GCR128

Overview
NameGCR128
Smed IDSMED30021751
Length (bp)2257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR128 (SMED30021751) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR128 (SMED30021751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR128 (SMED30021751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR128 (SMED30021751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30021751SMESG000050119.1 GCR128smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR128 vs. TrEMBL
Match: A0A193KUN9 (GCR128 OS=Schmidtea mediterranea OX=79327 GN=gcr128 PE=2 SV=1)

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 450/450 (100.00%), Postives = 450/450 (100.00%), Query Frame = 1
Query:  793 MDLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFIVLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQRKTLLFXXXXDE 2142
            MDLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFIVLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQRKTLLFRRRRDE
Sbjct:    1 MDLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFIVLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQRKTLLFRRRRDE 450          
BLAST of GCR128 vs. TrEMBL
Match: A0A193KUF3 (GCR139 OS=Schmidtea mediterranea OX=79327 GN=gcr139 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 3.179e-67
Identity = 149/425 (35.06%), Postives = 231/425 (54.35%), Query Frame = 1
Query:  796 DLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMED-LKMHNLVLYERIRNFDG 2049
            D  N S+ E+    +++FY+ EMY +CA+ +L         YC+NFI IGG  AL++IP VW G  GN+ L  A    I+     EI+ V F++V+T+ L++  +L +F SKG+PWLGF G Y+ Y S L CK   F  +FL+  S+N+L  E+  R +++K +G    + + VI+ + V +  SF+Q +P+  +++L   DGRYDC +D  +P  I+QW  IH  L+C+GL Q + I F N  +      L  TI  I     E  + S  L +I   L     D    ++H+T+ A +  +K+  S +I+   +  Y DNTTV GV+  Y   ++  I   L++L  S H WLY+F    FR  I+  I      +  +  V+D FM     MG++  +  K ++ L+  + VLYERIR  +G
Sbjct:    4 DYFNRSIYEN--RSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEG 426          
BLAST of GCR128 vs. TrEMBL
Match: A0A193KUU2 (GCR137 OS=Schmidtea mediterranea OX=79327 GN=gcr137 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.337e-41
Identity = 115/357 (32.21%), Postives = 184/357 (51.54%), Query Frame = 1
Query: 1069 FAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMEDLKMHNL--VLYERIRNFDGK-KPMRRRGTTHSKSTANEQRK 2112
            + ++ ++ L+F  +  +FLSKG+PWLGFTG+Y+ Y S LSCKL  F   FL+   +N+LL E   R + L   G       F+I+ +   +  SF    P+ ++++L   DGRYDC  D ++P+  ++W  IH  +FC+GL Q+LII  LN F  +       TI +IQ+   E  + S  L ++   L  +  D+   ++H+T    +  +++I S  +    F  + DNTTV+G +  Y    +    + L  LF S + WLYFF    FR  I+  I   + +++ +  + D FM     M +S +   K +D  + NL  VL+ER+   +G  K    +    S S ANE  K
Sbjct:    3 YVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQD-HLGNLDSVLFERVHQLEGALKYNSNQLLLKSHSQANESNK 358          
BLAST of GCR128 vs. TrEMBL
Match: A0A3P7P5P6 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9227 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.202e-25
Identity = 106/405 (26.17%), Postives = 179/405 (44.20%), Query Frame = 1
Query:  940 IGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFIVLFD-FLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLI-----------KTKIMMF---NPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQR 2109
            +GG  AL+++P V  G+LG L L  AF+  +       IF     +     LI+  + + FL+KG+ WLG+  +++ Y  T +CK   F   F+ +   N+L  ++ +R + +K K    +        +   +I  F+ + P  +I ++WLIDGRY C  D  +    V WT +H  LF NG  Q L + FL          L +TI  + TA       ++ + ++   L  +  DA+  ++     A ++ ++ +    + +E +S +EDN   +GV+  Y +  L  +   L  +  +YHFWL+FF    FR  I           + K+  F   NP+ E      D           A    L+  N VLY+R+   D      +R  +      +E R
Sbjct:    4 VGGVGALLALPTVVFGVLGELALLAAFSNKLVRSARQHIFSAYQCVFGIAFLIYFGINNLFLTKGLLWLGYEPIFLEYSHTYACKTSRFLKCFISATVSNILYADAINRAMAIKAKCYQPVTTTKCFVLLCCCVIGGFVAAVPNFIISNIWLIDGRYICGKDPAWSQSTVLWTTVHETLFANGCAQALSVLFLIMAMSRDVGKLDNTIDYLHTAHKLPGTLTETVFQVTFLLREARRDAWVCIIFNMSLAILMFVRGVIRGFLDWEIYSKFEDNGRTDGVLSFYMIIALEDLVIYLMMIVFAYHFWLFFFYVPAFRTWIFGETKDTVGGLRRKLEPFLPINPDEEYYQENWD-----------AGTFYLQNGNPVLYQRMVQLDKIINEAQREVSRPTGGTDELR 397          
BLAST of GCR128 vs. TrEMBL
Match: A0A183SL57 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS4955 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.029e-23
Identity = 113/414 (27.29%), Postives = 178/414 (43.00%), Query Frame = 1
Query:  940 IGGCFALMSIPIVWCGILGNLTLGLAFA-KYIKGIGNH--EIFVVAFAIVETLALIFIVLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILD---EICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQL-----------IKTKIMMF---NPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQRKTLL 2121
            +GG  AL+ +P V  GI+G LTL  AF  K I+    H    F  AF I     L F + +   +KG+ WLG+  V++ +  T +CK   F   F+ +   N+L  ++ +R + +K K             +   +I  F+ + P  +I +LW IDGR  CE D  +   ++ W   H  +F NG  Q L + FL          L +TI  + TA   +RL   I +   ++   L  S  DA+  +V     A ++  +A     + YE +  YEDN   +GV+  Y    L  +   L  +  +YHFWL+F+    FR             I+ K+  F   NP+ E      D                L+  N VLYER+   D      +R  + ++   ++ R + L
Sbjct:    3 VGGVAALLVLPTVVFGIIGELTLITAFCNKLIRSARQHAFSAFQSAFGI--AFLLYFGIYYLLFTKGLSWLGYEPVFLEHSHTFACKASRFICCFISATVSNILYADASNRAMAIKAKCYQPATTTKGFVVLSCCVIGGFVAAMPEFIICNLWRIDGRLICEKDPAWAPSVIHWLIFHETVFINGFGQALAVIFLIMAMSRDVGKLDNTIDYLHTA---HRLPGTITETVFQVTFLLRESRRDAWVCIVFNMSLAILMFARATIRSCLNYEIYYNYEDNGRTDGVLKFYMFNALEDLVIFLMMIVFAYHFWLFFYYIPAFRTWIFGETKDTVGGIRRKLEPFLPLNPDGEDYQENWDSGTF-----------YLQNGNPVLYERLVELDNIINEAQREMSRARRGKDDLRISQL 400          
BLAST of GCR128 vs. Planmine SMEST
Match: SMESG000050119.1 (SMESG000050119.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 300/303 (99.01%), Postives = 301/303 (99.34%), Query Frame = 1
Query: 1141 LGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDG 2049
            +G  GVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDG
Sbjct:    2 VGIYGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKMEDLKMHNLVLYERIRNFDG 304          
BLAST of GCR128 vs. Planmine SMEST
Match: SMESG000046223.1 (SMESG000046223.1)

HSP 1 Score: 238.81 bits (608), Expect = 9.804e-71
Identity = 149/425 (35.06%), Postives = 231/425 (54.35%), Query Frame = 1
Query:  796 DLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMED-LKMHNLVLYERIRNFDG 2049
            D  N S+ E+    +++FY+ EMY +CA+ +L         YC+NFI IGG  AL++IP VW G  GN+ L  A    I+     EI+ V F++V+T+ L++  +L +F SKG+PWLGF G Y+ Y S L CK   F  +FL+  S+N+L  E+  R +++K +G    + + VI+ + V +  SF+Q +P+  +++L   DGRYDC +D  +P  I+QW  IH  L+C+GL Q + I F N  +      L  TI  I     E  + S  L +I   L     D    ++H+T+ A +  +K+  S +I+   +  Y DNTTV GV+  Y   ++  I   L++L  S H WLY+F    FR  I+  I      +  +  V+D FM     MG++  +  K ++ L+  + VLYERIR  +G
Sbjct:    4 DYFNRSIYEN--RSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEG 426          
BLAST of GCR128 vs. Planmine SMEST
Match: SMESG000046233.1 (SMESG000046233.1)

HSP 1 Score: 228.024 bits (580), Expect = 5.462e-67
Identity = 142/403 (35.24%), Postives = 218/403 (54.09%), Query Frame = 1
Query:  862 MYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMED-LKMHNLVLYERIRNFDG 2049
            MY +CA+ +L         YC+NFI IGG  AL++IP VW G  GN+ L  A    I+     EI+ V F++V+T+ L++  +L +F SKG+PWLGF G Y+ Y S L CK   F  +FL+  S+N+L  E+  R +++K +G    + + VI+ + V +  SF+Q +P+  +++L   DGRYDC +D  +P  I+QW  IH  L+C+GL Q + I F N  +      L  TI  I     E  + S  L +I   L     D    ++H+T+ A +  +K+  S +I+   +  Y DNTTV GV+  Y   ++  I   L++L  S H WLY+F    FR  I+  I      +  +  V+D FM     MG++  +  K ++ L+  + VLYERIR  +G
Sbjct:    1 MYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEG 403          
BLAST of GCR128 vs. Planmine SMEST
Match: SMESG000046224.1 (SMESG000046224.1)

HSP 1 Score: 199.519 bits (506), Expect = 2.949e-56
Identity = 139/435 (31.95%), Postives = 221/435 (50.80%), Query Frame = 1
Query:  844 YFYNSEMYLECAD---WALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMEDLKMHNL--VLYERIRNFDGK-KPMRRRGTTHSKSTANEQRK 2112
            YF+NS+MY ECA+   + L      A   C+  I  GG   L++IP     I  N+ +G  F   ++     EI+ + + ++ ++ L+F  +  +FLSKG+PWLGFTG+Y+ Y S LSCKL  F   FL+   +N+LL E   R + L   G       F+I+ +   +  SF    P+ ++++L   DGRYDC  D ++P+  ++W  IH  +FC+GL Q+LII  LN F  +       TI +IQ+   E  + S  L ++   L  +  D+   ++H+T    +  +++I S  +    F  + DNTTV+G +  Y    +    + L  LF S + WLYFF    FR  I+  I   + +++ +  + D FM     M +S +   K +D  + NL  VL+ER+   +G  K    +    S S ANE  K
Sbjct:   18 YFFNSDMYTECAEKDLYMLYVGKGKANFNCDYLISFGGVTGLLTIPTALIAIFLNIIIGFGFLFSLRLSAKQEIYGMFYVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQD-HLGNLDSVLFERVHQLEGALKYNSNQLLLKSHSQANESNK 451          
BLAST of GCR128 vs. Planmine SMEST
Match: SMESG000046231.1 (SMESG000046231.1)

HSP 1 Score: 199.519 bits (506), Expect = 2.961e-56
Identity = 139/437 (31.81%), Postives = 222/437 (50.80%), Query Frame = 1
Query:  838 IQYFYNSEMYLECAD---WALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREXXXXXXXXXXXXXXXQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMEDLKMHNL--VLYERIRNFDGK-KPMRRRGTTHSKSTANEQRK 2112
            + YF+NS+MY ECA+   + L      A   C+  I  GG   L++IP     I  N+ +G  F   ++     EI+ + + ++ ++ L+F  +  +FLSKG+PWLGFTG+Y+ Y S LSCKL  F   FL+   +N+LL E   R + L   G       F+I+ +   +  SF    P+ ++++L   DGRYDC  D ++P+  ++W  IH  +FC+GL Q+LII  LN F  +       TI +IQ+   E  + S  L ++   L  +  D+   ++H+T    +  +++I S  +    F  + DNTTV+G +  Y    +    + L  LF S + WLYFF    FR  I+  I   + +++ +  + D FM     M +S +   K +D  + NL  VL+ER+   +G  K    +    S S ANE  K
Sbjct:   16 VLYFFNSDMYTECAEKDLYMLYVGKGKANFNCDYLISFGGVTGLLTIPTALIAIFLNIIIGFGFLFSLRLSAKQEIYGMFYVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQD-HLGNLDSVLFERVHQLEGALKYNSNQLLLKSHSQANESNK 451          
The following BLAST results are available for this feature:
BLAST of GCR128 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUN90.000e+0100.00GCR128 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A193KUF33.179e-6735.06GCR139 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUU23.337e-4132.21GCR137 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A3P7P5P61.202e-2526.17Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A183SL571.029e-2327.29Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of GCR128 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR128 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050119.10.000e+099.01SMESG000050119.1[more]
SMESG000046223.19.804e-7135.06SMESG000046223.1[more]
SMESG000046233.15.462e-6735.24SMESG000046233.1[more]
SMESG000046224.12.949e-5631.95SMESG000046224.1[more]
SMESG000046231.12.961e-5631.81SMESG000046231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021751 ID=SMED30021751|Name=GCR128|organism=Schmidtea mediterranea sexual|type=transcript|length=2257bp
AAAAAATCTAAACTACCATGTTAAATCGATTTGGAAATTAATAAATCATT
ATATTTTATTTTTAAGAATTCTATTATGAGTAATATTATGAATAAACAAC
CAGAATATTTACATCTTTTTTACAAAAAAGAAAGCACTCATACGCGGAGA
TGAAATTCATAGGTACTAAATGAATAACTGCAAAGCTATCCTTGCATTCA
ACAAATCAAAACATTTTTAAATTACTTCCGTGATTGTTGAAATTCAAATT
ACATCCATCTGCTTCATGCCAAAGCTGTGGACGAACATTGAGGAAATGTT
TGACAAACTGAAGCTAAATTTTTTTCACAAGATTTATATAATAAAAAAAA
TCAGCTGAAAAAAATTGTTCAAGAGTTAAAGCGATAATAGGAAGAATAAA
TTAAAGGTGTATAACAGAATTGAAAACTTAAAACTATTATATTGATAAGA
ATCTTTTACTATTTGATTTCACAGCTGTTGAGGACTTGCTAACACATCAA
AAATATATATTCGATTGTAGTCTATTGACATTCTTGAGTTCAGTGTAATA
TTTTATATAATTTTATGCCAAAGAACACAAGTGATATTGAAGTAAAAATC
TAAAACGTTTTGAAAATAAATTCCAAAATCTTTTGTGAATGTACAAGATC
CAGTGGTGTAGCTAGAAATTTGGGCCAATAGGCAACAATCATTGATGGAC
CCCAGTCTCTAATTGGTCTACTTTGTTTAACAAAATAACTTGTCTTAAAA
AATAATTTATTCATAATATATAATTTTTGAAGTCACCTGTAGATGGACCT
CACAAATCACTCGGTCTCAGAAGATGATTTCAGCCATATCCAATATTTTT
ACAATTCAGAGATGTATCTAGAATGCGCAGATTGGGCTCTTGAAAAACGA
AACAATACCGCCATTCAGTATTGCAATAATTTTATATTTATTGGCGGCTG
TTTTGCCCTTATGTCGATTCCCATAGTTTGGTGCGGAATATTGGGGAACC
TGACTCTCGGGTTGGCCTTTGCAAAGTATATCAAAGGAATCGGAAATCAT
GAAATCTTTGTTGTCGCATTTGCAATTGTTGAAACACTCGCTTTGATATT
TATTGTATTGTTTGATTTTCTTTCTAAAGGGGTCCCATGGTTGGGATTTA
CGGGAGTTTATGTTTTATACAAGTCAACGCTCTCTTGTAAATTGTTCTCT
TTTGCTGGAATATTCCTTGACTCTTTATCAGTCAACTTGCTGTTGGGTGA
ATCTTTTCATAGATTCCTCATTTTGAAATTCAAAGGTGGCATTGAAATTC
AGAGAGAATTCGTGATTTTTGGAGTATTGGTAATTATTATATTCAGTTTC
ATACAATCTGCTCCATTGACAGTCATTTTTTCCCTTTGGTTAATTGATGG
ACGATATGATTGTGAAATCGACTGTCAGTTTCCATGGCCGATTGTCCAGT
GGACAGGAATACATTTTGGTCTATTTTGTAATGGACTTTTTCAAACATTA
ATCATATTCTTTCTAAACTCATTTTCCTGGTATTATTGGTACGTACTGTA
CCATACTATTCACACAATTCAAACAGCTACAAATGAATACAGATTGTCTT
CTAAAATCCTGGATGAAATTTGCAACTCGTTGACAGTTTCACTTGATGAC
GCTTTCTGTACCTTGGTACATACGACGGTCGGGGCAGCCATTTTAAATAT
AAAGGCAATTTTCAGTTTGAAGATATTCTACGAATTCTTTAGTGTTTACG
AAGACAACACAACAGTCGAAGGAGTCGTATATATGTACTATTTGAGAACA
TTAGGTCAGATTTTTTCTACTCTCTTTTATCTTTTCGAAAGTTACCATTT
TTGGCTTTATTTCTTTTGTAATTCTAATTTTCGGCAATTAATCAAAACAA
AAATTATGATGTTCAATCCAGAAAGTGAAAGGCTTTCAAATGTGATTGAT
CAGTTTATGATGGGAGATTCGGTGAAAAAGACAGCAAAAATGGAGGATCT
AAAAATGCACAATTTGGTACTGTATGAAAGAATACGAAACTTTGACGGTA
AAAAGCCAATGAGGAGACGCGGAACTACCCATTCTAAGAGCACTGCTAAT
GAACAAAGAAAGACTCTGCTATTTAGGCGACGTAGAGATGAATAATAGCT
GTGTTCTAGTTACTATTAAATCATGAATTATTATATAATTTATTATGCTA
CCGCAGGTTCCGGTTATGGAATTGTGTTTATTATTACTTAGTTATATAAT
ACCTTTT
back to top

protein sequence of SMED30021751-orf-1

>SMED30021751-orf-1 ID=SMED30021751-orf-1|Name=SMED30021751-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
MDLTNHSVSEDDFSHIQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFI
GGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLA
LIFIVLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLL
LGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWL
IDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWY
VLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAI
LNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFES
YHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFMMGDSVKKTAKM
EDLKMHNLVLYERIRNFDGKKPMRRRGTTHSKSTANEQRKTLLFRRRRDE
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane