G+M V  PS G     G ++ EFV         DY  +  FV+DGPLKSFC++RL +L  +F +H+LLNE +E+ EQK V+HRDFYNIRKVDTH+HA+S MNQKHLLRFIKK I+   +  V  ++ +G+ ++L ++   + +T YDL+ID LDVH DR+TFHRFDKFNAKYNP+GQS LREVFLKTDNY  G FFAHV+KEV ADL ESKYQNAE RLS+YGR  NEWD+LAKWA   +VYSDNV+W+IQ PR++D++  KG +K FQ++L N+F PLFEVT DP SHPELHAFL +V+GFDSVDDESKS+  V +  T  PEN+   +NPPY+YY++YMYAN++ LN+ RS RG++ F  RPHCGEAG + HLV  FLL  +INHGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFLDY RNPL  ++ +GL+VSLSTDDPLQFHFTKEPL+EEYSIA QVWK TS DMCELARNSV+MSGFS TIKS WLG  + +EGV GND+ RTNVPNIRIA+R+E LT E
Sbjct:  248 FQRVQICGDDTLEVPVDELHVAAEALIKALQLRQKYMTISSQYFHRTTGRYLGALNSGSLKLLESQEKLFRSVRSPASAFACRISLTPAEGSVTGAFDGNVTKDHPINPPETTGDPFTVTYWPEPVDVSLEFRKGIMHVLPPSGGRIGSTGNNW-EFVVPSLSSYLTDYDMIRAFVADGPLKSFCYRRLTYLGSKFALHSLLNEARESLEQKRVSHRDFYNIRKVDTHLHAASCMNQKHLLRFIKKTIRTKGDVLVCEDQKTGQPMTLQQLIDQVGVTAYDLSIDNLDVHADRNTFHRFDKFNAKYNPIGQSRLREVFLKTDNYIKGVFFAHVLKEVFADLAESKYQNAEPRLSIYGRSINEWDNLAKWATNCQVYSDNVRWLIQVPRLFDVYHAKGSMKYFQDILTNVFQPLFEVTADPKSHPELHAFLQYVTGFDSVDDESKSDKVVFNHTTPTPENYCLPENPPYSYYIFYMYANLTQLNQFRSYRGLNTFALRPHCGEAGNLHHLVTCFLLAESINHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLDYHRNPLNSYLSKGLNVSLSTDDPLQFHFTKEPLIEEYSIAIQVWKLTSIDMCELARNSVLMSGFSHTIKSHWLGPNYMQEGVMGNDITRTNVPNIRIAYRYETLTQE 908          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A4S2LG43 (AMP deaminase OS=Opisthorchis felineus OX=147828 GN=CRM22_007443 PE=3 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 386/648 (59.57%), Postives = 483/648 (74.54%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFV--------RDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G +   + ++E+   A+AL+ A ++R++YM IS Q FH+TT RYL  + SG         + +L   +E   +S +S   + DHP N P T GDP+ +   PE  +V   F+ G+M V  PS G     G ++ EFV         DY  +  FV+DGPLKSFC++RL +L  +F +H+LLNE +E+ EQK V+HRDFYNIRKVDTH+HA+S MNQKHLLRFIKK I+   +  V  ++ +G+ ++L ++   + +T YDL+ID LDVH DR+TFHRFDKFNAKYNP+GQS LREVFLKTDNY  G FFAHV+KEV ADL ESKYQNAE RLS+YGR  NEWD+LAKWA   +VYSDNV+W+IQ PR++D++  KG +K FQ++L N+F PLFEVT DP SHPELHAFL +V+GFDSVDDESKS+  V +  T  PEN+   +NPPY+YY++YMYAN++ LN+ RS RG++ F  RPHCGEAG + HLV  FLL  +INHGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFLDY RNPL  ++ +GL+VSLSTDDPLQFHFTKEPL+EEYSIA QVWK TS DMCELARNSV+MSGFS TIKS WLG  + +EGV GND+ RTNVPNIRIA+R+E LT E
Sbjct:  248 FQRVQICGDDTLEVPVDELHVAAEALIKALQLRQKYMTISSQYFHRTTGRYLGALNSG---------SLKLLESQEKLFRSVRS--PASDHPINPPETTGDPFTVTYWPEPVDVSLEFRKGIMHVLPPSGGRIGSTGNNW-EFVVPSLSSYLTDYDMIRAFVADGPLKSFCYRRLTYLGSKFALHSLLNEARESLEQKRVSHRDFYNIRKVDTHLHAASCMNQKHLLRFIKKTIRTKGDVLVCEDQKTGQPMTLQQLIDQVGVTAYDLSIDNLDVHADRNTFHRFDKFNAKYNPIGQSRLREVFLKTDNYIKGVFFAHVLKEVFADLAESKYQNAEPRLSIYGRSINEWDNLAKWATNCQVYSDNVRWLIQVPRLFDVYHAKGSMKYFQDILTNVFQPLFEVTADPKSHPELHAFLQYVTGFDSVDDESKSDKVVFNHTTPTPENYCLPENPPYSYYIFYMYANLTQLNQFRSYRGLNTFALRPHCGEAGNLHHLVTCFLLAESINHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLDYHRNPLNSYLSKGLNVSLSTDDPLQFHFTKEPLIEEYSIAIQVWKLTSIDMCELARNSVLMSGFSHTIKSHWLGPNYMQEGVMGNDITRTNVPNIRIAYRYETLTQE 883          
BLAST of AMP deaminase vs. TrEMBL
Match: G7YNP1 (AMP deaminase OS=Clonorchis sinensis OX=79923 GN=CLF_103973 PE=3 SV=1)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 385/648 (59.41%), Postives = 484/648 (74.69%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFV--------RDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR+ I G +   + ++E+   A+AL+ A ++R++YM IS Q FH TT RYL  + SG         + +L   +E   +S +S   + DHP N P T GDP+ +   PE  +V   F+ G+M V  PS G +I    +  EFV         DY  +  FV+DGPLKSFC++RL +L  +F +H+LLNE +E+ EQK V+HRDFYNIRKVDTH+HA+S MNQKHLLRFIKK I+   +  V  ++ +G+ ++L ++   + +T YDL+ID LDVH DR+TFHRFDKFNAKYNP+GQS LREVFLKTDNY  G FFAHV+KEV ADL ESKYQNAE RLS+YGR  NEWD+LAKWA+  +VYSDNV+W+IQ PR++D++  KG +K FQ++L N+F PLFEVT DP SHPELHAFL +V+GFDSVDDESKS+  V +  T  PEN+   +NPPY+YY++YMYAN++ LN+ RS RG++ F  RPHCGEAG + HLV  FLL  +INHGLLLRKAPVLQYLYYL QIGIAMSPLSNNSLFLDY RNPL +++ +GL+VSLSTDDPLQFHFTKEPL+EEYSIA QVWK TS DMCELARNSV+MSGFS TIKS WLG  + +EGV GND+ R+NVPNIRIA+R+E LT E
Sbjct:  256 FQRVQICGDDTLEVPVDELHVAAEALIKALQLRQKYMTISSQYFHLTTGRYLGALNSG---------SLKLLESQEKLFRSVRS--PASDHPINPPETTGDPFTVTYWPEPVDVSLEFRKGIMHVLPPS-GGRIGSNGNNWEFVVPSLSSYLTDYDMIRAFVADGPLKSFCYRRLTYLGSKFALHSLLNEARESLEQKRVSHRDFYNIRKVDTHLHAASCMNQKHLLRFIKKTIRTKGDVLVCEDRKTGQPMTLQQLIDQVGVTAYDLSIDNLDVHADRNTFHRFDKFNAKYNPIGQSRLREVFLKTDNYIKGVFFAHVLKEVFADLAESKYQNAEPRLSIYGRSINEWDNLAKWAINCQVYSDNVRWLIQVPRLFDVYHAKGSMKYFQDILTNVFQPLFEVTADPKSHPELHAFLQYVTGFDSVDDESKSDKLVFNHTTPTPENYCLPENPPYSYYIFYMYANLTQLNQFRSYRGLNTFALRPHCGEAGNLHHLVTCFLLAESINHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLDYHRNPLNNYLSKGLNVSLSTDDPLQFHFTKEPLIEEYSIATQVWKLTSIDMCELARNSVLMSGFSPTIKSHWLGPNYMQEGVMGNDITRSNVPNIRIAYRYETLTQE 891          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A131XL84 (Putative adenosine monophosphate deaminase (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 391/738 (52.98%), Postives = 511/738 (69.24%), Query Frame = 1
Query:  118 RDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            R+  +    EI + + +P FPIE +E +  ++  +  +  +    E  S    D   M D L  L+  D                     +P++QR+AI G + + + LE++ + +K L++A R+R +YM IS+Q F K T R+L                NQL  +  DD  S + +  S DHPF    T  DP+N + LP   + E    +GV+ VY   +       +D+      +F+ D + +   ++DGPLKSFC++RL++L  +F++H LLNE +E A QK+V HRDFYNIRKVDTH+HA+S MNQKHLLRFIKK +K+H  + V   K   ++++L EVF +M++T YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+FLKTDNY  G++FA ++KEVM+DLEESKYQNAELRLS+YGR  NEWD LAKWAV N +YSDNV+W++Q PR+YD+F++  ++ +F+E+L NIF PLFE T DPSSHPELH FL ++ GFDSVDDESK E  +IDK+   P+ +   +NP Y YYLYYMYANM VLN  R +RG+++F  RPHCGEAGPVQHLV G+LL  NINHGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNS++MSGF   +K +WLG  ++ EG  GND+ RTNVP+IR+A+R+E L  E
Sbjct:   83 REKAKVMGNEISAPYEVPHFPIELYESRK-VMQQQLSTRAQKELEERKSFFDGDVKEMEDNLAQLNDLD--------------------FVPHFQRVAISGEDTSGVPLEDLHQASKLLVSALRLREKYMEISQQSFPKATKRFL----------------NQLKGKPLDDLDSPEEMFSSADHPFYCVPTVTDPWNCEVLP-SMKCELRMHNGVVHVYKNKEDMAAEKPLDFPYVNLPQFINDLNLMCAMIADGPLKSFCYRRLSYLTSKFQLHVLLNELRELAAQKAVPHRDFYNIRKVDTHVHAASCMNQKHLLRFIKKMMKMHSEDHVF--KQGDKLMTLEEVFSAMNITAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESRLREIFLKTDNYIGGQYFAEILKEVMSDLEESKYQNAELRLSIYGRSRNEWDKLAKWAVRNTMYSDNVRWLVQVPRLYDVFKSNNLVNNFEEILENIFMPLFEATNDPSSHPELHQFLQYIVGFDSVDDESKPEYPMIDKDVPLPKQYTDTENPAYNYYLYYMYANMCVLNHFRKKRGLNLFVLRPHCGEAGPVQHLVGGYLLSENINHGLLLRKVPVLQYLYYLAQIGIAMSPLSNNSLFLNYHRNPLPEYLSRGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSIVMSGFPHKVKQYWLGPNYQREGPTGNDITRTNVPDIRVAYRYETLVDE 780          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A131YJE5 (AMP deaminase OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 390/738 (52.85%), Postives = 510/738 (69.11%), Query Frame = 1
Query:  118 RDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            R+  +    EI + + +P FPIE  E +  ++  +  +  +    E  S    D   M D L  L+  D                     +P++QR+AI G + + + LE++ + +K L++A R+R +YM IS+Q F K T R+L                NQL  +  +D  S + +  S DHPF    T  +P+N + LP     E    +GV+ VY   +   +   +D+      +F+ D + +   ++DGPLKSFC++RL++L  +F++H LLNE +E A QK+V HRDFYNIRKVDTH+HA+S MNQKHLLRFIKK +K+H  + V   K   ++++L EVF +M++T YDL++D LDVH DR+TFHRFDKFN KYNPVG+S LRE+FLKTDNY  G++FA ++KEVM+DLEESKYQNAELRLS+YGR  NEWD LAKWAV N +YSDNV+W++Q PR+YD+F++  ++ +F+E+L NIF PLFEVT DPSSHPELH FL ++ GFDSVDDESK E  +IDK+   P+ +   +NP Y YYLYYMYANM VLN  R  RG+++F  RPHCGEAGPVQHLV G+LL  NINHGLLLRK PVLQYLYYL QIGIAMSPLSNNSLFL+Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNS++MSGF   +K +WLG  ++ EG  GND+ RTNVP+IR+A+R+E L  E
Sbjct:   87 REKAKVMGNEISAPYEVPHFPIELAESRK-VMQQQLSTRAQKELEERKSYFDGDVKEMEDNLAQLNDLD--------------------FVPHFQRVAISGEDTSGVPLEDLHQASKLLVSALRLREKYMEISQQSFPKATKRFL----------------NQLKGKPLEDLDSPEEMFSSADHPFYCVPTVTEPWNCEVLP-NMNCELRMHNGVVHVYKNKEDMAVEKPMDFPYVNLPQFINDLNLMCAMIADGPLKSFCYRRLSYLTSKFQLHVLLNELRELAAQKAVPHRDFYNIRKVDTHVHAASCMNQKHLLRFIKKMMKMHSEDHVF--KQGDKLMTLEEVFSAMNITAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESRLREIFLKTDNYIGGQYFAEILKEVMSDLEESKYQNAELRLSIYGRSRNEWDKLAKWAVRNTMYSDNVRWLVQVPRLYDVFKSNNLVNNFEEILENIFMPLFEVTNDPSSHPELHQFLQYIVGFDSVDDESKPEYPMIDKDVPLPKQYTDTENPAYNYYLYYMYANMCVLNHFRKLRGLNLFVLRPHCGEAGPVQHLVGGYLLSENINHGLLLRKVPVLQYLYYLAQIGIAMSPLSNNSLFLNYHRNPLPEYLSRGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSIVMSGFPHKVKQYWLGPNYQREGPTGNDITRTNVPDIRVAYRYETLVDE 784          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 352/643 (54.74%), Postives = 463/643 (72.01%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQ--SKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLE-FVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +QR++I G E+  +   ++ + A+ ++ A  +R +YM+ S Q F  TT R L       + +D     +    + E    +  +++   S+ HP+       DP N+       +V +     + +  N  +  K+      L+ ++ D + +   + +GP+KSFC++RL +L+ +F+MH+LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK  +K +P E V +E   GR  +L++VF++M+LT YDL++D LD+    +TFHRFDKFN+KYNP+G+S LRE+F+KTDN+ +G++F H++KEVM+DLEESKYQNAELRLS+YGR  +EWD LA WA T+ VYS NV W++Q PR++D++R+K  + +FQ+ML NIF PLFEVT +P SHP+LH FL HV GFDSVDDESK E  V + ++  PENW  +DNPPY+YYLYY YANM+VLN LR +RG   F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL VSLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCEL+RNSV+MSGFS   K +WLG  +  EG +GND+ R+NVP+IR+AFR E L  E
Sbjct:  114 FQRVSISGEEKCGVPFTDLVDAAECVVRALFIREKYMSESLQGFCSTTARLLQ------DLSDRPLHCSPQGAEPETPVAADATVHPPVSRTHPYEG----QDPKNLPS-----DVGYT----LCSALNKPEYRKLDLPYPNLQDYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHSLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKSAMKKYPEEIVRME--GGRGQTLMDVFENMNLTAYDLSVDTLDM--TGNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLALWATTHSVYSPNVCWLVQIPRLFDVYRSKRQLGNFQQMLENIFLPLFEVTVNPQSHPDLHLFLQHVVGFDSVDDESKPEHHVFNLDSPLPENWTEEDNPPYSYYLYYTYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSANISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELSRNSVLMSGFSHKTKRYWLGPDYSREGPEGNDIRRSNVPDIRVAFRHETLCEE 733          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 330/650 (50.77%), Postives = 445/650 (68.46%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPG-TQG-DPYNIDKLPEKFEVEFAFKDGVMAVYNPSDG---SKIHCGVDYLE---FVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P +QR+ I G     + +E+ ++ AK+LL A  +R +Y  ++   F +TT ++L       + N+  F   +  +                  P   P  T+G DPY+++ +P+        KDG++ VY+ ++     K H G+ Y +   F  D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E K V HRDFYN+RKVDTHIHA++ MNQKHLLRFI+    +   ++V++EK  G+ ++L +VF+++ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELRE++LKTDNY NG +FA +IKEV  DLEESKYQ AE RLS+YGR   EW++LAKW +  KVYS N++W+IQ PRIYDIFR K II +F +ML NIF PLFE T +P  H E+H FL +V+GFDSVDDESK    +    +  PE W  ++NPPY+YYLY+MYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGL L+K+PVLQYL+YL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL VSLSTDDP+QFH+TKE LMEEY+IAAQ+WK ++ D+CE+ARNSV+ SG S   K  +LG+ + ++G  GND+ RTNV  IR+A+R E L  E
Sbjct:  146 PEFQRVTISGDYCAGITVEDYEQAAKSLLKALFIREKYSRLAYHRFPRTTAKFLR------SANNEKFSEEEEVL------------------PDTVPSPTEGQDPYSMEDVPQNLNYPMKMKDGIIYVYDNAEALSQEKPH-GLPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVE-GDRVVMEKG-GKKITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNE 768          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 330/650 (50.77%), Postives = 445/650 (68.46%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPG-TQG-DPYNIDKLPEKFEVEFAFKDGVMAVYNPSDG---SKIHCGVDYLE---FVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P +QR+ I G     + +E+ ++ AK+LL A  +R +Y  ++   F +TT ++L       + N+  F   +  +                  P   P  T+G DPY+++ +P+        KDG++ VY+ ++     K H G+ Y +   F  D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E K V HRDFYN+RKVDTHIHA++ MNQKHLLRFI+    +   ++V++EK  G+ ++L +VF+++ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELRE++LKTDNY NG +FA +IKEV  DLEESKYQ AE RLS+YGR   EW++LAKW +  KVYS N++W+IQ PRIYDIFR K II +F +ML NIF PLFE T +P  H E+H FL +V+GFDSVDDESK    +    +  PE W  ++NPPY+YYLY+MYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGL L+K+PVLQYL+YL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL VSLSTDDP+QFH+TKE LMEEY+IAAQ+WK ++ D+CE+ARNSV+ SG S   K  +LG+ + ++G  GND+ RTNV  IR+A+R E L  E
Sbjct:  146 PEFQRVTISGDYCAGITVEDYEQAAKSLLKALFIREKYSRLAYHRFPRTTAKFLR------SANNEKFSEEEEVL------------------PDTVPSPTEGQDPYSMEDVPQNLNYPMKMKDGIIYVYDNAEALSQEKPH-GLPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVE-GDRVVMEKG-GKKITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNE 768          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 330/650 (50.77%), Postives = 445/650 (68.46%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPG-TQG-DPYNIDKLPEKFEVEFAFKDGVMAVYNPSDG---SKIHCGVDYLE---FVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P +QR+ I G     + +E+ ++ AK+LL A  +R +Y  ++   F +TT ++L       + N+  F   +  +                  P   P  T+G DPY+++ +P+        KDG++ VY+ ++     K H G+ Y +   F  D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E K V HRDFYN+RKVDTHIHA++ MNQKHLLRFI+    +   ++V++EK  G+ ++L +VF+++ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELRE++LKTDNY NG +FA +IKEV  DLEESKYQ AE RLS+YGR   EW++LAKW +  KVYS N++W+IQ PRIYDIFR K II +F +ML NIF PLFE T +P  H E+H FL +V+GFDSVDDESK    +    +  PE W  ++NPPY+YYLY+MYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGL L+K+PVLQYL+YL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL VSLSTDDP+QFH+TKE LMEEY+IAAQ+WK ++ D+CE+ARNSV+ SG S   K  +LG+ + ++G  GND+ RTNV  IR+A+R E L  E
Sbjct:  125 PEFQRVTISGDYCAGITVEDYEQAAKSLLKALFIREKYSRLAYHRFPRTTAKFLR------SANNEKFSEEEEVL------------------PDTVPSPTEGQDPYSMEDVPQNLNYPMKMKDGIIYVYDNAEALSQEKPH-GLPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVE-GDRVVMEKG-GKKITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNE 747          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3a (AMP deaminase 3-like [Source:NCBI gene;Acc:103043749])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 324/647 (50.08%), Postives = 441/647 (68.16%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIH---C--GVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P YQR+ I G     + +E+ ++ AK+LL A  +R +Y  ++   F +TT  +L   E+              T  +E+D                 P    DPY+++ +PE    E   +DG++ VY+ ++  +++   C    D   F  D   +   ++DGP K++C +RLNFL  +F +H +LNE  E  E K V HRDFYN+RKVDTHIHA++ MNQKHLL FI+   K    E+V++EK +G+ L+L +VF ++ + PYDLT+D LDVH  R TFHRFDKFN+KYNPVG SELRE++LKTDN+  G +FA +IKEV  DLEESKYQ+AE RLS+YGR   EW+SL++W + +KV+S N++W+IQ PRIYDIF+++ ++ +F +ML NIF PLFE T +P  H ELH FL +V+GFDSVDDESK    +    +  PE W   DNPPY+YYL++MYAN+ VLN LR +RG+  F FRPHCGEAG + HLV+ FL   NI+HGL L+K+PVLQYLYYL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL VSLSTDDP+QFH+TKE LMEEY+IAAQ+WK ++ D+CE+ARNSV+ SG S   K  ++G  + ++G +GND+ RTNV  IR+A+R E L  E
Sbjct:  139 PEYQRVTISGDYCAGITVEDYEQAAKSLLKALFIREKYSKLAYHCFPRTTALFLRSAEN--------------TQWREEDEVLPDLCP--------CPEEGQDPYSMENIPENLSYELKMRDGIIYVYDNAEALRLNRPRCLPYPDLETFALDMSHVLAMIADGPTKTYCHRRLNFLGSKFYLHEMLNEMAELKELKGVPHRDFYNVRKVDTHIHAAACMNQKHLLNFIQTTYKTDA-ERVVLEK-TGQRLTLKQVFNNLSMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNHIKGEYFARLIKEVAHDLEESKYQHAEPRLSIYGRCPEEWESLSQWFIQHKVHSPNMRWVIQVPRIYDIFKSRKLVPNFAKMLENIFLPLFEATVNPQKHKELHIFLKYVTGFDSVDDESKHSDHMFSYKSPKPEQWTTDDNPPYSYYLFHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLYYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDLCEIARNSVLQSGLSHQEKKHFVGANYLKDGPEGNDIRRTNVAQIRMAYRHETLCNE 761          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ampd1 (adenosine monophosphate deaminase 1 (isoform M) [Source:ZFIN;Acc:ZDB-GENE-040426-1906])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 332/648 (51.23%), Postives = 439/648 (67.75%), Query Frame = 1
Query:  391 PNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQG-DPYNIDKLPEKFEVEFAFKDGVMAVYN--PSDGSKIHCGVDYLE---FVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            P++QR+ + G     + LE++ E  + L  A  +R +YM +S Q F  TT RYL  IE                 +   DS     +       F AP  +G DP +++ +P     +   +DGV+ V +    D   +H  + YL+   F+ D + L T ++DGP K+FC +RLNFL  +F +H +LNE  E  E K VAHRDFYN+RKVDTHIHA++ MNQKHLLRFIK    + P   V ++   G  ++L ++F+S+ L P DLT+D LDVH  R TFHRFDKFN+KYNPVG SELR++++KTDN+  G +FA +IKEV +DLEES+YQ+AE RLSVYG K +EW  LA W + ++VYS N+KWMIQ PRIYDIFR K ++ +F  ML NIF PLFE T +P+ H  LH FL HV+GFDSVDDESK    +    +  P+ W  Q NP Y YY+YYMYAN+ VLN LR +RGM+ F FRPHCGEAG V HL+A F+L  NI+HGL L+K+PVLQYLYYL Q+ IAMSPLSNNSLFL+Y +NPL +F+ +GL +SLSTDDP+QFHFTKEPLMEEY+IAAQV+K ++ DMCE+ARNSV+ S +S   K  +LG  + ++G  GN++ +TNV +IR+A+R+E    E
Sbjct:   34 PDFQRMIVMGDYAAGVCLEDLAEAGQGLYRALLIREKYMRLSFQRFPCTTSRYLRTIEG----------------EAWHDSDQVLPV-------FTAPPKKGEDPLSLEGIPGDLGYKVTSRDGVVHVSSGGAGDNEALH-SLPYLDIDTFIDDMNFLLTLIADGPTKTFCHRRLNFLGSKFNLHEMLNEMAEMKELKEVAHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHSYLVDPERVVRVK--DGVPVTLRQLFESLKLHPNDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYIKTDNHIKGEYFATIIKEVASDLEESRYQHAEPRLSVYGSKRDEWHKLADWFIQHRVYSPNLKWMIQMPRIYDIFRAKNLVLNFGTMLDNIFLPLFEATINPNQHKHLHVFLKHVTGFDSVDDESKHSGHMFSSKSPKPQEWDVQKNPSYTYYMYYMYANVMVLNNLRRERGMNTFLFRPHCGEAGAVTHLLAAFMLADNISHGLNLKKSPVLQYLYYLAQLPIAMSPLSNNSLFLEYAKNPLLEFLQKGLCISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLSTCDMCEIARNSVLQSAYSHEEKKHFLGNNYLQDGPAGNNILKTNVAHIRLAYRYETWCYE 655          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010379.1 (pep scaffold:Pmarinus_7.0:GL480085:7718:22400:1 gene:ENSPMAG00000009393.1 transcript:ENSPMAT00000010379.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 514.998 bits (1325), Expect = 1.438e-172
Identity = 302/652 (46.32%), Postives = 396/652 (60.74%), Query Frame = 1
Query:  397 YQRIAIKG---AEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY----NPSDGSKIHCGVDYL----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKAS-GRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            + R+ I G   A+ T +   E+Q+ A  L+ A R R++ M  S Q F +T  R+L      V+               ED   +G          +  P T G P  +           A   GV  +Y       DG       D        + D   L   V DGPLK+FC +RL  L  +F++H + NE  E  + K    RDF N+ KVDTHIHA++ M  + LL+ ++   +    E V + +   GR L+L E+F  + L    + +D LDVH DRDTF RFD+FN KYNP+G SELR VFLKT+N+ +G++FA ++K V   LE S+YQ AE R+SVYGR   +W+ LA W   ++VYS +++W+IQ PRIY IFRT+ II SF  ML NIF PLFEVT +P S+P LH FL HV+GFDSV DES +E   +  ++  PE W   +NPPYAYY+YYM+AN++VLN+LR Q  M+ F FRPHCGEAG V HL   FL   NI+HG+ L K+PVLQYLYYLCQI IAMSP+SNNSLFL+Y RNP  DF  +GL VSLS+DDPLQFHFT+E L+EEY+ AA  WK ++ D+CE+A NSV  SG S   K  +LG ++ EEG +GND  ++NV  IR+AFR E L  E
Sbjct:   43 FHRVVITGDSAADVTWVRPAELQDIAAKLMGAMRARQQRMVASLQRFPRTATRFLRPPGDKVDCG------------TEDGLPNG----------YPVPMTAGSPPPVTPAALTLPSRVAMVRGVAVLYVDEKAQEDGQAWALPCDATIGLSSHLSDLGVLLGLVQDGPLKTFCQRRLKLLAAKFQVHQMTNELAEMIQLKVDGCRDFENVVKVDTHIHAAACMTARELLQMMRSARE----EGVPVSRGPDGRELTLAELFAQLHLRSDSIDLDNLDVHVDRDTFQRFDRFNDKYNPLGSSELRNVFLKTNNHMSGKYFAMLVKNVGRRLEASRYQYAEPRMSVYGRSRGDWEKLAGWFEQHQVYSPHLRWVIQVPRIYHIFRTRNIIPSFGVMLENIFLPLFEVTLNPDSNPTLHNFLQHVTGFDSVSDESLAEGLFL-PDSPAPEEWTSAENPPYAYYVYYMFANVAVLNQLRRQCNMNTFVFRPHCGEAGSVAHLADSFLTSDNISHGINLSKSPVLQYLYYLCQIPIAMSPISNNSLFLEYSRNPFLDFYHKGLTVSLSSDDPLQFHFTQEALVEEYATAAHFWKLSTCDLCEIASNSVRQSGLSHMEKREFLGDKYLEEGPEGNDATKSNVAPIRVAFRHETLCQE 667          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 337.035 bits (863), Expect = 5.960e-107
Identity = 178/373 (47.72%), Postives = 242/373 (64.88%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNP-SDGSKIHCGVDY-----LEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRI 1497
            +QR+ I G +   +  +++ E + +LL A R+R +Y  ++   F  TT + L L     N+                 +   K+I+ +   P  +P   GD Y++ + PE        + GV  VY+  S G      VD        F+ D + L     +GPLKSFC++RL FL+ +F+MH LLNE KE + QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K   +E  ++ +  G+  +L +VF+ ++LT +DL++D LDVH DR+TFHRFDKFNAKYNPVG+S LRE+F+KTDN   GR+FAH+IKEVM+DLEESKYQNAELRLS+YGR+  EW+ LAKWAVT++VYS NV+W+IQ PR+
Sbjct:  110 FQRLLITGEDACGVPRDDVVEVSSSLLRALRLRYKYSMLAMHSFFPTTAQALLL-----NSTTAATPGTSPQTIPPPTATIPKNIHPTTACPETSP--YGD-YDVSEFPEDCGFTVEMRGGVAHVYDGFSPGQHRDELVDLPYGDLAAFIADMNILMAMSINGPLKSFCYRRLQFLSAKFQMHALLNEMKELSAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAVKRESDE--VVHRDQGKEQTLKQVFEDLNLTAFDLSVDMLDVHADRNTFHRFDKFNAKYNPVGESILREIFIKTDNCIGGRYFAHIIKEVMSDLEESKYQNAELRLSIYGRERGEWEGLAKWAVTHRVYSHNVRWLIQIPRL 472          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: AMD1 (AMP deaminase; tetrameric enzyme that catalyzes the deamination of AMP to form IMP and ammonia; thought to be involved in regulation of intracellular purine (adenine, guanine, and inosine) nucleotide pools [Source:SGD;Acc:S000004498])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 285/501 (56.89%), Postives = 378/501 (75.45%), Query Frame = 1
Query:  826 VRDYH----ALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            +RDY+     + +  SDGP KSF ++RL +L  R+ ++ LLNE++ET+  K   HRDFYN+RKVDTH+H S+ MNQKHLLRFIK  ++   +EKV+     G++L+L EVF+S+ LT YDL+ID LD+H  +DTFHRFDKFN KYNP+G+S LRE+FLKT+NY  G + A + K+V+ DLE SKYQN E R+SVYGR  +EWD LA W + NKV S NV+W++Q PR+YDI++  GI++SFQ++  N+F PLFEVT++P SHP+LH FL  V GFDSVDDESK +     +    P  W    NPPY+YYLYY+Y+N++ LN+ R++RG +    RPHCGEAG  +HLV+ +LL H I+HG+LLRK P +QYLYYL Q+GIAMSPLSNN+LFL Y +NP   +  RGL+VSLSTDDPLQF +T+EPL+EEYS+AAQ++K ++ DMCELARNSV+ SG+   IK  W+GK F + GV+GNDV RTNVP+IRI +R++ L+ E
Sbjct:  296 LRDYYLDLEKMISISSDGPAKSFAYRRLQYLEARWNLYYLLNEYQETSVSKRNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLRHSKDEKVIFR--DGKLLTLDEVFRSLHLTGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTNNYIKGTYLADITKQVIFDLENSKYQNCEYRISVYGRSLDEWDKLASWVIDNKVISHNVRWLVQIPRLYDIYKKTGIVQSFQDICKNLFQPLFEVTKNPQSHPKLHVFLQRVIGFDSVDDESKVDR-RFHRKYPKPSLWEAPQNPPYSYYLYYLYSNVASLNQWRAKRGFNTLVLRPHCGEAGDPEHLVSAYLLAHGISHGILLRKVPFVQYLYYLDQVGIAMSPLSNNALFLTYDKNPFPRYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNSVLQSGWEAQIKKHWIGKDFDKSGVEGNDVVRTNVPDIRINYRYDTLSTE 793          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: YBR284W_mRNA (Putative metallo-dependent hydrolase superfamily protein; similar to AMP deaminases but lacks key catalytic residues and does not rescue purine nucleotide metabolic defect of quadruple aah1 ade8 amd1 his1 mutant; null mutant exhibits longer telomeres, altered Ty mobility, decreased resistance to rapamycin and wortmannin; induced in response to hydrostatic pressure; not an essential gene; YBR284W has a paralog, YJL070C, that arose from the whole genome duplication [Source:SGD;Acc:S000000488])

HSP 1 Score: 179.489 bits (454), Expect = 3.011e-47
Identity = 179/586 (30.55%), Postives = 273/586 (46.59%), Query Frame = 1
Query:  820 EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDK--FNAKYNPVGQ----------SELR-----EVFLKTDNYNNGRFFAHVIKE-VMADLEESKYQNAELRLSV-YGRKY------NEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLF--EVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKN----TLNPENWVC-QDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCG--------------------EAGPVQHLVA--GFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSN--------------NSLFLD----YQRNPLYDFMCRGLHVSLSTDDPLQFH-FTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQF--------------KEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            EF  D+      + D  L  F  KRL +L  +F +   L+  +E  + K V H+DFYN RK+D ++  S   +Q  L  FI   ++  P ++V+ +  +G  ++L ++FK ++        + L +    D+F  + K  + AKY+ V             +LR     + FL+ DNY NG + A ++K  ++   EESKYQ  +L +   +   Y      N W   A W     ++S+N++W I+  RIY      G +K+FQE L+ IF PLF  E     S  P L  FL+ VS  D    ++ +    I KN    +  P++W    DNP  + Y+YY+Y N++ LN +R     + FT R  C                     EA     L+A  GF     +N   L    P L YL+YL QI + ++PL++                L L+    Y++NP   F   G  +SLS++  L  + +TKEP++EEYS+AA +++  S D+CEL RNSV+ SGFS T+K+ WLG                 K    + N     NVP IR  +R   L  E
Sbjct:  218 EFREDFEWCLKIIRDRSLSRFSEKRLQYLVNKFPVFQHLHSKEEMRQSKKVPHKDFYNCRKIDLNLLLSGCFSQWQLTEFIWTKLRKEP-DRVIHQAFNGSHITLSQLFK-VNFEETGQFFNGLKI--IDDSFLEWYKVIYLAKYHLVNDEMEIHTGSHGKQLRYYLIAKTFLEFDNYINGEYLAELLKTFLIKPQEESKYQLCQLSVDFQFYLHYDNSDVDNWWMVFANWLNHYNIFSNNIRWNIRISRIYPELYHTGKVKNFQEYLNLIFKPLFNAENYLHKSLGPILLKFLSQVSSIDLCIQDTDN---YIWKNFTAVSCLPKDWTSGGDNPTISQYMYYVYVNLTKLNHIRQALHQNTFTLRSSCSPTSMNRTSQFSNTLNFTEHTEAILNNFLLACGGF-----LNAENLWNAPPSLVYLFYLSQIPMVVAPLNSIVDSKPTMLQEQAPTGLVLEPSKPYKKNPFMKFFEMGFKISLSSESILYNNSYTKEPIIEEYSVAASIYRLHSADLCELLRNSVITSGFSSTLKNKWLGVSLASHDYFVENTGFVDKWYDCKPNTSLEHNVPIIRRQYRSSTLAGE 791          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: YJL070C_mRNA (Putative metallo-dependent hydrolase superfamily protein; similar to AMP deaminases but lacks key catalytic residues and does not rescue purine nucleotide metabolic defect of quadruple aah1 ade8 amd1 his1 mutant; may regulate purine nucleotide homeostasis as overexpression in an AMD1 strain grown in adenine results in greatly reduced GDP and GTP intracellular levels; not an essential gene; YJL070C has a paralog, YBR284W, that arose from the whole genome duplication [Source:SGD;Acc:S000003606])

HSP 1 Score: 176.022 bits (445), Expect = 5.782e-46
Identity = 179/596 (30.03%), Postives = 272/596 (45.64%), Query Frame = 1
Query:  820 EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFK---SMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNP------VGQSE----LREVFLKTDNYNNGRFFAHV-IKEVMADLEESKYQNAELRLS--VYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTR-----DPSSHPE---LHAFLNHVSGFDSVDDESKSESC--VIDKNTLNPENWVCQ-DXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGP--------------VQHLVAGFXXXXXXXXXXX--XRKAPVLQYLYYLCQIGIAMSPLSNNSL-------FL--------------------------------DYQRNPLYDFMCRGLHVSLSTDDPL-QFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFK-----EEGVQGNDVF---------RTNVPNIRIAFRFEALTAE 2316
            EF  D+  +   +          KRL++L  +F++   LN  KE    K+V +RDFYN RKVD  +  S  ++Q+ L  +I + I L P   V  +  + R LSL ++F+   S +  P  + +  +D     D +      +    P      VG+      L +VFL+ DN+  G + A + IK V+  LE+SKYQ A++ ++   Y    + +   ++W +  K+ S N++W IQ  RI+     + ++ +FQE L  IF PLF + +     D S + +   L  FL++V   D V  ES         D N   P+ W  Q DNP  A+Y+YY+Y +++ +N LRSQ   +  T R +C                   V+ LV   LL +     +      A ++QYL+YL QI I  +PLS+ SL       FL                                 Y+ NP       GL +SLS+   L    +T EPL+EEYS+AA ++    TD+CEL+R SV+ SG+    K+ W+G   K     EE V G D +         + NVP IR  +R E L  E
Sbjct:  280 EFRDDFAYIIELIQSHKFNEVSRKRLSYLLDKFELFQYLNSKKEILANKNVPYRDFYNSRKVDRDLSLSGCISQRQLSEYIWEKINLEPERIVYQDPETSRKLSLRDIFQFGCSSNDQPIAIGLKLIDDEF-LDWYRNIYLIDYHLTPNKVAKLVGKEMRFYLLAKVFLEFDNFIEGEYLAEIFIKYVIHILEKSKYQLAQVSVNFQFYSSGEDWYKKFSQWLLRWKLVSYNIRWNIQIARIFPKLFKENVVSNFQEFLDLIFNPLFTLEKEQLPIDSSVNTDIIGLQFFLSNVCSMDLVIKESDEYYWKEFTDMNC-KPKFWTAQGDNPTVAHYMYYIYKSLAKVNFLRSQNLQNTITLRNYCSPLSSRTSQFGVDLYFTDQVESLVCNLLLCNGGLLQVEPLWDTATMIQYLFYLFQIPILAAPLSSVSLLNSQKSTFLKNKNVLLEHDYLKDQETAKINPSRDITVGEQRSYETNPFMKMFKMGLKISLSSKSILYNSSYTLEPLIEEYSVAASIYLLNPTDLCELSRTSVLSSGYEGWYKAHWIGVGVKKAPYFEENVGGIDNWYDTAKDTSIKHNVPMIRRRYRKETLDQE 873          
BLAST of AMP deaminase vs. Ensembl Nematostella
Match: EDO38389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD62])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 325/560 (58.04%), Postives = 395/560 (70.54%), Query Frame = 1
Query:  658 SKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVY-------NPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            SK+ PF+    QGD          + VE    DGV+ V        N      +H   D  EF  D + L    + GP+KSF ++RL +L  R+ +HTLLNE KE A  K V HRDFYN+RKVDTH+HA+S MNQKHLLRFIKK +K   +E V++    G+  +L EVF  ++LTPYDL++D LDVH DR+TFHRFDKFN+KYNPVG+S LRE+FLKTDNY +GR+FA ++KEVM DLEESKYQNAE R+S+YGR  NEWD+LAKWAV + V+S+NV+W+IQ PR++D++R KG++K+FQEML N+F PLFE T +P SHPELH FL  V GFDSVDDESK+E  +  + +  P NW  QDNPPYAYYLYYMY+NM VLN LR +RG +    RPHCGEAGP  HLV  F+L  NI+HGLLLRK P LQYLYYL QIGIAMSPLSNNSLFL+YQRNPL D   R              H+  EPLMEEYSIAAQVWK +  DM ELARNSV+MSGF + +K  W+G   K EG   ND+ +TNVPNIR+ FR E L  E
Sbjct:   46 SKESPFDC-EVQGDC--------GYAVEMI--DGVIQVISCRRDHKNRPSNCTVHPFPDLQEFFEDQNILLALSTHGPIKSFAYRRLKYLESRYSLHTLLNEMKELAAMKEVPHRDFYNVRKVDTHVHAASCMNQKHLLRFIKKKVKCEGDEPVIMH--DGKEATLREVFAMLNLTPYDLSVDTLDVHADRNTFHRFDKFNSKYNPVGESRLREIFLKTDNYIDGRYFAQLMKEVMVDLEESKYQNAEPRISIYGRSINEWDALAKWAVNHDVFSENVRWVIQIPRLFDVYRAKGLVKNFQEMLENLFMPLFEATINPQSHPELHKFLTQVIGFDSVDDESKTEKSLFTETSPLPANWTSQDNPPYAYYLYYMYSNMVVLNHLRRERGFNTLRLRPHCGEAGPAHHLVTAFMLAENISHGLLLRKVPALQYLYYLAQIGIAMSPLSNNSLFLNYQRNPLPDGQSR--------------HYPHEPLMEEYSIAAQVWKLSPCDMAELARNSVLMSGFEEEVKRQWIGCD-KLEG--SNDITKTNVPNIRVCFRQETLLQE 575          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 370/648 (57.10%), Postives = 474/648 (73.15%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPY-NIDK--LPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            Y R++I G E+  +   ++ + AK ++ A  +R +Y+N S Q F KTT    +L + G  T D  F           D  S   ++   D P + P ++  PY N+D   LP          DGV+ V+  S        ++ L     E++ D + + + + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +  E V +E   GR  +L +VF+SM+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDNY  G++FAH++KEVM+DLEESKYQN+ELRLS+YGR  +EWD LA+WAVT++VYSDNV+W+IQ PR++D+++TK  + +FQEML NIF PLFE T +P SHPELH FL HV GFDSVDDESK E  + + ++  P +W  +DNPPY+YYLYY YANM+VLN+LR QRG+  F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS   KS+WLG  + +EG   ND+ RTNVP+IR+A+R E LT E
Sbjct:  138 YLRVSISGDEKCGVPFTDLVDAAKCVVKALFIREKYINRSLQNFCKTTAH--ALHDLGTKTLDMGFY----------DDVSETPVD--ADAPVHPPVSETHPYDNMDSMILPPDAGYGCKMVDGVVHVFTKSYNMDKSTELELLYPDLKEYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHVE--CGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEE 769          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 370/648 (57.10%), Postives = 474/648 (73.15%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPY-NIDK--LPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            Y R++I G E+  +   ++ + AK ++ A  +R +Y+N S Q F KTT    +L + G  T D  F           D  S   ++   D P + P ++  PY N+D   LP          DGV+ V+  S        ++ L     E++ D + + + + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +  E V +E   GR  +L +VF+SM+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDNY  G++FAH++KEVM+DLEESKYQN+ELRLS+YGR  +EWD LA+WAVT++VYSDNV+W+IQ PR++D+++TK  + +FQEML NIF PLFE T +P SHPELH FL HV GFDSVDDESK E  + + ++  P +W  +DNPPY+YYLYY YANM+VLN+LR QRG+  F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS   KS+WLG  + +EG   ND+ RTNVP+IR+A+R E LT E
Sbjct:  138 YLRVSISGDEKCGVPFTDLVDAAKCVVKALFIREKYINRSLQNFCKTTAH--ALHDLGTKTLDMGFY----------DDVSETPVD--ADAPVHPPVSETHPYDNMDSMILPPDAGYGCKMVDGVVHVFTKSYNMDKSTELELLYPDLKEYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHVE--CGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEE 769          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 370/648 (57.10%), Postives = 474/648 (73.15%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPY-NIDK--LPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            Y R++I G E+  +   ++ + AK ++ A  +R +Y+N S Q F KTT    +L + G  T D  F           D  S   ++   D P + P ++  PY N+D   LP          DGV+ V+  S        ++ L     E++ D + + + + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +  E V +E   GR  +L +VF+SM+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDNY  G++FAH++KEVM+DLEESKYQN+ELRLS+YGR  +EWD LA+WAVT++VYSDNV+W+IQ PR++D+++TK  + +FQEML NIF PLFE T +P SHPELH FL HV GFDSVDDESK E  + + ++  P +W  +DNPPY+YYLYY YANM+VLN+LR QRG+  F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS   KS+WLG  + +EG   ND+ RTNVP+IR+A+R E LT E
Sbjct:  141 YLRVSISGDEKCGVPFTDLVDAAKCVVKALFIREKYINRSLQNFCKTTAH--ALHDLGTKTLDMGFY----------DDVSETPVD--ADAPVHPPVSETHPYDNMDSMILPPDAGYGCKMVDGVVHVFTKSYNMDKSTELELLYPDLKEYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHVE--CGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEE 772          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 370/648 (57.10%), Postives = 474/648 (73.15%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPY-NIDK--LPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            Y R++I G E+  +   ++ + AK ++ A  +R +Y+N S Q F KTT    +L + G  T D  F           D  S   ++   D P + P ++  PY N+D   LP          DGV+ V+  S        ++ L     E++ D + + + + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +  E V +E   GR  +L +VF+SM+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDNY  G++FAH++KEVM+DLEESKYQN+ELRLS+YGR  +EWD LA+WAVT++VYSDNV+W+IQ PR++D+++TK  + +FQEML NIF PLFE T +P SHPELH FL HV GFDSVDDESK E  + + ++  P +W  +DNPPY+YYLYY YANM+VLN+LR QRG+  F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS   KS+WLG  + +EG   ND+ RTNVP+IR+A+R E LT E
Sbjct:  115 YLRVSISGDEKCGVPFTDLVDAAKCVVKALFIREKYINRSLQNFCKTTAH--ALHDLGTKTLDMGFY----------DDVSETPVD--ADAPVHPPVSETHPYDNMDSMILPPDAGYGCKMVDGVVHVFTKSYNMDKSTELELLYPDLKEYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHVE--CGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEE 746          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 370/648 (57.10%), Postives = 474/648 (73.15%), Query Frame = 1
Query:  397 YQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPY-NIDK--LPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYL-----EFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAE 2316
            Y R++I G E+  +   ++ + AK ++ A  +R +Y+N S Q F KTT    +L + G  T D  F           D  S   ++   D P + P ++  PY N+D   LP          DGV+ V+  S        ++ L     E++ D + + + + +GP+KSFC++RL +L+ +F+MH LLNE KE A QK V HRDFYNIRKVDTHIHASS MNQKHLLRFIK+ +K +  E V +E   GR  +L +VF+SM+LT YDL++D LD+H DR+TFHRFDKFN+KYNP+G+S LRE+F+KTDNY  G++FAH++KEVM+DLEESKYQN+ELRLS+YGR  +EWD LA+WAVT++VYSDNV+W+IQ PR++D+++TK  + +FQEML NIF PLFE T +P SHPELH FL HV GFDSVDDESK E  + + ++  P +W  +DNPPY+YYLYY YANM+VLN+LR QRG+  F  RPHCGEAGP+ HLV+GF+L  NI+HGLLLRKAPVLQYLYYL Q+GIAMSPLSNNSLFL Y RNPL +++ RGL +SLSTDDPLQFHFTKEPLMEEYSIAAQVWK +S DMCELARNSV+MSGFS   KS+WLG  + +EG   ND+ RTNVP+IR+A+R E LT E
Sbjct:  101 YLRVSISGDEKCGVPFTDLVDAAKCVVKALFIREKYINRSLQNFCKTTAH--ALHDLGTKTLDMGFY----------DDVSETPVD--ADAPVHPPVSETHPYDNMDSMILPPDAGYGCKMVDGVVHVFTKSYNMDKSTELELLYPDLKEYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHVE--CGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEE 732          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 1483.39 bits (3839), Expect = 0.000e+0
Identity = 768/770 (99.74%), Postives = 770/770 (100.00%), Query Frame = 1
Query:   70 MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEXXXXXXXXXXXXSFLNDENSQ 2379
            MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMN+SKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKS+NQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ
Sbjct:    1 MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNVSKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSVNQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ 770          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 1481.85 bits (3835), Expect = 0.000e+0
Identity = 772/781 (98.85%), Postives = 773/781 (98.98%), Query Frame = 1
Query:   37 MSSKNKEFPKIMDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEXXXXXXXXXXXXSFLNDENSQ 2379
            MSSKNKEFPKIMDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMN+SKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS        DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ
Sbjct:    1 MSSKNKEFPKIMDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNVSKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS--------DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ 773          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 1458.74 bits (3775), Expect = 0.000e+0
Identity = 761/770 (98.83%), Postives = 762/770 (98.96%), Query Frame = 1
Query:   70 MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEXXXXXXXXXXXXSFLNDENSQ 2379
            MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMN+SKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS        DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ
Sbjct:    1 MDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNVSKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS--------DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ 762          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 1457.2 bits (3771), Expect = 0.000e+0
Identity = 755/757 (99.74%), Postives = 757/757 (100.00%), Query Frame = 1
Query:  109 MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEXXXXXXXXXXXXSFLNDENSQ 2379
            MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMN+SKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKS+NQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ
Sbjct:    1 MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNVSKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSVNQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ 757          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 1434.08 bits (3711), Expect = 0.000e+0
Identity = 748/757 (98.81%), Postives = 749/757 (98.94%), Query Frame = 1
Query:  109 MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATXXXXXXXXXXXXXXPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQSGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDXXXXXXXXXXXXXXXSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFXXXXXXXXXXXXRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEXXXXXXXXXXXXSFLNDENSQ 2379
            MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMN+SKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS        DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ
Sbjct:    1 MRSRDGQQPFSKEIGSEFNMPKFPIEKHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKMLGTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTATRMRRRYMNVSKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQS--------DHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSDGSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAELNLLLRMTLKNLSFLNDENSQ 749          
The following BLAST results are available for this feature:
BLAST of AMP deaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMPD20.000e+057.69adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+057.69adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+057.69adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+057.69adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+057.69adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ampd-10.000e+055.02AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+055.02AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+055.23AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+055.18AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMPdeam0.000e+058.05gene:FBgn0052626 transcript:FBtr0303292[more]
AMPdeam0.000e+057.85gene:FBgn0052626 transcript:FBtr0340445[more]
AMPdeam0.000e+057.14gene:FBgn0052626 transcript:FBtr0309246[more]
AMPdeam0.000e+057.14gene:FBgn0052626 transcript:FBtr0301046[more]
AMPdeam0.000e+057.14gene:FBgn0052626 transcript:FBtr0073833[more]
back to top
BLAST of AMP deaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2b0.000e+058.27adenosine monophosphate deaminase 2b [Source:ZFIN;... [more]
ampd2b0.000e+058.27adenosine monophosphate deaminase 2b [Source:ZFIN;... [more]
ampd2a0.000e+056.74adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd2a0.000e+057.05adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd3b0.000e+050.54adenosine monophosphate deaminase 3b [Source:ZFIN;... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a50.000e+056.79solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+056.79solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+056.79solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+057.23solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+057.23solute carrier family 5 member 5 [Source:Xenbase;A... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ampd20.000e+058.31adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd20.000e+058.31adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd20.000e+058.31adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd30.000e+045.56adenosine monophosphate deaminase 3 [Source:MGI Sy... [more]
Ampd30.000e+045.56adenosine monophosphate deaminase 3 [Source:MGI Sy... [more]
back to top
BLAST of AMP deaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01433|AMPD2_HUMAN0.000e+057.69AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 P... [more]
sp|Q9DBT5|AMPD2_MOUSE0.000e+058.31AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 ... [more]
sp|Q02356|AMPD2_RAT0.000e+058.00AMP deaminase 2 OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|O09178|AMPD3_RAT0.000e+045.61AMP deaminase 3 OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|O08739|AMPD3_MOUSE0.000e+045.56AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 ... [more]
back to top
BLAST of AMP deaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SDY70.000e+058.46AMP deaminase OS=Opisthorchis felineus OX=147828 G... [more]
A0A4S2LG430.000e+059.57AMP deaminase OS=Opisthorchis felineus OX=147828 G... [more]
G7YNP10.000e+059.41AMP deaminase OS=Clonorchis sinensis OX=79923 GN=C... [more]
A0A131XL840.000e+052.98Putative adenosine monophosphate deaminase (Fragme... [more]
A0A131YJE50.000e+052.85AMP deaminase OS=Rhipicephalus appendiculatus OX=3... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2a0.000e+054.74adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd3b0.000e+050.77AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3b0.000e+050.77AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3b0.000e+050.77AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3a0.000e+050.08AMP deaminase 3-like [Source:NCBI gene;Acc:1030437... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ampd10.000e+051.23adenosine monophosphate deaminase 1 (isoform M) [S... [more]
ENSPMAT00000010379.11.438e-17246.32pep scaffold:Pmarinus_7.0:GL480085:7718:22400:1 ge... [more]
ampd2a5.960e-10747.72adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
AMD10.000e+056.89AMP deaminase; tetrameric enzyme that catalyzes th... [more]
YBR284W_mRNA3.011e-4730.55Putative metallo-dependent hydrolase superfamily p... [more]
YJL070C_mRNA5.782e-4630.03Putative metallo-dependent hydrolase superfamily p... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383890.000e+058.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2a0.000e+057.10AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+057.10AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+057.10AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+057.10AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+057.10AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
back to top
BLAST of AMP deaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018449.10.000e+099.74SMESG000018449.1[more]
SMESG000018449.10.000e+098.85SMESG000018449.1[more]
SMESG000018449.10.000e+098.83SMESG000018449.1[more]
SMESG000018449.10.000e+099.74SMESG000018449.1[more]
SMESG000018449.10.000e+098.81SMESG000018449.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021767 ID=SMED30021767|Name=AMP deaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=2635bp
TCAAATCTCTGATATTTCTGAAACATTTTAATAACCATGTCGTCAAAAAA
TAAAGAATTTCCGAAAATAATGGATTCTGAACTTGACAAAATCACAAACT
TATATCGAATGCGAAGTAGAGATGGCCAACAACCATTTTCAAAAGAAATT
GGAAGTGAATTCAATATGCCGAAATTTCCAATTGAAAAGCACGAATTGAA
ATCACATATTCTGGATTTAAAATTTCATAGTGAAGTAGAATTTAGTGAAA
CCGAAGATTCTTCGAATTTAATTATGGATTCACCGATTATGAATGACCCA
CTAAACCACCTGCATATGTTCGACCGAAAAATGCTTGGAACTGCTACGAG
TGATAGCATTTCAAGTATTCAATCAAAGAAGTCTAGTATTCCTAATTATC
AACGAATTGCCATTAAAGGAGCAGAAGAAACATCGCTGGCTCTGGAAGAA
ATTCAAGAAAATGCAAAGGCTCTTTTGACGGCAACACGAATGCGTCGCCG
ATACATGAACATATCTAAACAACCATTCCACAAGACGACTGATAGATACT
TATCCTTAATTGAAAGTGGAGTCAACACAAATGACCATCATTTCATCAAC
AACCAGCTTACTATGCAAAAGGAAGATGATTCCCAAAGCGGTAAATCTAT
AAATCAAAGCAAAGATCATCCGTTTAATGCTCCTGGAACCCAAGGAGACC
CATATAACATTGATAAGTTACCAGAAAAATTCGAAGTGGAGTTTGCATTT
AAGGACGGAGTTATGGCTGTATATAATCCTTCTGACGGCTCCAAGATCCA
TTGCGGTGTCGACTATTTAGAATTTGTTAGAGATTATCACGCTTTATCAA
CTTTTGTAAGTGATGGGCCATTAAAATCGTTTTGTTTTAAACGATTAAAT
TTTTTAAATTATCGCTTTAAAATGCATACTTTATTGAATGAGTGGAAAGA
AACTGCCGAACAAAAATCAGTGGCCCATAGAGATTTCTATAATATTAGAA
AAGTGGATACTCACATTCATGCATCTTCATCTATGAATCAGAAACATCTA
TTAAGATTTATTAAAAAATGTATCAAACTACATCCAAATGAAAAGGTAAT
GATTGAAAAAGCAAGTGGCCGCATATTGTCTTTAGTTGAGGTTTTCAAAT
CGATGGATCTGACACCATATGATCTGACAATTGACAAACTTGACGTGCAC
TGCGATCGTGATACGTTTCATAGATTTGACAAATTCAACGCTAAATACAA
TCCGGTTGGCCAAAGCGAACTGAGAGAAGTATTTCTTAAAACCGATAACT
ATAATAACGGCAGATTCTTTGCTCATGTCATTAAAGAAGTGATGGCAGAT
CTTGAAGAATCTAAATATCAGAATGCTGAACTAAGATTGTCGGTTTATGG
TCGCAAATACAATGAATGGGATTCATTAGCTAAATGGGCAGTTACAAACA
AAGTATATTCTGACAATGTTAAATGGATGATTCAATTTCCGAGAATTTAT
GATATTTTCCGAACGAAAGGAATTATCAAAAGTTTTCAGGAGATGTTACA
CAACATATTCACCCCACTATTTGAAGTGACTAGAGATCCTAGCAGTCATC
CGGAACTTCATGCTTTTCTAAATCATGTCAGTGGATTTGACTCAGTTGAC
GATGAATCGAAATCAGAATCGTGCGTAATTGATAAGAATACTCTAAATCC
TGAAAATTGGGTCTGTCAAGACAATCCGCCTTATGCTTATTATTTGTATT
ACATGTATGCAAACATGTCAGTATTAAATGAATTGAGAAGCCAACGTGGA
ATGGATATTTTTACATTCCGACCTCATTGTGGTGAAGCCGGACCAGTTCA
ACATTTGGTTGCTGGATTTCTTTTAGGTCATAATATTAATCACGGACTTT
TGCTGAGAAAAGCTCCAGTTCTTCAATATTTATACTATTTGTGTCAAATC
GGCATAGCGATGTCACCTTTGAGCAATAACTCGTTATTTCTCGATTATCA
ACGAAATCCATTATATGATTTTATGTGTCGTGGTCTTCACGTGAGTCTCA
GTACAGATGATCCTTTACAATTCCATTTCACAAAGGAACCTCTAATGGAA
GAGTACAGTATAGCGGCCCAAGTTTGGAAATTTACATCAACCGACATGTG
TGAACTTGCAAGAAATAGTGTCATGATGAGTGGCTTTTCTGATACTATCA
AATCCTTTTGGCTTGGAAAACAGTTCAAAGAAGAAGGAGTTCAAGGAAAC
GATGTTTTTCGTACAAACGTTCCTAACATTCGTATTGCATTTAGATTTGA
GGCATTAACAGCTGAACTGAATTTACTGCTCCGAATGACTTTGAAAAATT
TATCCTTTCTGAACGATGAAAACTCCCAATAAAACAGTCCTATTTAATTA
GAATTATTATCCATAAATTTATTTTTTACAAATGTTTTCATCAACTTTCA
ATTGTCTGTGATTTTAGTTAATTAAATTTAATCCGTAGCTTAAATGCAAT
ATTTTTAATACTTCATCAAGTACAATTCTTAGTGAAATCATGTTGCACAT
CGCATTCATTTTTTATTGGTTTATTACTGTGCTATTTGCGTTGATTTCTA
ACTATTTGTGGACATCGTTATTGGTTGAATAAATG
back to top

protein sequence of SMED30021767-orf-1

>SMED30021767-orf-1 ID=SMED30021767-orf-1|Name=SMED30021767-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=782bp
MSSKNKEFPKIMDSELDKITNLYRMRSRDGQQPFSKEIGSEFNMPKFPIE
KHELKSHILDLKFHSEVEFSETEDSSNLIMDSPIMNDPLNHLHMFDRKML
GTATSDSISSIQSKKSSIPNYQRIAIKGAEETSLALEEIQENAKALLTAT
RMRRRYMNISKQPFHKTTDRYLSLIESGVNTNDHHFINNQLTMQKEDDSQ
SGKSINQSKDHPFNAPGTQGDPYNIDKLPEKFEVEFAFKDGVMAVYNPSD
GSKIHCGVDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLL
NEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHP
NEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKF
NAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELR
LSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSF
QEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDK
NTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGE
AGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSL
FLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFT
STDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRI
AFRFEALTAELNLLLRMTLKNLSFLNDENSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001365A/AMP_deaminase_dom
IPR006329AMPD
IPR006650A/AMP_deam_AS
IPR032466Metal_Hydrolase
Vocabulary: molecular function
TermDefinition
GO:0019239deaminase activity
GO:0003876AMP deaminase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032264IMP salvage
GO:0009168purine ribonucleoside monophosphate biosynthetic process
GO:0006188IMP biosynthetic process
GO:0009117nucleotide metabolic process
GO:0042632cholesterol homeostasis
GO:0046033AMP metabolic process
GO:0046034ATP metabolic process
GO:0046039GTP metabolic process
GO:0052652cyclic purine nucleotide metabolic process
GO:0072015glomerular visceral epithelial cell development
GO:0097009energy homeostasis
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 129..149
NoneNo IPR availableGENE3DG3DSA:2.30.30.800coord: 333..425
e-value: 1.6E-252
score: 840.6
NoneNo IPR availableGENE3DG3DSA:3.20.20.140coord: 236..760
e-value: 1.6E-252
score: 840.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..224
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..214
NoneNo IPR availablePANTHERPTHR11359:SF0AMP DEAMINASEcoord: 96..770
IPR006329AMP deaminaseTIGRFAMTIGR01429TIGR01429coord: 137..764
e-value: 5.3E-271
score: 898.6
IPR006329AMP deaminasePIRSFPIRSF001251AMP_deaminasecoord: 3..775
e-value: 2.1E-282
score: 937.2
IPR006329AMP deaminasePANTHERPTHR11359AMP DEAMINASEcoord: 96..770
IPR001365Adenosine/AMP deaminase domainPFAMPF00962A_deaminasecoord: 319..728
e-value: 7.1E-114
score: 380.5
IPR006650Adenosine/AMP deaminase active sitePROSITEPS00485A_DEAMINASEcoord: 670..676
IPR032466Metal-dependent hydrolaseSUPERFAMILYSSF51556Metallo-dependent hydrolasescoord: 113..763