SMED30021753

Overview
NameSMED30021753
Smed IDSMED30021753
Length (bp)1481
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021753 (SMED30021753) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021753 (SMED30021753) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021753 (SMED30021753) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021753 (SMED30021753) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021753

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021753SMESG000043533.1 dd_Smed_v4_12718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021753SMESG000043533.1 dd_Smed_v4_12718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021753SMESG000043533.1 dd_Smed_v4_12718_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021753SMESG000043533.1 dd_Smed_v4_12718_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30021753 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001184:43922..46189 -7293
Homology
BLAST of SMED30021753 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.5286 bits (127), Expect = 6.671e-7
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCI-ESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECP 549
            EC IC   L +A    CG  +CK CI +S  D G++        C  +  + +   +F D+ +   +L+  +KCP + C H+ ++  L+ H   CE ++M+CP
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK--------CPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30021753 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.5286 bits (127), Expect = 6.671e-7
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCI-ESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECP 549
            EC IC   L +A    CG  +CK CI +S  D G++        C  +  + +   +F D+ +   +L+  +KCP + C H+ ++  L+ H   CE ++M+CP
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK--------CPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30021753 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 59.6918 bits (143), Expect = 3.132e-9
Identity = 50/219 (22.83%), Postives = 86/219 (39.27%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVC--------EKSMMECPFNEIGCDF-KSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEK-STLDSDLNGIVTENS------------CNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQ 834
            EC IC  +L +  +  CG  +C+ C+ +WM   NQ CP      +  + LS   ++F D+ +   +   +  CP  S       S ++LH  +         E    +CPF +I CDF      N L EHL  ++  H +  ++  +              +G   EN              N +   I     Q     E  T++ +T LE+++  ++
Sbjct:  103 ECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCP------MDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLR 315          
BLAST of SMED30021753 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.204e-6
Identity = 31/103 (30.10%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCI-ESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECP 549
            EC IC   L +A    CG  +CK CI +S  D G++        C  +  + +   +F D+ +   +L+  +KCP + C H+ ++  L+ H   CE ++M+CP
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK--------CPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30021753 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.668e-6
Identity = 31/103 (30.10%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCI-ESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECP 549
            EC IC   L +A    CG  +CK CI +S  D G++        C  +  + +   +F D+ +   +L+  +KCP + C H+ ++  L+ H   CE ++M CP
Sbjct:   70 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK--------CPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCP 164          
BLAST of SMED30021753 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.887e-17
Identity = 48/177 (27.12%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  184 IWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTE 714
            I ++L  +  ++   +    +C +C   L++A    CGC +C +CI  ++  GN +CPG  + C  EE+L+I  N+  D+  + ++    +KCP ++C   C++  ++ H  +C      CPF  +GC+   +    L  HL N    HSK  I  +       S + +D  G+ T+
Sbjct:    6 INRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSEC-KEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDII-------SNMRNDFFGLTTK 174          
BLAST of SMED30021753 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.171e-14
Identity = 44/165 (26.67%), Postives = 89/165 (53.94%), Query Frame = 1
Query:  181 NIWKILGEHKLD-INSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSE 672
            N+ ++L ++ +  ++  ++    C +C + + DA    CGC+YC  CI  ++   + +CPG    C  E+ L++  +VF++     R+    +KCP   CN+  ++ +L  H + C    +ECP   IGC+ + + K+ + +HL ++V  H++  + +  + KSE
Sbjct:    8 NVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTEC-KEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSE 171          
BLAST of SMED30021753 vs. TrEMBL
Match: A0A182MKP3 (Uncharacterized protein OS=Anopheles culicifacies OX=139723 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 9.614e-9
Identity = 43/173 (24.86%), Postives = 77/173 (44.51%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCP--LDSCNHRCKISQLDLHFEVCEKSM----MECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSI 744
            EC IC  +L +  +  CG  +C++CI  W++  N  CP      +  E L I  ++F D+ +   +   +  CP  +  C  +   +++D H   C  +M      CPF  I C F + ++  L  H+ +E + H +  ++    +       D      V E S ND++ S+
Sbjct:   32 ECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP------LDNEPLDIKSDIFPDNCTRREISQIKKPCPNSMRGCVDQFSPTEIDSHLRQCPFAMSRQSQPCPFARIKCKFIATDEAALNAHIASECQQHLQLLLETYTGSSDRYKFWDPPAKNSVPEMSTNDLVRSM 198          
BLAST of SMED30021753 vs. TrEMBL
Match: A0A182W055 (Uncharacterized protein OS=Anopheles minimus OX=112268 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.402e-8
Identity = 43/173 (24.86%), Postives = 76/173 (43.93%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCP--LDSCNHRCKISQLDLHFEVCEKSM----MECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSI 744
            EC IC  +L +  +  CG  +C++CI  W++  N  CP      +  E L I  ++F D+ +   +   +  CP  +  C  +   + +D H   C  +M      CPF  I C F + ++  L  H+ +E + H +  ++    +       D      V E S ND++ S+
Sbjct:   32 ECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP------LDNEPLDIKCDIFPDNCTRREISQIKKPCPNSMRGCVDQLSPTDIDTHLRQCPFAMSRQSQPCPFARIKCKFIATDEAALSAHIASECQQHLQLLLETYTGSSDRYKFWDPPAKNSVPEMSTNDLVRSM 198          
BLAST of SMED30021753 vs. TrEMBL
Match: A0A182PKL6 (Uncharacterized protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.930e-8
Identity = 41/173 (23.70%), Postives = 78/173 (45.09%), Query Frame = 1
Query:  244 ECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCP--LDSCNHRCKISQLDLHFEVCEKSM----MECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSI 744
            EC IC  +L +  +  CG  +C++CI  W++  N  CP      +  E L I  ++F D+ +   +   +  CP  +  C  +   +++D H   C  +M      CPF  + C F + +++ L  H+ +E + H +  ++    +       D      V E S N+++ S+
Sbjct:   32 ECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP------LDNEPLDIKCDIFPDNCTRREISQIKKPCPNSMRGCVDQLSPTEIDTHLRQCPFAMSRQSQPCPFARVQCKFVAPDEDALNAHIASECQQHLQLLLETYTGSNDRYKFWDPPAKNSVPEMSTNELVRSM 198          
BLAST of SMED30021753 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 51.6026 bits (122), Expect = 5.081e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  247 CTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGR-VNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFK 576
            C IC   + +  +  CG +YCK CIE W       C G+ V +C  +        +F D  +D  +L+ E+KC  + C  + ++ Q   H ++C    ++C     GC+ K
Sbjct:   30 CAICHMVVNEPVLTSCGHSYCKYCIEKW-------CNGKEVVTCPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILE--GCNVK 131          
BLAST of SMED30021753 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 49.6766 bits (117), Expect = 5.403e-6
Identity = 34/133 (25.56%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  181 NIWKILGEHKLDINSQISGFS-----------ECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMEC 546
            N    +G   L   + + G+            EC IC   L +A    CG  +CK CIE  +    Q CP   N  +SE+ L      F D+ +   +L+  ++CP   C  + ++  L+ H   C+ + + C
Sbjct:   45 NPTASMGSSSLQAAAPLQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVD-NEMLSEDQL------FPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of SMED30021753 vs. Planmine SMEST
Match: SMESG000043533.1 (SMESG000043533.1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 421/425 (99.06%), Postives = 423/425 (99.53%), Query Frame = 1
Query:  166 MKNWTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWNSEISNLWTNNMIQEKEISKLKTLXXXXXXXXXXXXXXTCHKLAEMLENNSYWQFSIHWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIGKTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEFNETLNRQIFHFAKSFKHFYQNFKIPNSVLINCTIELVK 1440
            MKNWTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYL DNKS+KSTLDSDLNGIVTENSCNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWN+EISNLWTNNMIQEKEISKLKTLSNSISEQNSSSEIITC KLAEMLENNSYWQFSIHWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIGKTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEFNETLNRQIFHFAKSFKHFYQNFKIPNSVLINCTIELVK
Sbjct:    1 MKNWTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLTDNKSKKSTLDSDLNGIVTENSCNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWNNEISNLWTNNMIQEKEISKLKTLSNSISEQNSSSEIITCPKLAEMLENNSYWQFSIHWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIGKTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEFNETLNRQIFHFAKSFKHFYQNFKIPNSVLINCTIELVK 425          
BLAST of SMED30021753 vs. Planmine SMEST
Match: SMESG000009561.1 (SMESG000009561.1)

HSP 1 Score: 142.51 bits (358), Expect = 3.060e-37
Identity = 123/451 (27.27%), Postives = 213/451 (47.23%), Query Frame = 1
Query:  166 MKNWTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKY---WIKYLKDNK--SEKSTLDSDLNGIVTENSCNDMIYSIELKFNQL-----TFKKEDHTKKDQTD---LEDLRNHIQGLETKYRDL----ENVVEKIWENWNSEISNLWTNNMIQEKE--------ISKLKTLXXXXXXXXXXXXXXTCHKLAEMLENNSYWQFSIHWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIG--KTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEF-NETLNRQIFHFAKSFKHFYQN-FKIPNSVLINCTIE 1431
            M+    +W IL ++  +I+ ++  + +C+IC   L +AY G C CNYCK CIE ++    + CPG    C  +E +S+  ++ KD G+D R+   +++CP +SC  + K+  +D H   C KS +ECPF E+GC         + +HL + +  HSK    WI  LK+     E S +   L  ++ +N    +I  ++ K +Q+       + E   +K Q +    E L++ I+ LE  Y       +N +EK        + N    N+   KE        ISK  ++     +         C   +EM  + S+    I   TK    ++S  F+S D++ Q+ L ++P G  ++ +    +   F I   K  +PS  + FK  I + ++NK        ++ +C+F ++ LN +IFHF  S     Q      ++V+I C++E
Sbjct:    1 MEKLVKMWTILDKYPFEIDPKVLIYVKCSICNGLLRNAYQGPCCCNYCKTCIEIYLGDDRKHCPGDSIEC-RQEQISMRNHIIKDRGADYRVSQLDVRCPWNSCRFQGKLLNMDDHLRTCNKSPIECPFTELGCQTILTENINIKDHLLDNICQHSKLISNWITILKNETLNCEGSAI-KQLRNVLKQN----VIVLVDRKISQVRCNLRNAEIEPLLEKIQIESIKREKLKDEIRNLEKDYGQKILFHKNELEKQRILIRKLMKNKHHKNLALSKESGNHDRKCISKFNSIQQHGRDD-------LCGVKSEMAASLSWIVTEISRKTKYKINLKSENFHSNDRQFQMNLLLYPGG--YERYTGTHLSIAFYIRPWKAVNPSKLFPFKCNILMRISNKFQTNSQLDISNNCQFKSQNLNSEIFHF--SLDELEQTAVTYSDTVVIECSVE 434          
BLAST of SMED30021753 vs. Planmine SMEST
Match: SMESG000009561.1 (SMESG000009561.1)

HSP 1 Score: 140.584 bits (353), Expect = 1.238e-36
Identity = 122/445 (27.42%), Postives = 211/445 (47.42%), Query Frame = 1
Query:  184 IWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKY---WIKYLKDN--KSEKSTLDSDLNGIVTENSCNDMIYSIELKFNQL-----TFKKEDHTKKDQTD---LEDLRNHIQGLETKYRDL----ENVVEKIWENWNSEISNLWTNNMIQEKE--------ISKLKTLXXXXXXXXXXXXXXTCHKLAEMLENNSYWQFSIHWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIG--KTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEF-NETLNRQIFHFAKSFKHFYQN-FKIPNSVLINCTIE 1431
            +W IL ++  +I+ ++  + +C+IC   L +AY G C CNYCK CIE ++    + CPG    C  +E +S+  ++ KD G+D R+   +++CP +SC  + K+  +D H   C KS +ECPF E+GC         + +HL + +  HSK    WI  LK+     E S +   L  ++ +N    +I  ++ K +Q+       + E   +K Q +    E L++ I+ LE  Y       +N +EK        + N    N+   KE        ISK  ++     +         C   +EM  + S+    I   TK    ++S  F+S D++ Q+ L ++P G  ++ +    +   F I   K  +PS  + FK  I + ++NK        ++ +C+F ++ LN +IFHF  S     Q      ++V+I C++E
Sbjct:    1 MWTILDKYPFEIDPKVLIYVKCSICNGLLRNAYQGPCCCNYCKTCIEIYLGDDRKHCPGDSIEC-RQEQISMRNHIIKDRGADYRVSQLDVRCPWNSCRFQGKLLNMDDHLRTCNKSPIECPFTELGCQTILTENINIKDHLLDNICQHSKLISNWITILKNETLNCEGSAI-KQLRNVLKQN----VIVLVDRKISQVRCNLRNAEIEPLLEKIQIESIKREKLKDEIRNLEKDYGQKILFHKNELEKQRILIRKLMKNKHHKNLALSKESGNHDRKCISKFNSIQQHGRDD-------LCGVKSEMAASLSWIVTEISRKTKYKINLKSENFHSNDRQFQMNLLLYPGG--YERYTGTHLSIAFYIRPWKAVNPSKLFPFKCNILMRISNKFQTNSQLDISNNCQFKSQNLNSEIFHF--SLDELEQTAVTYSDTVVIECSVE 428          
BLAST of SMED30021753 vs. Planmine SMEST
Match: SMESG000020851.1 (SMESG000020851.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.352e-33
Identity = 78/261 (29.89%), Postives = 140/261 (53.64%), Query Frame = 1
Query:  175 WTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWNSEISNLWTNNMIQEKEISKL 957
            + ++WK+LG++  DI+ Q+    +C IC + L+DA  GLC C+YC++CI  ++   N+ CPG    C  E+ LS+   +  D  ++ R+    + CP D C +R K+  +  HF VC+K  + CPFNE+GC    I  + +  HL NE+  HS+  I ++++ K+E +TL         +N    +  +IE K  +  F  E+  ++++    DL++ +  +     +LE  +  I  N   ++S L+ +     +EI++L
Sbjct:    7 FEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLS-RNRKCPGNKPDCQIEQ-LSLEE-IIDDSAANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEE-AFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQL 263          
BLAST of SMED30021753 vs. Planmine SMEST
Match: SMESG000020851.1 (SMESG000020851.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.563e-33
Identity = 78/261 (29.89%), Postives = 140/261 (53.64%), Query Frame = 1
Query:  175 WTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKRCIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCPLDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHNEVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSIELKFNQLTFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWNSEISNLWTNNMIQEKEISKL 957
            + ++WK+LG++  DI+ Q+    +C IC + L+DA  GLC C+YC++CI  ++   N+ CPG    C  E+ LS+   +  D  ++ R+    + CP D C +R K+  +  HF VC+K  + CPFNE+GC    I  + +  HL NE+  HS+  I ++++ K+E +TL         +N    +  +IE K  +  F  E+  ++++    DL++ +  +     +LE  +  I  N   ++S L+ +     +EI++L
Sbjct:    5 FEDMWKMLGKYNFDIDPQLQINLKCLICKRLLVDACCGLCYCSYCRKCITPYLS-RNRKCPGNKPDCQIEQ-LSLEE-IIDDSAANARISEIIVSCPADGCIYRDKLLTIYNHFRVCDKKSIPCPFNEMGCMKSDIKNDEISVHLRNEIYDHSQLLIDWIRNMKNEMTTLIVLKQQETAQNELKKLEKTIEDKIEE-AFNYEEEQQRNEELFRDLKDQLNIITNNTGELERKIMSIKSNNERDLSFLFESRKKLGEEINQL 261          
The following BLAST results are available for this feature:
BLAST of SMED30021753 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF66.671e-730.10TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF66.671e-730.10TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30021753 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf63.132e-922.83gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of SMED30021753 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9Y4K3|TRAF6_HUMAN3.204e-630.10TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|Q3ZCC3|TRAF6_BOVIN3.668e-630.10TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
back to top
BLAST of SMED30021753 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID82.887e-1727.12TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1015.171e-1426.67TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A182MKP39.614e-924.86Uncharacterized protein OS=Anopheles culicifacies ... [more]
A0A182W0551.402e-824.86Uncharacterized protein OS=Anopheles minimus OX=11... [more]
A0A182PKL63.930e-823.70Uncharacterized protein OS=Anopheles epiroticus OX... [more]
back to top
BLAST of SMED30021753 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021753 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO483945.081e-727.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021753 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf65.403e-625.56TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30021753 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043533.10.000e+099.06SMESG000043533.1[more]
SMESG000009561.13.060e-3727.27SMESG000009561.1[more]
SMESG000009561.11.238e-3627.42SMESG000009561.1[more]
SMESG000020851.11.352e-3329.89SMESG000020851.1[more]
SMESG000020851.11.563e-3329.89SMESG000020851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021753 ID=SMED30021753|Name=SMED30021753|organism=Schmidtea mediterranea sexual|type=transcript|length=1481bp
AATTTTTGTGCATTGACAATTGTAGACATTCATAGAATGAGAGCTTGTAT
TATTGATCAATAGTGTCAATGCCAAACTGCACTTATTCTAAGAATTTAAG
CAGTGCATATTGAAATAACTGCTTATAACTAAGTAAAACTATTTCATCAA
TTTCTCGGAAGATAAATGAAAAACTGGACAAATATTTGGAAAATTTTAGG
GGAACACAAATTGGATATAAATTCCCAAATTTCCGGTTTCTCTGAGTGCA
CAATTTGTGGACAATTTTTGATCGATGCCTACATTGGACTATGCGGATGT
AATTATTGCAAACGGTGCATCGAGTCTTGGATGGATCTTGGAAATCAGTT
CTGTCCCGGGCGGGTGAACTCTTGCATATCAGAGGAATCTTTGTCAATAA
ATAGAAATGTATTCAAAGATCACGGATCCGATATTCGATTGTTAGCATTT
GAAATCAAATGCCCTCTTGACTCATGCAACCACCGATGCAAGATCAGCCA
ACTTGACCTGCATTTTGAGGTCTGTGAAAAATCAATGATGGAATGTCCAT
TCAATGAAATTGGGTGCGATTTTAAATCAATCAATAAAAATGTGCTCATC
GAACATTTGCACAATGAAGTCGAATTTCACAGTAAATATTGGATCAAATA
TTTGAAAGACAATAAATCAGAAAAATCTACACTCGATTCAGATTTGAACG
GGATTGTAACAGAGAATTCTTGTAATGATATGATCTACTCTATCGAACTG
AAATTCAATCAACTAACCTTCAAAAAAGAAGACCACACAAAGAAGGATCA
AACTGATTTAGAAGACCTTAGAAATCATATTCAAGGATTGGAAACCAAAT
ATAGAGACCTGGAAAATGTGGTTGAGAAAATCTGGGAGAATTGGAATAGT
GAAATTAGTAATTTGTGGACTAATAACATGATTCAGGAAAAGGAAATTTC
AAAATTGAAGACCTTATCAAATTCTATTTCAGAGCAAAACTCGAGCTCCG
AAATCATTACTTGTCATAAACTTGCAGAGATGTTGGAAAATAATTCATAC
TGGCAATTTTCTATCCATTGGAACACAAAAGAGATGTTTCCAATTCGAAG
TCCTCCGTTCTATTCAGCAGATAAAAAACACCAAATAGTACTTTTTATAT
TTCCTTGTGGCTGCTTTTTTGATTGCTTCCAAAAAAATGGAGTTTGCTTT
CAATTTGTAATTGGAAAAACTCCTTCTCCTTCCATAAAATGGGAATTTAA
AGGAATTATTAAAATTACATTAACAAATAAAGATCTCCCAGCTGAATCTT
TCATTGTTACAAGGAGCTGTGAATTTAACGAAACCCTTAATAGACAGATA
TTTCATTTCGCTAAATCTTTCAAACACTTTTATCAAAATTTTAAGATTCC
TAACTCGGTTTTGATTAATTGCACTATCGAATTGGTAAAATAAACATATA
ATTGTTTACTTATCCATTAATAAAGATCAAC
back to top

protein sequence of SMED30021753-orf-1

>SMED30021753-orf-1 ID=SMED30021753-orf-1|Name=SMED30021753-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MKNWTNIWKILGEHKLDINSQISGFSECTICGQFLIDAYIGLCGCNYCKR
CIESWMDLGNQFCPGRVNSCISEESLSINRNVFKDHGSDIRLLAFEIKCP
LDSCNHRCKISQLDLHFEVCEKSMMECPFNEIGCDFKSINKNVLIEHLHN
EVEFHSKYWIKYLKDNKSEKSTLDSDLNGIVTENSCNDMIYSIELKFNQL
TFKKEDHTKKDQTDLEDLRNHIQGLETKYRDLENVVEKIWENWNSEISNL
WTNNMIQEKEISKLKTLSNSISEQNSSSEIITCHKLAEMLENNSYWQFSI
HWNTKEMFPIRSPPFYSADKKHQIVLFIFPCGCFFDCFQKNGVCFQFVIG
KTPSPSIKWEFKGIIKITLTNKDLPAESFIVTRSCEFNETLNRQIFHFAK
SFKHFYQNFKIPNSVLINCTIELVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR015155PFU
IPR019774Aromatic-AA_hydroxylase_C
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 215..235
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 27..116
coord: 111..375
NoneNo IPR availableCDDcd16449RING-HCcoord: 28..64
e-value: 1.16517E-5
score: 40.1433
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 22..64
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..132
e-value: 8.0E-12
score: 47.2
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 27..116
coord: 111..375
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 28..64
score: 8.831
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 97..201