Na channel amiloride sensitive

Overview
NameNa channel amiloride sensitive
Smed IDSMED30021762
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Na channel amiloride sensitive (SMED30021762) t-SNE clustered cells

Violin plots show distribution of expression levels for Na channel amiloride sensitive (SMED30021762) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Na channel amiloride sensitive (SMED30021762) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Na channel amiloride sensitive (SMED30021762) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021762

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021762SMESG000002761.1 SmedASXL_008722SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021762SMESG000002761.1 SMESG000002742.1 SmedASXL_008721SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021762SMESG000002761.1 SMESG000002742.1 dd_Smed_v6_24722_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Na channel amiloride sensitive vs. TrEMBL
Match: G4LY47 (Amiloride-sensitive sodium channel,putative OS=Schistosoma mansoni OX=6183 GN=Smp_175020 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.554e-85
Identity = 173/459 (37.69%), Postives = 244/459 (53.16%), Query Frame = 3
Query:   54 LFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFR-KITD-----RLTVIQNKITNSSLQW-TTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLN----------------------------------TKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVL---RHSLRPCPIGCVKKVCL-SQISYEVCPSSCTVAKYNKHNIL-----EQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            +F  SSL+PL+KIANAPS+S+RILW I +  M IGL VCI  VV QY   QT+FQLDYSG+ T  D  P I+IC  + E + +F+ AMK +    +   L          PW    V    R K+ +     +  +I +++    L W T+ +AIS +Y+++ NF+V+F I P    +++ L V EQVP    F+CTTFE  +++ + SWS + + +  E       T E   R     I HE+G LP+SAYD+HI   +   + ++++ SKSVT RLN                                  TK        T SLFG ++ Y  +ACGW ECC K    CNCTC +D+L   R +L+     C +  C   QI YE CP  C   K+ KH+ +     E       ++L LV+S++V +A EEE+++L KL SE+GGLCSLFIGFSC
Sbjct:    7 VFSQSSLVPLAKIANAPSRSLRILWAIVTAIMFIGLCVCISLVVMQYLKHQTVFQLDYSGRHTVYDQVPGITICPQSQESKRLFLDAMKRLNIITQPIPL----------PWFSKTVMDQLRMKVIEIQPDLKFGIIVHRLPKGELLWNTSKTAISPIYRMLLNFSVEFQIQPSYLADSYRLTVMEQVPNIRNFLCTTFELRSNNVEKSWSYLEIRINQE------STIENSNRVTFIIITHERGELPFSAYDRHIHTNLPPDTSVSLYFSKSVTTRLNTDYLDTIRMKNKQQTFVSDTTNYLQFALKRLKQKTKEQYLSQTNTVSLFGTEFLYSREACGWVECCTKVAYHCNCTCTLDLLSINRTALQ-THFLCERTQCQDEQIPYETCPLPCIQTKFIKHSEVRLPGYEDGLPILTSRLKLVRSESVQVAMEEEIFSLAKLFSEVGGLCSLFIGFSC 448          
BLAST of Na channel amiloride sensitive vs. TrEMBL
Match: A0A4E0RB86 (Na channel amiloride sensitive OS=Fasciola hepatica OX=6192 GN=D915_003419 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.316e-57
Identity = 118/304 (38.82%), Postives = 168/304 (55.26%), Query Frame = 3
Query:   51 NLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDR------LTVIQNKITNSSLQWTTH-SAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYS-WSGINVVVENELDTVINQT---PEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGNDYE 929
            ++F  SSL+PL+KIANAPS+S+R+LW +F+ TM +GL  CI  VV QYC  QT+FQLDYSG+    D  P +++C    E + +F  A+   +N+                PWL       FR+I  +        V+ +++    LQW T  SA+S LY ++HNF+V+F + P    ++  L V EQVP    F+CTTFE  + +P  S WS         L+  +NQT   P          I HE+G LP+SAYD+HI  ++  GS+++V+ SKS+T RLNT RNPC A     L+    E
Sbjct:    6 SVFSQSSLVPLAKIANAPSRSLRLLWAVFTATMFVGLCACITLVVIQYCRHQTVFQLDYSGRNVIYDQIPGLTLCPQTQEAKRLFHLAVNMEVNKH-------------PSPWLNKQALDKFRQIAKQHKPNMSFEVLTHRMPPGQLQWDTQKSALSPLYGMLHNFSVRFVMQPAQTGDSHRLTVMEQVPNPKHFLCTTFELRSQNPSVSRWS--------YLEMQLNQTATPPGSDMFSSFILITHERGELPFSAYDRHIQTSMTPGSDVSVYFSKSITARLNTARNPCHASPDMHLWQTGME 288          

HSP 2 Score: 120.939 bits (302), Expect = 7.353e-25
Identity = 62/155 (40.00%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  840 LSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPI--GCVKKVC-LSQISYEVCPSSCTVAKYNKHN-ILEQKCEKHMN----KLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            ++ SV+ +    +   L   T  LFG  + Y  ++CGW EC  K  + CNC+  +++  + +  C     C +  C + QISY+ CP +C VAK+ KHN I E   E ++     ++ LV+S+ V +ATEEE+++L KL SE+GGLCSLFIGFSC
Sbjct:  339 MNHSVSEQPLEPQKAALKGSTVRLFGTTFFYSRESCGWAECSRKVRQVCNCSSVVELWSYKMHGCEAVEACERAECQVKQISYKTCPLACVVAKFVKHNTITETGSEVNLAPGAIQIKLVRSEAVQVATEEEIFSLAKLFSEVGGLCSLFIGFSC 493          
BLAST of Na channel amiloride sensitive vs. TrEMBL
Match: A0A504Y611 (Na channel amiloride sensitive OS=Fasciola gigantica OX=46835 GN=FGIG_02532 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 3.871e-57
Identity = 115/290 (39.66%), Postives = 164/290 (56.55%), Query Frame = 3
Query:   51 NLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDR------LTVIQNKITNSSLQWTTH-SAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYS-WSGINVVVENELDTVINQT---PEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPC 887
            ++F  SSL+PL+KIANAPS+S+R+LW +F+ TM +GL  CI  VV QYC  QT+FQLDYSG+    D  P +++C    E + +F  A+   +N+                PWL       FR+I  +        V+ +++    LQW T  SA+S LY ++HNF+V+F + P    ++  L V EQVP    F+CTTFE  + +P  S WS         L+  +NQT   P          I HE+G LP+SAYD+HI  ++  GS+++V+ SKS+T RLNT RNPC
Sbjct:    6 SVFSQSSLVPLAKIANAPSRSLRLLWAVFTATMFVGLCACITLVVIQYCRHQTVFQLDYSGRNVIYDQIPGLTLCPQTQEAKRLFHLAVNMEVNKH-------------PSPWLNKQALDKFRQIAKQRKPNMSFEVLTHRMPPGQLQWDTQKSALSPLYGMLHNFSVRFVMQPAQTGDSHRLTVMEQVPNPKHFLCTTFELRSQNPSVSRWS--------YLEMQLNQTATPPGSDMFSSFILITHERGELPFSAYDRHIQTSMTPGSDVSVYFSKSITARLNTARNPC 274          

HSP 2 Score: 120.939 bits (302), Expect = 6.543e-25
Identity = 62/155 (40.00%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  840 LSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPI--GCVKKVC-LSQISYEVCPSSCTVAKYNKHN-ILEQKCEKHMN----KLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            ++ SV+ +    +   L   T  LFG  + Y  ++CGW EC  K  + CNC+  +++  + +  C     C +  C + QISY+ CP +C VAK+ KHN I E   E ++     ++ LV+S+ V +ATEEE+++L KL SE+GGLCSLFIGFSC
Sbjct:  339 MNHSVSEQPLEPQKAALKGSTVRLFGTTFFYSRESCGWAECSRKVRQVCNCSSVVELWSYKMHGCEAVEACERAECQVKQISYKTCPLACVVAKFVKHNTITETGSEVNLAPGAIQIKLVRSEAVQVATEEEIFSLAKLFSEVGGLCSLFIGFSC 493          
BLAST of Na channel amiloride sensitive vs. TrEMBL
Match: A0A068Y416 (Na channel amiloride sensitive OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000424600 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 4.839e-57
Identity = 115/289 (39.79%), Postives = 165/289 (57.09%), Query Frame = 3
Query:   54 LFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKIT------DRLTVIQNKITNSSLQWTTH-SAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYSWSGINVVVENELDT--VINQTPEKLKRYQVNF--IVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPC 887
            +F  SSL+P++KIA+AP++  RI+W+I S  M IGL  CI  V+ QYC+ QT+FQLDYSG+ +  D  P I+IC    E+  +F  A K    +  +  + KK +     PWL S V+    K+       D    I + + + SL W T   A S +Y+ +HNF+V F I P S  NN+ L V EQVP    F+CTTFE     P+  WS +   ++ ++    +  +T   +K     F  I HE+G LP+SAYD++I  T+   SE++++ SKSVTRR NT RNPC
Sbjct:    7 VFSQSSLVPIAKIASAPTRLQRIIWVIISTAMFIGLCSCITLVIIQYCMHQTVFQLDYSGRHSVYDQIPGITICPDPQEIHRLFDHARK----KHGWPKVNKKAEQGTV-PWLNSAVNKELLKLITANKALDPPGAIGHYLPSGSLYWDTQVVAKSPIYRALHNFSVTFQIKPASVVNNYQLFVLEQVPNVRQFMCTTFELTTRRPELGWSHVEFTIQQDMHMAGIATETRSSVKPRGTTFGIIAHERGELPFSAYDRNIYTTLAPESEVSIYYSKSVTRRANTARNPC 290          

HSP 2 Score: 123.635 bits (309), Expect = 6.782e-26
Identity = 66/150 (44.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  861 RLNTKRNPCLAKGT--TSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDID-VLRHSLRPCP-IGCVKKVCL-SQISYEVCPSSCTVAKYNKHNIL-----EQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            R N +R P   K     SLF  ++ Y  +ACGWK CC+K    C CTC +D +L  +   CP   C +  C  S + Y+ CP  C ++K+ K N+L     + K   + +KL L++S+NV +A EEE+Y+L KL SEIGGLCSLFIGFSC
Sbjct:  346 RTNERRQPATLKSAKAVSLFNTEFLYSREACGWKVCCMKVALECGCTCTMDWLLSTATANCPNDRCERTQCSDSPVLYDQCPMPCVLSKFVKQNLLVIEPPDSKLPANTSKLKLIRSENVQVAAEEEIYSLAKLFSEIGGLCSLFIGFSC 495          
BLAST of Na channel amiloride sensitive vs. TrEMBL
Match: A0A0R3VSP1 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS194 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.005e-57
Identity = 114/293 (38.91%), Postives = 169/293 (57.68%), Query Frame = 3
Query:   42 IMKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKIT------DRLTVIQNKITNSSLQWTTH-SAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYSWSGINVVVENELDT--VINQTPEKLKRYQVNF--IVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPC 887
            +   +F  SSL+P++KIA+AP++  RI+W+I S  M IGL  CI  V+ QYC+ QT+FQLDYSG+ T  D  P I+IC    E+  +F  A K     + + +  KK +     PWL S V+    K+       D    I + + + SL W T   A S +Y+V+HNF+V F I P +  NN+ L V EQVP    F+CTTFE     P++ WS + + ++ ++    +   T + +K     F  I HE+G LP+SAYD++I  T+   +E++++ SKSVTRR NT R+PC
Sbjct:    3 LASEVFSQSSLVPIAKIASAPTRLQRIIWVIISTAMFIGLCSCITLVIIQYCMHQTVFQLDYSGRHTVYDQIPGITICPDPQEIHRLFNYARKV----RGWPEANKKAEQGTV-PWLNSAVNKELLKLITANRALDPPGAIGHYLPSGSLYWDTQVVAKSPIYRVLHNFSVTFQIKPANVLNNYQLFVLEQVPNVRQFMCTTFELTTRRPEHGWSYVEITIQQDMHMAGIATDTADSVKPRGTTFGIIAHERGELPFSAYDRNIYTTLAPENEVSIYYSKSVTRRANTARSPC 290          

HSP 2 Score: 123.25 bits (308), Expect = 1.107e-25
Identity = 66/150 (44.00%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  861 RLNTKRNPCLAKGT--TSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDID-VLRHSLRPCPIG-CVKKVCL-SQISYEVCPSSCTVAKYNKHNIL-----EQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            R N +R P   K     SLF  ++ Y  +ACGWK CC+K    C CTC +D +L  +   CP   C +  C  S + Y  CP  C ++K+ K N+L     + K   + +KL L++S+NV +A EEE+Y+L KL SEIGGLCSLFIGFSC
Sbjct:  346 RTNEERQPATQKSAKAVSLFNTEFLYSREACGWKVCCMKVALECGCTCTMDWLLSTATENCPNDRCERTQCSDSPVLYNQCPMPCVLSKFVKQNLLIIEPPDSKLPANTSKLKLIRSENVQVAAEEEIYSLAKLFSEIGGLCSLFIGFSC 495          
BLAST of Na channel amiloride sensitive vs. Planmine SMEST
Match: SMESG000002742.1 (SMESG000002742.1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 339/339 (100.00%), Postives = 339/339 (100.00%), Query Frame = 3
Query:  594 VPRTWGFICTTFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQISYEVCPSSCTVAKYNKHNILEQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSCXXXXXXXXXXXXWRSSAYINDSNTLYLSKSLDVSNSPQMNHFLTPRYSSNSPSPTEVNEVQNFNCSRTIILMLLADNMANTEYFFHGEKDVDKMLLHEQLRLGRVKIRLI 1610
            VPRTWGFICTTFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQISYEVCPSSCTVAKYNKHNILEQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSCIFLFEIIEAFIIWRSSAYINDSNTLYLSKSLDVSNSPQMNHFLTPRYSSNSPSPTEVNEVQNFNCSRTIILMLLADNMANTEYFFHGEKDVDKMLLHEQLRLGRVKIRLI
Sbjct:    8 VPRTWGFICTTFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQISYEVCPSSCTVAKYNKHNILEQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSCIFLFEIIEAFIIWRSSAYINDSNTLYLSKSLDVSNSPQMNHFLTPRYSSNSPSPTEVNEVQNFNCSRTIILMLLADNMANTEYFFHGEKDVDKMLLHEQLRLGRVKIRLI 346          
BLAST of Na channel amiloride sensitive vs. Planmine SMEST
Match: SMESG000002761.1 (SMESG000002761.1)

HSP 1 Score: 389.808 bits (1000), Expect = 4.841e-134
Identity = 191/191 (100.00%), Postives = 191/191 (100.00%), Query Frame = 3
Query:   24 MQTSILIMKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSLQWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQV 596
            MQTSILIMKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSLQWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQV
Sbjct:    1 MQTSILIMKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSLQWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQV 191          
BLAST of Na channel amiloride sensitive vs. Planmine SMEST
Match: SMESG000008099.1 (SMESG000008099.1)

HSP 1 Score: 384.415 bits (986), Expect = 2.817e-127
Identity = 210/461 (45.55%), Postives = 286/461 (62.04%), Query Frame = 3
Query:   45 MKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSLQWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPC-LAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQISYEVCPSSCTVAKYNKHNILEQKCEKHMNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSCXXXXXXXXXXXXWRS----------SAYINDSNTLYLSKSLDVSNSPQ 1394
            M  +F  SSLIPLSKI+NAP+KSI+ILW +F   MLIGL++CI  VV QYC  QTIFQLD+SGK  + D  P++++C     + +MF   ++  +   E + +MK +      PW +S +   F  IT  L++I N +    L+W++ +A S  YK++HN TV F I P    + + +   EQVP    F+CTTFEF+       W  + ++V N   ++ +Q+       +++ I HE GSLP+SAYD+HITET+  G+++ +FLSKS+T RLNT RNPC     T +LFG +Y Y HD CGWK CC    K CNC C IDVLR    PC   C +  C  + +Y  CPSSC + KYNKHN   +K  K+ ++L L+KSDNVHIATEE++YT+TKL SEIGGLCSLFIGFSCI++FE+IEA I+W S              ND+ T Y  +  DV  S +
Sbjct:    1 MVKIFSQSSLIPLSKISNAPTKSIKILWTLFFTVMLIGLIICITLVVIQYCHHQTIFQLDFSGKQVAYDAIPAVTLCHNTKNMVSMFRNLLERQVGVLEAKKIMKSSASDGMLPWQHSRIKGIFLNITHNLSIISNNLERGLLKWSSLTAKSPFYKLLHNITVNFKIIPYF--SGYQVTAYEQVPHVRSFLCTTFEFKTQSGYQPWVKLEILV-NSNASLYHQSMN-----EISIITHEAGSLPFSAYDRHITETLNSGNKVQIFLSKSITMRLNTDRNPCNEYTSTINLFGRNYSYSHDVCGWKMCCTNCFKGCNCICPIDVLRQISNPCNETCRQNSCARKGNYTTCPSSCIIIKYNKHNKNIEKINKNSHQLILIKSDNVHIATEEKIYTITKLFSEIGGLCSLFIGFSCIYIFELIEAVILWHSGILTECINVPGGLRNDNITRYSFRGKDVDKSSE 453          
BLAST of Na channel amiloride sensitive vs. Planmine SMEST
Match: SMESG000000681.1 (SMESG000000681.1)

HSP 1 Score: 182.185 bits (461), Expect = 3.071e-51
Identity = 120/407 (29.48%), Postives = 202/407 (49.63%), Query Frame = 3
Query:   69 SLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCIGFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKTVLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSLQWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICTTFE--FENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSLPYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGNDYEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQISYEVCPSSCTVAKYNKHNILEQKCEKH-MNKLNLVKSDNVHIATEEELYTLTKLCSEIGGLCSLFIGFSC 1280
            SLIPL+KI NA S+  RILW IFS+ M++GL+  I   V+QY  Q T+F++DYS     L++ P+I++C  N  +            N++ Y  ++ ++                        T+I N   +S+  W+T +A+S                       FI N+K  +P+    ICT FE   E S+   +W+ + + +E          P     ++V  ++H K S P++ Y+K++ + +  G  +  F +KSV   L+T RNPC      ++ G ++ Y    C W   C+    +CNC+C++DVL      C   C++K   + ++  +CP +C   KY+  N++ +   ++  +++ ++ S+ V +ATEE +YTL K+ SEIGGL SL  G SC
Sbjct:    6 SLIPLTKILNAHSQLSRILWTIFSVAMVVGLIGSIILTVHQYLDQSTVFRMDYSTA-NYLNDLPAITVCHNNHRI------------NKEVYHSVIGES------------------------TIIYNITPHSTANWSTENALSL----------------------FIGNLKTTLPKNQ--ICTIFELYLEKSE---AWNSLKITMEQP-------DPNPTDFFEV--VIHGKESFPFNNYEKYLYKKVDPGKCIYTFTAKSVANHLDTNRNPC-ENIKINVMGRNFSYDQTVCQWMHVCVNLHNYCNCSCELDVLGVIHSRCSDKCLQKFSRALVNTSICPQACHKMKYSDLNVVTRDLSQYNKSEIEIIMSNLVSMATEEPIYTLAKMFSEIGGLSSLLFGVSC 338          
The following BLAST results are available for this feature:
BLAST of Na channel amiloride sensitive vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LY472.554e-8537.69Amiloride-sensitive sodium channel,putative OS=Sch... [more]
A0A4E0RB861.316e-5738.82Na channel amiloride sensitive OS=Fasciola hepatic... [more]
A0A504Y6113.871e-5739.66Na channel amiloride sensitive OS=Fasciola giganti... [more]
A0A068Y4164.839e-5739.79Na channel amiloride sensitive OS=Echinococcus mul... [more]
A0A0R3VSP15.005e-5738.91Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na channel amiloride sensitive vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000002742.10.000e+0100.00SMESG000002742.1[more]
SMESG000002761.14.841e-134100.00SMESG000002761.1[more]
SMESG000008099.12.817e-12745.55SMESG000008099.1[more]
SMESG000000681.13.071e-5129.48SMESG000000681.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021762 ID=SMED30021762|Name=Na channel amiloride sensitive|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
AAAAAGCGGAACTTTAAAATGAAATGCAAACGTCAATTTTAATCATGAAA
AATTTGTTTGGATCCAGTTCATTGATCCCTTTGTCGAAAATCGCTAACGC
TCCTAGCAAATCTATAAGAATTCTTTGGATAATTTTCTCCATTACTATGC
TGATTGGGTTGCTAGTTTGTATTGGTTTCGTCGTCAATCAGTATTGTCTT
CAACAAACTATTTTTCAGTTGGATTATTCTGGCAAGATGACTTCCCTTGA
CAATTGTCCATCGATAAGCATTTGTTTTCTAAACGATGAGGTACAGAACA
TGTTCATGCAAGCCATGAAGACCGTTCTTAATCGACAAGAATATGAAGAT
TTGATGAAAAAGAATAAAGATTCCAGAAAACCACCGTGGCTTTATTCCGG
AGTCCATAGTTTTTTTAGAAAGATCACCGATAGATTAACGGTCATTCAAA
ATAAAATTACAAACTCCTCTCTTCAATGGACCACTCATTCCGCAATTTCC
AAATTATACAAGGTCATGCACAATTTCACTGTGAAATTTTCTATTTCTCC
TAAATCAGAGGAAAACAATTTTATTCTCAACGTAAAGGAACAAGTTCCAC
GAACTTGGGGTTTCATTTGCACTACATTTGAATTCGAAAATTCAGATCCT
GATTATTCTTGGTCTGGCATTAATGTCGTTGTTGAGAATGAACTTGATAC
GGTTATCAATCAAACACCAGAAAAGTTGAAAAGATATCAAGTTAACTTTA
TAGTACATGAAAAGGGCTCTTTACCTTATTCTGCATATGACAAACACATC
ACAGAAACAATAATGGGAGGTAGTGAACTTACTGTTTTTCTTTCAAAATC
AGTGACCAGACGGTTGAATACCAAACGCAATCCATGCCTTGCCAAGGGTA
CTACTTCTTTATTTGGAAATGACTATGAATATGGTCATGATGCTTGCGGG
TGGAAGGAATGTTGTATTAAAACACTAAAGTTTTGCAACTGTACTTGTGA
TATTGATGTTCTCAGACACAGTTTGCGACCCTGTCCAATAGGGTGTGTAA
AGAAAGTATGTCTTTCCCAAATAAGCTATGAAGTTTGTCCTTCGTCTTGT
ACTGTGGCCAAATATAACAAACATAACATCCTAGAACAAAAATGTGAAAA
ACACATGAATAAACTGAATCTAGTCAAGAGTGACAACGTTCATATAGCAA
CTGAAGAAGAACTTTACACCTTGACAAAGCTTTGCAGTGAAATCGGTGGT
CTCTGTTCACTATTCATTGGATTCAGTTGTATTTTTCTGTTTGAAATTAT
TGAAGCTTTTATCATATGGAGATCATCGGCTTATATCAATGATAGCAATA
CCCTTTATCTATCAAAATCCTTAGACGTTTCAAACAGTCCTCAAATGAAT
CATTTTCTCACTCCTCGATATTCAAGTAATAGTCCTTCTCCAACTGAAGT
CAACGAAGTTCAGAATTTTAACTGCAGTCGAACAATCATTCTTATGTTAC
TTGCAGACAATATGGCAAATACTGAATACTTTTTCCATGGAGAAAAAGAT
GTTGATAAAATGCTACTCCACGAACAGCTACGACTCGGTCGAGTAAAAAT
TAGACTTATTTGAACTGAAAATATGTTATTCATGTTTATTATGAGTTTTT
ATTAGCTTTCAAAGCGAATTTATTGTTGTTGAACTATTACTAGATCATTG
AACACCCTATTTTCAATATTGAATGAACTATTTGATGTACTTTGTGATTA
TTTTAATTAATTAATCAATTATTAAGTTATTA
back to top

protein sequence of SMED30021762-orf-1

>SMED30021762-orf-1 ID=SMED30021762-orf-1|Name=SMED30021762-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MQTSILIMKNLFGSSSLIPLSKIANAPSKSIRILWIIFSITMLIGLLVCI
GFVVNQYCLQQTIFQLDYSGKMTSLDNCPSISICFLNDEVQNMFMQAMKT
VLNRQEYEDLMKKNKDSRKPPWLYSGVHSFFRKITDRLTVIQNKITNSSL
QWTTHSAISKLYKVMHNFTVKFSISPKSEENNFILNVKEQVPRTWGFICT
TFEFENSDPDYSWSGINVVVENELDTVINQTPEKLKRYQVNFIVHEKGSL
PYSAYDKHITETIMGGSELTVFLSKSVTRRLNTKRNPCLAKGTTSLFGND
YEYGHDACGWKECCIKTLKFCNCTCDIDVLRHSLRPCPIGCVKKVCLSQI
SYEVCPSSCTVAKYNKHNILEQKCEKHMNKLNLVKSDNVHIATEEELYTL
TKLCSEIGGLCSLFIGFSCIFLFEIIEAFIIWRSSAYINDSNTLYLSKSL
DVSNSPQMNHFLTPRYSSNSPSPTEVNEVQNFNCSRTIILMLLADNMANT
EYFFHGEKDVDKMLLHEQLRLGRVKIRLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 377..434
e-value: 1.3E-6
score: 30.2
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 87..239
e-value: 1.2E-7
score: 33.0
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 62..366
e-value: 1.2E-7
score: 33.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 280..359
e-value: 1.2E-7
score: 33.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 32..61
e-value: 1.2E-7
score: 33.0
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 15..427
e-value: 4.3E-24
score: 85.3
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 31..434