Myosin, heavy chain 11a, smooth muscle

Overview
NameMyosin, heavy chain 11a, smooth muscle
Smed IDSMED30021763
Length (bp)1403
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin, heavy chain 11a, smooth muscle (SMED30021763) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin, heavy chain 11a, smooth muscle (SMED30021763) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin, heavy chain 11a, smooth muscle (SMED30021763) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin, heavy chain 11a, smooth muscle (SMED30021763) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Match: MYH9 (myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:7579])

HSP 1 Score: 63.1586 bits (152), Expect = 8.202e-10
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI ++EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Match: MYH11 (myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:7569])

HSP 1 Score: 56.225 bits (134), Expect = 9.025e-8
Identity = 28/80 (35.00%), Postives = 49/80 (61.25%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
             IRQ+  ER F+IFY +++  K ++++ L+L   + + FL N  V I      + F ET+E + IMG +++EQ  I++V+
Sbjct:  271 AIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVV 350          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 55.8398 bits (133), Expect = 1.570e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            +RQ+  ER F+IFYQLLS   E LK+ L+L   + +RFL N  + I G      F ET+E + IMG + +E   +++V+
Sbjct:  282 VRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV 360          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 55.8398 bits (133), Expect = 1.623e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            +RQ+  ER F+IFYQLLS   E LK+ L+L   + +RFL N  + I G      F ET+E + IMG + +E   +++V+
Sbjct:  281 VRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV 359          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 55.8398 bits (133), Expect = 1.679e-7
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            +RQ+  ER F+IFYQLLS   E LK+ L+L   + +RFL N  + I G      F ET+E + IMG + +E   +++V+
Sbjct:  272 VRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV 350          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 53.9138 bits (128), Expect = 6.665e-8
Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLL-STKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            V+RQ+  ER F+IFYQ+L    ++ K+  +L  +  +RFL N  +++  +   Q F+ TI  ++IMG  D E   I+RV+
Sbjct:  278 VLRQAQDERSFHIFYQILRGCSAKEKSEYLLEGVDNYRFLVNRGITLPNVDDVQEFHSTINSMRIMGFADDEISSIMRVV 357          

HSP 2 Score: 21.557 bits (44), Expect = 6.665e-8
Identity = 7/12 (58.33%), Postives = 12/12 (100.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEF 268
            +S+V+L+GN+EF
Sbjct:  357 VSAVLLLGNLEF 368          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Celegans
Match: nmy-2 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5EBY3])

HSP 1 Score: 50.447 bits (119), Expect = 6.208e-7
Identity = 27/81 (33.33%), Postives = 49/81 (60.49%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLS--TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            V++Q+  ER F+IFYQLL   +K + ++ L+   +S ++F+ N    ++G+       ET+  + IMG+ D+E   I+RV+
Sbjct:  282 VLKQAPNERSFHIFYQLLKGLSKVQREHYLLEDSLSKYKFVSNGDSKLAGVDDGAEMKETLNAMSIMGLNDEEIGGILRVV 362          

HSP 2 Score: 21.9422 bits (45), Expect = 6.208e-7
Identity = 8/12 (66.67%), Postives = 11/12 (91.67%), Query Frame = 2
Query:  233 LSSVMLMGNMEF 268
            +S+VML GN+EF
Sbjct:  362 VSAVMLFGNLEF 373          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100467)

HSP 1 Score: 51.2174 bits (121), Expect = 2.140e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL+  + E +   +L ++ ++ FL N ++ + G+     F  T++ + IMG+T ++   I R++
Sbjct:  323 IRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 401          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0306576)

HSP 1 Score: 51.2174 bits (121), Expect = 2.141e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL+  + E +   +L ++ ++ FL N ++ + G+     F  T++ + IMG+T ++   I R++
Sbjct:  331 IRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 409          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302572)

HSP 1 Score: 51.2174 bits (121), Expect = 2.287e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL+  + E +   +L ++ ++ FL N ++ + G+     F  T++ + IMG+T ++   I R++
Sbjct:  278 IRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 356          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302574)

HSP 1 Score: 51.2174 bits (121), Expect = 2.287e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL+  + E +   +L ++ ++ FL N ++ + G+     F  T++ + IMG+T ++   I R++
Sbjct:  278 IRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 356          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100466)

HSP 1 Score: 51.2174 bits (121), Expect = 2.287e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL+  + E +   +L ++ ++ FL N ++ + G+     F  T++ + IMG+T ++   I R++
Sbjct:  278 IRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 356          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Match: myh14 (myosin, heavy chain 14, non-muscle [Source:ZFIN;Acc:ZDB-GENE-100921-1])

HSP 1 Score: 62.003 bits (149), Expect = 1.132e-9
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLLS  +E ++  L+LG    +RFLC  ++ + G   ++ F +T++ + IMG T +E   +++VI
Sbjct:  288 IRQAKDERTFHIFYQLLSGATEAMRKELLLGGADQYRFLCGGSLPVPGQSDSENFTQTMDSMTIMGFTQEESTSMLKVI 366          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Match: myh14 (myosin, heavy chain 14, non-muscle [Source:ZFIN;Acc:ZDB-GENE-100921-1])

HSP 1 Score: 62.003 bits (149), Expect = 1.141e-9
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLLS  +E ++  L+LG    +RFLC  ++ + G   ++ F +T++ + IMG T +E   +++VI
Sbjct:  288 IRQAKDERTFHIFYQLLSGATEAMRKELLLGGADQYRFLCGGSLPVPGQSDSENFTQTMDSMTIMGFTQEESTSMLKVI 366          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 58.5362 bits (140), Expect = 1.307e-8
Identity = 32/79 (40.51%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+   + L++ L L + + +RFL N  V+I G    + F ETI+  +IMGI + EQ  +++V+
Sbjct:  270 IRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIMGIPEDEQTGLLKVV 348          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 56.6102 bits (135), Expect = 6.042e-8
Identity = 32/79 (40.51%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+    +L++ L L + + +RFL N  V+I G    + F ETI+  +IMGI + EQ  +++V+
Sbjct:  273 IRQAKDERAFHIFYYLLTGAGDKLRSELCLEDYNKYRFLSNGNVTIPGQQDRELFAETIDAFRIMGIPEDEQTGLLKVV 351          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Match: myh11a (myosin, heavy chain 11a, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-050531-1])

HSP 1 Score: 53.9138 bits (128), Expect = 1.810e-7
Identity = 28/79 (35.44%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY +++ TK +L+  L+L   + +RFL    V I G    + ++ET+E ++IMG + +E+  +++V+
Sbjct:  270 IRQAKTERAFHIFYYMVAGTKDKLREELLLENFNNYRFLSAGHVQIPGNQDDEMYDETMEAMEIMGFSVEERADVLKVV 348          

HSP 2 Score: 21.1718 bits (43), Expect = 1.810e-7
Identity = 10/20 (50.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKT-RSQFQ 289
            +S+V+ +GN+EFK  R+Q Q
Sbjct:  348 VSTVLQLGNIEFKKERNQEQ 367          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 68.5514 bits (166), Expect = 1.681e-11
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
             IRQ+  ER F+IFY LLS   E LK+ L+L   + +RFL N  V+I G      F ET+E +KIMG T++EQ  ++RV+
Sbjct:  268 AIRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVV 347          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 63.5438 bits (153), Expect = 6.051e-10
Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK+ L+L   + +RFL N  V+I G      F ET+E +KIMG T++EQ  ++RV+
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVV 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 63.5438 bits (153), Expect = 6.386e-10
Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK+ L+L   + +RFL N  V+I G      F ET+E +KIMG T++EQ  ++RV+
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVV 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 63.5438 bits (153), Expect = 6.391e-10
Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK+ L+L   + +RFL N  V+I G      F ET+E +KIMG T++EQ  ++RV+
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVV 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 63.1586 bits (152), Expect = 6.507e-10
Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK+ L+L   + +RFL N  V+I G      F ET+E +KIMG T++EQ  ++RV+
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQQDKDLFQETMEAMKIMGFTEEEQIGLLRVV 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Match: Myh9 (myosin, heavy polypeptide 9, non-muscle [Source:MGI Symbol;Acc:MGI:107717])

HSP 1 Score: 62.3882 bits (150), Expect = 9.303e-10
Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI + EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 56.6102 bits (135), Expect = 7.050e-8
Identity = 31/79 (39.24%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+  K ++K+ L+L   +++ FL N  V I      + F ET+E + IMG  ++EQ  I++V+
Sbjct:  272 IRQARDERTFHIFYYLLAGAKEKMKSDLLLESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFNEEEQLAILKVV 350          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 56.6102 bits (135), Expect = 7.053e-8
Identity = 31/79 (39.24%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+  K ++K+ L+L   +++ FL N  V I      + F ET+E + IMG  ++EQ  I++V+
Sbjct:  279 IRQARDERTFHIFYYLLAGAKEKMKSDLLLESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFNEEEQLAILKVV 357          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 56.225 bits (134), Expect = 8.076e-8
Identity = 31/79 (39.24%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+  K ++K+ L+L   +++ FL N  V I      + F ET+E + IMG  ++EQ  I++V+
Sbjct:  272 IRQARDERTFHIFYYLLAGAKEKMKSDLLLESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFNEEEQLAILKVV 350          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 55.8398 bits (133), Expect = 9.555e-8
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            +RQ+  ER F+IFYQLLS   E LK+ L+L   + +RFL N  + I G      F ET+E + IMG + +E   +++V+
Sbjct:  309 VRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV 387          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Match: sp|P35579|MYH9_HUMAN (Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4)

HSP 1 Score: 63.1586 bits (152), Expect = 3.939e-9
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI ++EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Match: sp|Q258K2|MYH9_CANLF (Myosin-9 OS=Canis lupus familiaris OX=9615 GN=MYH9 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.008e-9
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI ++EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Match: sp|P14105|MYH9_CHICK (Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.473e-9
Identity = 37/79 (46.84%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI D+EQ  +++VI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPDEEQIGLLKVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Match: sp|Q62812|MYH9_RAT (Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 PE=1 SV=3)

HSP 1 Score: 62.7734 bits (151), Expect = 5.766e-9
Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI + EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Match: sp|Q8VDD5|MYH9_MOUSE (Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4)

HSP 1 Score: 62.3882 bits (150), Expect = 6.508e-9
Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LLS   E LK  L+L   + +RFL N  V+I G      F ET+E ++IMGI + EQ  ++RVI
Sbjct:  265 IRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVI 343          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Match: A0A0V0J4N1 (Myosin heavy chain, non-muscle (Fragment) OS=Schistocephalus solidus OX=70667 GN=MYSN PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.491e-11
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+  ER F+IFYQLLS+ +  LK TL++ E + F +L N  + +  +   QAF ET E + IMGITD EQ+ I R++
Sbjct:  244 VIRQAPDERTFHIFYQLLSSATPALKQTLLITEPTNFAYLSNGILEVPSLDEKQAFAETTEAMAIMGITDDEQQAIFRIL 323          

HSP 2 Score: 23.8682 bits (50), Expect = 2.491e-11
Identity = 9/13 (69.23%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            LS+V+ +GNMEFK
Sbjct:  323 LSAVLHLGNMEFK 335          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Match: A0A0X3NYF6 (Myosin heavy chain, non-muscle (Fragment) OS=Schistocephalus solidus OX=70667 GN=MYSN PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.492e-11
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+  ER F+IFYQLLS+ +  LK TL++ E + F +L N  + +  +   QAF ET E + IMGITD EQ+ I R++
Sbjct:  244 VIRQAPDERTFHIFYQLLSSATPALKQTLLITEPTNFAYLSNGILEVPSLDEKQAFAETTEAMAIMGITDDEQQAIFRIL 323          

HSP 2 Score: 23.8682 bits (50), Expect = 2.492e-11
Identity = 9/13 (69.23%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            LS+V+ +GNMEFK
Sbjct:  323 LSAVLHLGNMEFK 335          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Match: Q5C0P5 (SJCHGC07125 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.336e-11
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+S ER F+IFYQLL++ +  ++  L+L   S++RFL N  + + G+   Q F ET + + IMGI +++Q  I RVI
Sbjct:   10 VIRQASDERSFHIFYQLLASATPAMQQQLLLNHASSYRFLSNGMIELPGVDEQQFFRETTDAMDIMGINNEDQNAIFRVI 89          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Match: A0MP08 (Myosin-2a (Fragment) OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.503e-10
Identity = 37/80 (46.25%), Postives = 52/80 (65.00%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
             IRQ+  ER F+IFY L+S   E LK+ L+L   + +RFL N  V+I G +    F ET+E +KIMG TD+EQ  ++RV+
Sbjct:   70 AIRQAKDERTFHIFYYLMSGAGEHLKSDLLLEAYNKYRFLSNGHVTIPGQLDKDLFQETMEAMKIMGFTDEEQTGLLRVV 149          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Match: A0A183T9Y1 (Myosin heavy chain, non-muscle OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13279 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.585e-10
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKS-ELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+  ER F+IFYQLLS+ +  LK TL++ E + F +L N  + +  +   QAF ET E ++IMGITD EQ+ I R++
Sbjct:  285 VIRQAPDERTFHIFYQLLSSATPALKQTLLITEPTNFAYLSNGILEVPSLDEKQAFAETTEAMEIMGITDDEQQAIFRIL 364          

HSP 2 Score: 23.8682 bits (50), Expect = 1.585e-10
Identity = 9/13 (69.23%), Postives = 12/13 (92.31%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            LS+V+ +GNMEFK
Sbjct:  364 LSAVLHLGNMEFK 376          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Match: myh14 (myosin, heavy chain 14, non-muscle [Source:ZFIN;Acc:ZDB-GENE-100921-1])

HSP 1 Score: 59.3066 bits (142), Expect = 6.790e-9
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQLL   S+ +K  L+LG    +RFLC  ++ + G   A  F +T++ + IMG T +E   +++VI
Sbjct:  285 IRQAKDERTFHIFYQLLCGASDAMKGELLLGGADQYRFLCGGSIPVPGQSDADNFIQTMDSMSIMGFTPEECTSMLKVI 363          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 56.6102 bits (135), Expect = 1.558e-8
Identity = 33/79 (41.77%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F++FY LLS   + L++ L L + S +RFL N  V+I G      F ET++  KIM I + EQ  +++VI
Sbjct:  263 IRQAKEERTFHMFYYLLSGAGDKLRSELCLEDYSKYRFLSNGKVTIPGQQDRDLFTETLDAFKIMSIPEDEQTGLLKVI 341          

HSP 2 Score: 21.557 bits (44), Expect = 1.558e-8
Identity = 8/13 (61.54%), Postives = 11/13 (84.62%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            +SSV+ +GNM FK
Sbjct:  341 ISSVLQLGNMSFK 353          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 54.6842 bits (130), Expect = 9.357e-8
Identity = 29/79 (36.71%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY +++  K +L+  L+L   + +RFL    V I G    + + ET+E + IMG++D+E+  I++V+
Sbjct:  273 IRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVV 351          

HSP 2 Score: 21.1718 bits (43), Expect = 9.357e-8
Identity = 10/20 (50.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKT-RSQFQ 289
            +S+V+ +GN+EFK  R+Q Q
Sbjct:  351 VSTVLQLGNIEFKKERNQEQ 370          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 54.299 bits (129), Expect = 1.168e-7
Identity = 29/79 (36.71%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY +++  K +L+  L+L   + +RFL    V I G    + + ET+E + IMG++D+E+  I++V+
Sbjct:  279 IRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVV 357          

HSP 2 Score: 21.1718 bits (43), Expect = 1.168e-7
Identity = 10/20 (50.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKT-RSQFQ 289
            +S+V+ +GN+EFK  R+Q Q
Sbjct:  357 VSTVLQLGNIEFKKERNQEQ 376          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 54.299 bits (129), Expect = 1.287e-7
Identity = 29/79 (36.71%), Postives = 50/79 (63.29%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY +++  K +L+  L+L   + +RFL    V I G    + + ET+E + IMG++D+E+  I++V+
Sbjct:  279 IRQAKTERAFHIFYYMVAGAKDKLREELLLESFNNYRFLMAGHVQIPGNQDDEMYEETMEAMNIMGLSDEERIGILKVV 357          

HSP 2 Score: 21.1718 bits (43), Expect = 1.287e-7
Identity = 10/20 (50.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKT-RSQFQ 289
            +S+V+ +GN+EFK  R+Q Q
Sbjct:  357 VSTVLQLGNIEFKKERNQEQ 376          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010634.1 (pep scaffold:Pmarinus_7.0:GL481212:2267:20773:1 gene:ENSPMAG00000009630.1 transcript:ENSPMAT00000010634.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 2.334e-12
Identity = 36/80 (45.00%), Postives = 49/80 (61.25%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
             IRQ+  ER F+IFYQLL+  +E L+  L+L   S +RFL N  V I G      F ET+E L+IMG   +EQ  ++RV+
Sbjct:   67 AIRQAKDERAFHIFYQLLTGATEHLRTELLLEGFSNYRFLSNGYVPIPGQQDKDNFQETMESLRIMGFAHEEQMALLRVV 146          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 62.7734 bits (151), Expect = 1.062e-10
Identity = 36/80 (45.00%), Postives = 46/80 (57.50%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE-LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
             IRQ+  ER F+IFYQLLS   E LK  L+L   + +RFL N  V I G      F ET   + IMG T +EQ  ++RV+
Sbjct:  277 AIRQAKDERTFHIFYQLLSGAGEHLKTDLLLEGYNNYRFLSNGNVVIPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVV 356          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 56.225 bits (134), Expect = 6.474e-8
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+    +L+  L+L   + +RFL N  V+I G      FNET++  KIM I ++EQ  +++V+
Sbjct:  263 IRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGNVTIPGQQDKDLFNETMDAFKIMSIPEEEQIGMLKVV 341          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 56.225 bits (134), Expect = 6.590e-8
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLLS-TKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFY LL+    +L+  L+L   + +RFL N  V+I G      FNET++  KIM I ++EQ  +++V+
Sbjct:  270 IRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGNVTIPGQQDKDLFNETMDAFKIMSIPEEEQIGMLKVV 348          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Match: myh14 (myosin-10 [Source:NCBI gene;Acc:101160019])

HSP 1 Score: 53.9138 bits (128), Expect = 3.696e-7
Identity = 28/79 (35.44%), Postives = 47/79 (59.49%), Query Frame = 1
Query:    4 IRQSSIER*FNIFYQLL-STKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            IRQ+  ER F+IFYQ+L     E +  L+LG    +RFL   ++ + G   ++ F +T++ + IMG T +E   +++VI
Sbjct:  286 IRQAKDERTFHIFYQMLCGATEETRAELLLGNADEYRFLTGGSIPVPGQSDSENFTQTMDSMAIMGFTAEESISMLKVI 364          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 48.9062 bits (115), Expect = 7.038e-6
Identity = 25/81 (30.86%), Postives = 48/81 (59.26%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE--LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            V++Q   ER F++FYQLLS  S+  LK   +  ++S + +LC  + S+SG+  A  F      ++I+G  + E + +++++
Sbjct:  192 VVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCLDSASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLV 272          

HSP 2 Score: 20.4014 bits (41), Expect = 7.038e-6
Identity = 7/17 (41.18%), Postives = 14/17 (82.35%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKTRSQ 283
            +++V+ +GN+EFK  S+
Sbjct:  272 VAAVLKLGNIEFKPESR 288          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 48.9062 bits (115), Expect = 7.152e-6
Identity = 25/81 (30.86%), Postives = 48/81 (59.26%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSE--LKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            V++Q   ER F++FYQLLS  S+  LK   +  ++S + +LC  + S+SG+  A  F      ++I+G  + E + +++++
Sbjct:  192 VVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCLDSASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLV 272          

HSP 2 Score: 20.4014 bits (41), Expect = 7.152e-6
Identity = 7/17 (41.18%), Postives = 14/17 (82.35%), Query Frame = 2
Query:  233 LSSVMLMGNMEFKTRSQ 283
            +++V+ +GN+EFK  S+
Sbjct:  272 VAAVLKLGNIEFKPESR 288          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 129.028 bits (323), Expect = 5.303e-32
Identity = 62/79 (78.48%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+S ER F+IFYQLLSTKSE+KNTL+LGEMS +RFLCN A SISGI   QAFNETIE LKIMGITD+EQE I RVI
Sbjct:  285 VIRQASEERSFHIFYQLLSTKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVI 363          

HSP 2 Score: 28.4906 bits (62), Expect = 5.303e-32
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            +SSVMLMGNMEFK
Sbjct:  363 ISSVMLMGNMEFK 375          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 129.028 bits (323), Expect = 5.481e-32
Identity = 62/79 (78.48%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+S ER F+IFYQLLSTKSE+KNTL+LGEMS +RFLCN A SISGI   QAFNETIE LKIMGITD+EQE I RVI
Sbjct:  279 VIRQASEERSFHIFYQLLSTKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVI 357          

HSP 2 Score: 28.1054 bits (61), Expect = 5.481e-32
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            +SSVMLMGNMEFK
Sbjct:  357 ISSVMLMGNMEFK 369          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 129.028 bits (323), Expect = 5.482e-32
Identity = 62/79 (78.48%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+S ER F+IFYQLLSTKSE+KNTL+LGEMS +RFLCN A SISGI   QAFNETIE LKIMGITD+EQE I RVI
Sbjct:  279 VIRQASEERSFHIFYQLLSTKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVI 357          

HSP 2 Score: 28.1054 bits (61), Expect = 5.482e-32
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            +SSVMLMGNMEFK
Sbjct:  357 ISSVMLMGNMEFK 369          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 129.028 bits (323), Expect = 5.712e-32
Identity = 62/79 (78.48%), Postives = 68/79 (86.08%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLLSTKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVI 237
            VIRQ+S ER F+IFYQLLSTKSE+KNTL+LGEMS +RFLCN A SISGI   QAFNETIE LKIMGITD+EQE I RVI
Sbjct:  279 VIRQASEERSFHIFYQLLSTKSEMKNTLLLGEMSGYRFLCNGAASISGIDEVQAFNETIEALKIMGITDEEQECIFRVI 357          

HSP 2 Score: 28.1054 bits (61), Expect = 5.712e-32
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 2
Query:  233 LSSVMLMGNMEFK 271
            +SSVMLMGNMEFK
Sbjct:  357 ISSVMLMGNMEFK 369          
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Match: SMESG000062420.1 (SMESG000062420.1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.140e-12
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:    1 VIRQSSIER*FNIFYQLL-STKSELKNTLMLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRVIIC 243
            VIRQ++ ER F++FYQLL      LK  L+L  +S ++ L N  +++      Q F +T+E L IMGI+  EQE I RVI  
Sbjct:  280 VIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNGMIAVPDYDEKQMFKDTVEALDIMGISKDEQESIFRVIAA 361          
The following BLAST results are available for this feature:
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH98.202e-1046.84myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH119.025e-835.00myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH101.570e-740.51myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH101.623e-740.51myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH101.679e-740.51myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nmy-16.665e-836.25Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
nmy-26.208e-733.33Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zip2.140e-632.91gene:FBgn0265434 transcript:FBtr0100467[more]
zip2.141e-632.91gene:FBgn0265434 transcript:FBtr0306576[more]
zip2.287e-632.91gene:FBgn0265434 transcript:FBtr0302572[more]
zip2.287e-632.91gene:FBgn0265434 transcript:FBtr0302574[more]
zip2.287e-632.91gene:FBgn0265434 transcript:FBtr0100466[more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh141.132e-939.24myosin, heavy chain 14, non-muscle [Source:ZFIN;Ac... [more]
myh141.141e-939.24myosin, heavy chain 14, non-muscle [Source:ZFIN;Ac... [more]
myh9a1.307e-840.51myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh9a6.042e-840.51myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh11a1.810e-735.44myosin, heavy chain 11a, smooth muscle [Source:ZFI... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH91.681e-1146.25myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH96.051e-1046.84myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH96.386e-1046.84myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH96.391e-1046.84myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH96.507e-1046.84myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh99.303e-1046.84myosin, heavy polypeptide 9, non-muscle [Source:MG... [more]
Myh117.050e-839.24myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
Myh117.053e-839.24myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
Myh118.076e-839.24myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
Myh109.555e-840.51myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35579|MYH9_HUMAN3.939e-946.84Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4[more]
sp|Q258K2|MYH9_CANLF4.008e-946.84Myosin-9 OS=Canis lupus familiaris OX=9615 GN=MYH9... [more]
sp|P14105|MYH9_CHICK5.473e-946.84Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=... [more]
sp|Q62812|MYH9_RAT5.766e-946.84Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 PE=... [more]
sp|Q8VDD5|MYH9_MOUSE6.508e-946.84Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J4N12.491e-1147.50Myosin heavy chain, non-muscle (Fragment) OS=Schis... [more]
A0A0X3NYF62.492e-1147.50Myosin heavy chain, non-muscle (Fragment) OS=Schis... [more]
Q5C0P54.336e-1143.75SJCHGC07125 protein (Fragment) OS=Schistosoma japo... [more]
A0MP081.503e-1046.25Myosin-2a (Fragment) OS=Xenopus laevis OX=8355 PE=... [more]
A0A183T9Y11.585e-1047.50Myosin heavy chain, non-muscle OS=Schistocephalus ... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh146.790e-940.51myosin, heavy chain 14, non-muscle [Source:ZFIN;Ac... [more]
myh9a1.558e-841.77myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh11a9.357e-836.71myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a1.168e-736.71myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a1.287e-736.71myosin-11-like [Source:NCBI gene;Acc:103025732][more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010634.12.334e-1245.00pep scaffold:Pmarinus_7.0:GL481212:2267:20773:1 ge... [more]
myh101.062e-1045.00myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh9b6.474e-840.51myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh9b6.590e-840.51myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh143.696e-735.44myosin-10 [Source:NCBI gene;Acc:101160019][more]
myo1b7.038e-630.86myosin IB [Source:NCBI gene;Acc:101175446][more]
myo1b7.152e-630.86myosin IB [Source:NCBI gene;Acc:101175446][more]
back to top
BLAST of Myosin, heavy chain 11a, smooth muscle vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049494.15.303e-3278.48SMESG000049494.1[more]
SMESG000049494.15.481e-3278.48SMESG000049494.1[more]
SMESG000049494.15.482e-3278.48SMESG000049494.1[more]
SMESG000049494.15.712e-3278.48SMESG000049494.1[more]
SMESG000062420.18.140e-1242.68SMESG000062420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021763 ID=SMED30021763|Name=Myosin, heavy chain 11a, smooth muscle|organism=Schmidtea mediterranea sexual|type=transcript|length=1403bp
GTTATTCGGCAATCGTCTATAGAAAGATAATTTAATATTTTCTATCAGCT
ACTTTCAACAAAATCTGAGTTGAAAAATACTTTAATGCTCGGTGAAATGT
CTGCTTTCAGATTTCTTTGCAATGCTGCTGTATCGATTTCTGGCATTGTT
GTGGCGCAAGCATTCAATGAAACTATAGAAGTGCTGAAGATTATGGGAAT
CACTGATAAAGAGCAAGAATACATAATTCGAGTTATCATCTGTAATGCTA
ATGGGCAATATGGAGTTCAAAACAAGATCACAATTCCAATATCGAAGTTG
CACAAGCTGAAAAGAGTGAATCGGACGATTCTTCCTCTGAAAAAGATTAT
TTCAATGATTATTTCTGTCAAAACGATATCATATTCTTTGATGTGGATGA
ACAATGCTTCGTTTTAATGTTCTTATGAAGAAATGGCAAATGTGTCTGCA
CATTACTTCCATTATCCAAGTGACAAGATTCAATTCTATATATCACAGCC
TGGCTTCTCGAATAAAGAGTATTCTAGAAATAAATGTCAAAGACGAATTT
ATTATAAGAAGCGTTCTATTCTAGTCAGAGTTGGAAAACATGTGTCAGGC
CAATTGCCTTTATTTTTATTCTGGCAATCTCAACCATTCAGCTTTAATCA
AAGATCTCATCAATGCTATCTCAAAGCAAATCAGTATTTATCAAAACAAC
ATTACCTTCCATATTCTTCCATCGAAACAACATTTGAAAATCGATGGAAG
TTCGCATTTTGCTCTTTTGTACCTTAAATCTGGACATTGGCAAATCGAAT
TGGATAAAGAAAGCAAACTATATATAGATAAAAAAACAGCTGTGATATTT
TGGACAAAAATGGTTCAAAATTGAAAGGATACCATTGAAATCTATTGGAC
AATTCATTTGGAGATTCATTTTAGGAAGAAACTTTACAATAAAGCCCGAC
CACAAGTTACTTGAACTTTTTTAATAACCAATCGTTACCAAAATTTATAT
CGTCAAGAATAGCCAGGTGGGCAACTGAAATCATGGGATATTGTCGGTCT
ATTAATACAACATTTGGATGCGTTATCCAAACTTTAATACAATGAAATGA
TATTCAATACCAATGAAGAAACTACAGAATCAAAGTAGTTCCATCCCGGA
AAATTTATATCCGATACAGAAGCAGAAAAAATAACAACAATTTAAGAAAA
ATAAATTATTTAATTATCACAGGTAACTGGACTAACTGCTCCAAGAATGT
TTTTGCAACGCATAAAGGACTGTTTACAATCAAACACAATTGAATTTACA
GAAACCTGTGTTCATGAATTATTGATAGAACCATACTGTTAAACAAGCGT
GCAAAACAGAAACGAGTCTAAACCATAAAATGAACAAGATATGTACTACT
ATA
back to top

protein sequence of SMED30021763-orf-1

>SMED30021763-orf-1 ID=SMED30021763-orf-1|Name=SMED30021763-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MLGEMSAFRFLCNAAVSISGIVVAQAFNETIEVLKIMGITDKEQEYIIRV
IICNANGQYGVQNKITIPISKLHKLKRVNRTILPLKKIISMIISVKTISY
SLMWMNNASF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex