GCR060

Overview
NameGCR060
Smed IDSMED30021741
Length (bp)1304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR060 (SMED30021741) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR060 (SMED30021741) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR060 (SMED30021741) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR060 (SMED30021741) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of GCR060 vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 79.7221 bits (195), Expect = 1.518e-15
Identity = 74/273 (27.11%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 79.7221 bits (195), Expect = 1.518e-15
Identity = 74/273 (27.11%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 79.7221 bits (195), Expect = 1.518e-15
Identity = 74/273 (27.11%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 79.7221 bits (195), Expect = 1.518e-15
Identity = 74/273 (27.11%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Human
Match: EDNRB (endothelin receptor type B [Source:HGNC Symbol;Acc:HGNC:3180])

HSP 1 Score: 79.337 bits (194), Expect = 1.801e-15
Identity = 72/273 (26.37%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  +++   +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSG--MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Celegans
Match: npr-35 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q7YXG8])

HSP 1 Score: 62.003 bits (149), Expect = 3.008e-10
Identity = 37/131 (28.24%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  181 GFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEII 573
            G + N  V + +   K+L    + LI +LA+AD+  L+  + T + N + + ++ G F C+L  +   +T   S++TL  +  DR+ AI   L + +S+   +++   VI ++WLVA +  +P  Y  ++I
Sbjct:   43 GVLGNTFVVLAVWAHKNLNITTDYLILSLALADLFILWICLPTTLINSIFTEWLWGQFFCRLSTWANASTSFASVYTLVAVTADRYLAICHTLKYNTSW--DREYTKYVIFAVWLVAAIFGIPNWYNYDLI 171          
BLAST of GCR060 vs. Ensembl Celegans
Match: tyra-2 (Tyramine receptor tyra-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19084])

HSP 1 Score: 62.003 bits (149), Expect = 3.736e-10
Identity = 47/157 (29.94%), Postives = 82/157 (52.23%), Query Frame = 1
Query:  193 NMAVFVLIVKVKSLKTVPNLLIANLAIADISY-LFGHVLTNI---------PNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITL-PVVYVTEIIQ-PTIPYNKSCLTTTLCIF 627
            N  VF+++ K   L+TVPNLL+ NLA +D++  L    L+++         P+ L   F+    LC             SI+ L+++ +DR+ AI  P+ + S   R+K+   ++I+S+W+ + LI+L P++   +  Q P + Y K+  T   C F
Sbjct:   36 NSLVFIVLYKNPRLQTVPNLLVGNLAFSDLALGLIVLPLSSVYAIAGEWVFPDALCEVFVSADILCST----------ASIWNLSIVGLDRYWAITSPVAYMSK--RNKRTAGIMILSVWISSALISLAPLLGWKQTAQTPNLIYEKNN-TVRQCTF 179          
BLAST of GCR060 vs. Ensembl Celegans
Match: tyra-2 (Tyramine receptor tyra-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19084])

HSP 1 Score: 61.6178 bits (148), Expect = 4.242e-10
Identity = 47/157 (29.94%), Postives = 82/157 (52.23%), Query Frame = 1
Query:  193 NMAVFVLIVKVKSLKTVPNLLIANLAIADISY-LFGHVLTNI---------PNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITL-PVVYVTEIIQ-PTIPYNKSCLTTTLCIF 627
            N  VF+++ K   L+TVPNLL+ NLA +D++  L    L+++         P+ L   F+    LC             SI+ L+++ +DR+ AI  P+ + S   R+K+   ++I+S+W+ + LI+L P++   +  Q P + Y K+  T   C F
Sbjct:   36 NSLVFIVLYKNPRLQTVPNLLVGNLAFSDLALGLIVLPLSSVYAIAGEWVFPDALCEVFVSADILCST----------ASIWNLSIVGLDRYWAITSPVAYMSK--RNKRTAGIMILSVWISSALISLAPLLGWKQTAQTPNLIYEKNN-TVRQCTF 179          
BLAST of GCR060 vs. Ensembl Celegans
Match: ckr-2 (CholecystoKinin Receptor homolog [Source:UniProtKB/TrEMBL;Acc:G4SNP8])

HSP 1 Score: 61.2326 bits (147), Expect = 5.820e-10
Identity = 34/151 (22.52%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  115 YRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTE 567
            +RG+   + Y +     +I +L  + N  V ++I+K ++++++ N+ + NLA +D+      +   + +++++ ++ G ++CK+  + +   +  S +TL V+A +R+ AI  PL   S  W+++     +I  +W++AI   + ++++ E
Sbjct:   12 FRGTT--ENYTIAVTFFMIFLLSVVGNSVVLIVIIKQRAMRSITNIYLMNLAASDMMLSVVCMPPTLVSMVMNCWMFGNYMCKILAYLQPVVVTASAYTLAVIAFERYFAICKPL--HSRIWQTRSHAYAMITLVWVIAIAANILMLFMYE 158          
BLAST of GCR060 vs. Ensembl Celegans
Match: ckr-2 (CholecystoKinin Receptor homolog [Source:UniProtKB/TrEMBL;Acc:G4SNP8])

HSP 1 Score: 61.2326 bits (147), Expect = 5.891e-10
Identity = 34/151 (22.52%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  115 YRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTE 567
            +RG+   + Y +     +I +L  + N  V ++I+K ++++++ N+ + NLA +D+      +   + +++++ ++ G ++CK+  + +   +  S +TL V+A +R+ AI  PL   S  W+++     +I  +W++AI   + ++++ E
Sbjct:   12 FRGTT--ENYTIAVTFFMIFLLSVVGNSVVLIVIIKQRAMRSITNIYLMNLAASDMMLSVVCMPPTLVSMVMNCWMFGNYMCKILAYLQPVVVTASAYTLAVIAFERYFAICKPL--HSRIWQTRSHAYAMITLVWVIAIAANILMLFMYE 158          
BLAST of GCR060 vs. Ensembl Fly
Match: CCHa1-R (gene:FBgn0050106 transcript:FBtr0086893)

HSP 1 Score: 85.8853 bits (211), Expect = 9.738e-18
Identity = 80/254 (31.50%), Postives = 139/254 (54.72%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLST------FIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPL---NHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI-FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLE-TQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLP 864
            + Y+V  L A+I V+G + N  + V+ + V+ ++ VPN  I +LA+AD+      ++T +P  L ST      +  G FLC L  F +  ++G S+FTLT ++ DR+ AIV PL   +      R+ +      +SIWL+AIL  LP +  + +    I  N+  +   +C  + +E  +   ++++ + F +Y+  P ++I + Y+ IAL L  +    G +Q  + R +  R+K++  VLAF++IF IC LP
Sbjct:   80 ETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLV----IITTVP--LASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGI--NEKSI--VICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQ-GAVRQVRARRKVAVTVLAFVVIFGICFLP 322          
BLAST of GCR060 vs. Ensembl Fly
Match: Lkr (gene:FBgn0035610 transcript:FBtr0077149)

HSP 1 Score: 76.6406 bits (187), Expect = 1.166e-14
Identity = 82/270 (30.37%), Postives = 137/270 (50.74%), Query Frame = 1
Query:  148 VVTLIAI----ISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVII-SIWLVAILITLP---VVYVTEIIQPTIPYNKS-CLTTTLCIFRK--ESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSI---NKRKKLSKIVLAFIIIFVICRLPDQL-NTIIIHISQYSHY 912
            +V L++I    IS++  I N  V  ++   + ++TV N+ IANLA AD+      +       LL ++   +F+C    F +  ++  S+FTLT +AIDR  AI+ PL       R  KFVS  II  IW++A+L  +P      V E+ +     N++  +T   C+ +   +  LQ++R   +    + +  PF +I   YI +A++L      G  Q   SR I     +KK+ K+++  +IIF +C LP QL N + + I + + Y
Sbjct:   34 IVALLSIFYGGISIVAVIGNTLVIWVVATTRQMRTVTNMYIANLAFADVIIGLFCIPFQFQAALLQSWNLPWFMCSFCPFVQALSVNVSVFTLTAIAIDRHRAIINPLRA-----RPTKFVSKFIIGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVTRPFCMNKNLSDDQLQSFR---YTLVFVQYLVPFCVISFVYIQMAVRLWGTRAPGNAQ--DSRDITLLKNKKKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPEINDY 293          
BLAST of GCR060 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345268)

HSP 1 Score: 73.559 bits (179), Expect = 8.029e-14
Identity = 70/296 (23.65%), Postives = 138/296 (46.62%), Query Frame = 1
Query:   52 KYHRTQIMVILNLTNCSNPKLYRGSVNFQQY---LVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYF-----LCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQIC-SSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
            ++    I V++N + C +  L    +    Y   +V  L   I +   I N  V  ++     ++TV N  IA+LAI DI   F      +P+  +S FI  Y+     LC    +++  ++  S +TL  ++IDR+ AI+ PL  + +    K++ + +I  +W +A+   LP+  V+ +  P  P++  C    +C     S  Q Y   +   F + F  P  ++   Y  I +++  +   G  +     R    ++K+ K++L  +I+F  C LP  +  ++++  +++H+
Sbjct:   74 QFETYNITVMMNFS-CDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSF----FCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRIT----KRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKC-EKYICREMWPSRTQEYYYTL-SLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHW 358          
BLAST of GCR060 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0085100)

HSP 1 Score: 72.7886 bits (177), Expect = 1.688e-13
Identity = 71/296 (23.99%), Postives = 138/296 (46.62%), Query Frame = 1
Query:   52 KYHRTQIMVILNLTNCSNPKLYRGSVNFQQY---LVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYF-----LCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQIC-SSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
            ++    I V++N + C +  L    +    Y   +V  L   I +   I N  V  ++     ++TV N  IA+LAI DI   F  V    P+  +S FI  Y+     LC    +++  ++  S +TL  ++IDR+ AI+ PL  + +    K++ + +I  +W +A+   LP+  V+ +  P  P++  C    +C     S  Q Y   +   F + F  P  ++   Y  I +++  +   G  +     R    ++K+ K++L  +I+F  C LP  +  ++++  +++H+
Sbjct:   74 QFETYNITVMMNFS-CDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCV----PSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRIT----KRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKC-EKYICREMWPSRTQEYYYTL-SLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHW 358          
BLAST of GCR060 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345267)

HSP 1 Score: 71.633 bits (174), Expect = 4.622e-13
Identity = 70/296 (23.65%), Postives = 138/296 (46.62%), Query Frame = 1
Query:   52 KYHRTQIMVILNLTNCSNPKLYRGSVNFQQY---LVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYF-----LCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQIC-SSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
            ++    I V++N + C +  L    +    Y   +V  L   I +   I N  V  ++     ++TV N  IA+LAI DI   F      +P+  +S FI  Y+     LC    +++  ++  S +TL  ++IDR+ AI+ PL  + +    K++ + +I  +W +A+   LP+  V+ +  P  P++  C    +C     S  Q Y   +   F + F  P  ++   Y  I +++  +   G  +     R    ++K+ K++L  +I+F  C LP  +  ++++  +++H+
Sbjct:   74 QFETYNITVMMNFS-CDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSF----FCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRIT----KRYATFIIAGVWFIALATALPIPIVSGLDIPMSPWHTKC-EKYICREMWPSRTQEYYYTL-SLFALQFVVPLGVLIFTYARITIRVWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHW 358          
BLAST of GCR060 vs. Ensembl Zebrafish
Match: ednrba (endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-980526-16])

HSP 1 Score: 83.1889 bits (204), Expect = 7.549e-17
Identity = 76/271 (28.04%), Postives = 138/271 (50.92%), Query Frame = 1
Query:   97 CSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESV--LQAY-RAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            C++P   R +  +   +V  L+ ++ ++G   N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  LCKL  F +  ++G +I +L  ++IDRF A+       SS+ R K     K+ ++ II IW+++I++ +P     ++I  T+ Y    L   L +  K+ +  +Q Y +A  W  F  YF  P     I Y    +  E       VQI  S  I +R++++K V   +++F +C LP  L+ I+
Sbjct:   72 CTDPTEIRDTFKYINTVVSCLVFVVGIIG---NSTLLRIIYKNKCMRNGPNILIASLALGDLLHIMIDIPINVYKLLAKDWPFGVGLCKLVPFIQKTSVGITILSLCALSIDRFRAV-------SSWNRIKGIGVPKWTAIEIILIWVLSIILAVPEAIAFDMI--TMDYKGEQLRICL-LHPKQRIKFMQFYKKAKDWWLFSFYFCMPLTCTAIFYTL--MTCEMLRKKNGVQIALSDHIKQRREVAKTVFCLVLVFALCWLPLHLSRIL 327          
BLAST of GCR060 vs. Ensembl Zebrafish
Match: grpr (gastrin-releasing peptide receptor [Source:ZFIN;Acc:ZDB-GENE-081015-4])

HSP 1 Score: 81.6481 bits (200), Expect = 1.867e-16
Identity = 69/273 (25.27%), Postives = 125/273 (45.79%), Query Frame = 1
Query:  100 SNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXAL--KLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
             +P L+ G       ++ T+ A++   G I N+ +      VKS++ VPNL +++LA+ D+  L      +    L   ++ G   CKL  F +  ++G S+FTLT +A DR+ AIV P++ QSS  ++   V +   SIW++++++ +P    +++    IP       T         +     ++             I +   +I  +L          G   I   R +  R +L+K VL F+ +F IC LP+     +I++ +  HY
Sbjct:   27 EHPHLHSG------IIIATVYALLITAGLIGNVTLIRTFCIVKSMRNVPNLFMSSLALGDVLLLVTCAPVDASKFLADEWLFGRMGCKLIPFIQLTSVGVSVFTLTALAADRYKAIVKPMDIQSS--KASLKVCLRAASIWMLSMVLAIPEAVFSDLHTFHIPQTNETFKTCAPYPHAGDLHPKIHSMASFLILYIIPLFIISVYYIFIARSLIQSANNMPVEGNTHI--RRQVESRMRLAKTVLVFVGLFAICWLPNH----VIYLYRSYHY 285          
BLAST of GCR060 vs. Ensembl Zebrafish
Match: nmbr (neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-041014-369])

HSP 1 Score: 80.1073 bits (196), Expect = 4.967e-16
Identity = 59/248 (23.79%), Postives = 119/248 (47.98%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSS---YWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            Q ++ ++  +I  +G + N+ +  + +   ++++VPN+ I++LA+ D+  L   V  +        +I G   CK+    +  ++G S+FTLT ++ DR  AIV P++ QSS   +W   K      I+IW+V++L+ +P    ++++   +P   +  T  +       +     +++            I +   +I   L     +  G +   S R    RK+L+KIVL F+ +F +C  P+ +
Sbjct:   32 QCVIPSVYILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFYEEWIFGTVACKMIPVIQLTSVGVSVFTLTALSADRHKAIVNPMDIQSSSAVFWTCLK-----AITIWVVSVLLAIPEAVFSQVVH--MPDKNTTFTACVPYPLSNEMHPKIHSIMIFLVYFLIPLSIISVYYYHIARTLIKSAHDMPGEISEHSKRQTETRKRLAKIVLVFVGLFALCWFPNHV 272          
BLAST of GCR060 vs. Ensembl Zebrafish
Match: nmbr (neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-041014-369])

HSP 1 Score: 80.1073 bits (196), Expect = 7.541e-16
Identity = 59/248 (23.79%), Postives = 119/248 (47.98%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSS---YWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            Q ++ ++  +I  +G + N+ +  + +   ++++VPN+ I++LA+ D+  L   V  +        +I G   CK+    +  ++G S+FTLT ++ DR  AIV P++ QSS   +W   K      I+IW+V++L+ +P    ++++   +P   +  T  +       +     +++            I +   +I   L     +  G +   S R    RK+L+KIVL F+ +F +C  P+ +
Sbjct:   89 QCVIPSVYILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFYEEWIFGTVACKMIPVIQLTSVGVSVFTLTALSADRHKAIVNPMDIQSSSAVFWTCLK-----AITIWVVSVLLAIPEAVFSQVVH--MPDKNTTFTACVPYPLSNEMHPKIHSIMIFLVYFLIPLSIISVYYYHIARTLIKSAHDMPGEISEHSKRQTETRKRLAKIVLVFVGLFALCWFPNHV 329          
BLAST of GCR060 vs. Ensembl Zebrafish
Match: sstr5 (somatostatin receptor 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2502])

HSP 1 Score: 76.6406 bits (187), Expect = 8.190e-15
Identity = 46/140 (32.86%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  166 IISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTI 585
            ++ ++G   N     ++++   +KTV N+ I NLA+AD  Y+ G       N+ LS +  G FLC++ M+    +   S F LTVM+IDR+ A+V P+  +S+ WR      V+   +W ++ L+TLPV+   + +QP +
Sbjct:   43 VVFIVGLTGNSLAIFVVLRYTKMKTVTNMYILNLAVADELYILGLPFLTTHNV-LSYWPFGNFLCRILMWADSISQFTSTFCLTVMSIDRYMAVVHPI--RSARWRRPSVAKVINSMVWALSCLLTLPVIIYCD-VQPGL 178          
BLAST of GCR060 vs. Ensembl Xenopus
Match: gpc2 (glypican 2 [Source:Xenbase;Acc:XB-GENE-6258957])

HSP 1 Score: 83.1889 bits (204), Expect = 6.464e-17
Identity = 87/340 (25.59%), Postives = 153/340 (45.00%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI-------FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHI-----SQYSHYFLLVTAQFLTY----VHPXXXXXXXXXXXXXFRYHLFHLFRSTRYDRSIHSNSYVPKSKMYCIEKKKEK 1107
              +LV    A+I ++G I N  V  +I K + ++T  N  IANLA  DI +L   V        L +++ G F+CK   + +  T+  +  TLT M+ DR  A + PL  +S   R+ K   +V I IW+ ++L++ P++   + IQ    Y       T CI        +K  +L  + AV  +          +++      +   +E  + +  VQ+ S R+I  R K+SK+V+  +++F IC  P QL ++         + Y+ Y +   A  ++Y    ++PL+           F+     +FR+   D SI S +   + K   +E    +
Sbjct:   38 DAWLVPLFFALIMLVGLIGNSLVIYVISKHRQMRTATNFYIANLASTDIMFLVCCVPFTATLYPLPSWVFGDFMCKFVAYLQQVTVQATCITLTAMSADRCYATLYPL--RSLRHRTPKVAMIVSICIWIGSLLLSTPIIPYQK-IQKGYWYGPR----TYCIEQFPSDVMKKVCILYQFLAVYLLPLLTICLCYSLMLKRVGRPV---VEPTDNNYQVQLLSERTIAMRSKISKMVIVIVLLFTICWGPIQLFSLFQGFYPGFQANYATYKIKTWANCMSYANSSINPLVYAFMGASFRKSFKKAFPFMFRNKVRDGSITSGTVNNEMKFVAMESTNNE 367          
BLAST of GCR060 vs. Ensembl Xenopus
Match: dguok (deoxyguanosine kinase [Source:Xenbase;Acc:XB-GENE-1006119])

HSP 1 Score: 82.0333 bits (201), Expect = 2.178e-16
Identity = 63/241 (26.14%), Postives = 112/241 (46.47%), Query Frame = 1
Query:  151 VTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            +T   IISV G + N  +  +  KVKS++TVPN+ I +LA  D+  L   V  +    ++ T++ G   CK+  F +  ++G S+FTLTV++ DR+ AIV PL  Q+S    K         +W++++L+  P    +++ + + P   +           E ++Q   +++            I      I   L   T          + + I  RK+++K VL  + +F  C LP+ +
Sbjct:   51 ITYAVIISV-GLLGNTILIKVFFKVKSMQTVPNIFITSLAFGDLLLLLTCVPVDASRYMVDTWLFGRMGCKILSFIQLTSVGVSVFTLTVLSADRYRAIVKPLELQTSDAVLKTCGKAAC--VWIISMLLAAPEAVFSDLYEFSSPDKNTSFKACAPYPVSEKLMQETHSLMCFLVFYIVPLSIISAYYILIAKTLYKSTFNMPAEEHTHARKQIESRKRVAKTVLVLVALFAFCWLPNHI 288          
BLAST of GCR060 vs. Ensembl Xenopus
Match: SSTR5 (somatostatin receptor 5 [Source:NCBI gene;Acc:100486456])

HSP 1 Score: 80.4925 bits (197), Expect = 5.181e-16
Identity = 53/161 (32.92%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  100 SNPKLYRGSVNFQQYLVVTLI-AIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQP 579
             N  +   SV+     ++ LI  ++ V+G   N  V  ++++   +KTV N+ I NLA+AD+ ++ G       N  +S +  G FLC+L M         SIF LTVM+IDR+ A+V P+  +S+ WR  +   ++  ++W ++ L+TLPV+  +E +QP
Sbjct:   29 DNKTVVDPSVSGMSSFIIPLIYLLVCVIGLSGNTLVIYVVLRYAKMKTVTNIYILNLAVADVLFMLGLPFLATQNA-ISYWPFGTFLCRLVMTVDGVNQFTSIFCLTVMSIDRYLAVVHPI--KSTKWRRPRVAKLISATVWTLSFLVTLPVIIFSE-VQP 185          
BLAST of GCR060 vs. Ensembl Xenopus
Match: kiss1r (KISS1 receptor [Source:NCBI gene;Acc:100316929])

HSP 1 Score: 78.1814 bits (191), Expect = 2.969e-15
Identity = 69/271 (25.46%), Postives = 117/271 (43.17%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQ--------------PTIPYNKSCL-----------TTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
              +LV    A++ ++G   N  V  +I K K ++TV N  IANLA  DI +L   V        L  +I G F+CK   + +  ++  +  TLT M++DR+   V PL  QS   R+ +  + V + IW+ + ++++PV    ++I+              P++ + K+ +             T+CI     V Q  R                            +E  + S  VQ+ + RS   R K+S++V   +++F IC  P QL
Sbjct:   41 DAWLVPLFFAMLMLVGLTGNSLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVPFTAALYPLPGWIFGEFMCKFVNYIQQVSVQATCVTLTAMSVDRWYVTVYPL--QSLRQRTPRVAAAVSVGIWIGSFIVSIPVPIYNQLIEGYWFGPQIYCSESFPSVSHEKAFILYNFLVVYLLPLITICICYSAMVYQMGRP--------------------------SVEPVDNSYQVQLLAERSELMRTKISRMVAVIVLLFTICWGPIQL 283          
BLAST of GCR060 vs. Ensembl Xenopus
Match: wwtr1 (WW domain containing transcription regulator 1 [Source:Xenbase;Acc:XB-GENE-489279])

HSP 1 Score: 77.411 bits (189), Expect = 6.228e-15
Identity = 61/243 (25.10%), Postives = 117/243 (48.15%), Query Frame = 1
Query:  145 LVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            ++ +L  +I ++G + N+ +  + +   ++++VPN+ I++LA  D+  L   V  +        +I G   CKL    +  ++G S+FTLT ++ DR+ AIV P++ Q+S   +  +  +   +IW+++IL+ +P    +E+   +   N S  T  +   + + +     +V+            I I   +I   L        G     S R +  RK+L+KIVL F+  F IC  P+ +
Sbjct:   35 VIPSLYLVIIMVGLLGNITLVKIFITNSAMRSVPNIFISSLAAGDLLLLVACVPVDAFRFFFEEWILGEVCCKLIPAIQLTSVGVSVFTLTALSADRYKAIVNPMDIQTS--SAVLWTCIKASAIWIISILLAVPEAVFSEVAHISESDNVS-FTACIPYPQNDEMHPKIHSVLIFLVYYLIPLTIISIYYYHIARTLIKSAHNIPGEYSEHSKRQMETRKRLAKIVLVFVGCFAICWFPNHV 274          
BLAST of GCR060 vs. Ensembl Mouse
Match: Brs3 (bombesin-like receptor 3 [Source:MGI Symbol;Acc:MGI:1100501])

HSP 1 Score: 78.5666 bits (192), Expect = 2.256e-15
Identity = 67/246 (27.24%), Postives = 112/246 (45.53%), Query Frame = 1
Query:  151 VTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRA-----VIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            +T   IISV G + N  +  +  K KS++TVPN+ I +LA  D+  L   V  +  + L   ++ G   CK+  F R  ++G S+FTLT+++ DR+ A+V PL  Q      K         IW+V+++  LP    + +     P       +       E +LQ   +     V +I         + +I        L + T+E S      + + I  RK+++K VL  + +F +C LP+ L
Sbjct:   52 ITYAGIISV-GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPPNAILKTCAKAG--GIWIVSMIFALPEAIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSH-----ARKQIESRKRIAKTVLVLVALFALCWLPNHL 289          
BLAST of GCR060 vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 77.0258 bits (188), Expect = 9.290e-15
Identity = 69/256 (26.95%), Postives = 136/256 (53.12%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPY-NKSCLTTTLCIFRKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N   +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     ++I  T  Y  K      L  F+K + +Q Y+ A  W  F  YF  P  I  + Y  +  ++  +++   +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:  101 KYINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDMI--TSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAVFYTLMTCEMLRKKSG--MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 77.0258 bits (188), Expect = 9.290e-15
Identity = 69/256 (26.95%), Postives = 136/256 (53.12%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPY-NKSCLTTTLCIFRKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N   +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     ++I  T  Y  K      L  F+K + +Q Y+ A  W  F  YF  P  I  + Y  +  ++  +++   +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:  101 KYINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDMI--TSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAVFYTLMTCEMLRKKSG--MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Mouse
Match: Ednrb (endothelin receptor type B [Source:MGI Symbol;Acc:MGI:102720])

HSP 1 Score: 77.0258 bits (188), Expect = 9.290e-15
Identity = 69/256 (26.95%), Postives = 136/256 (53.12%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPY-NKSCLTTTLCIFRKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N   +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     ++I  T  Y  K      L  F+K + +Q Y+ A  W  F  YF  P  I  + Y  +  ++  +++   +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:  101 KYINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDMI--TSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAVFYTLMTCEMLRKKSG--MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. Ensembl Mouse
Match: Nmbr (neuromedin B receptor [Source:MGI Symbol;Acc:MGI:1100525])

HSP 1 Score: 75.8702 bits (185), Expect = 1.824e-14
Identity = 63/246 (25.61%), Postives = 115/246 (46.75%), Query Frame = 1
Query:  145 LVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSS---YWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            ++ +L  II  +G + N+ +  + +   +++ VPN+ I+NLA  D+  L   V  +        ++ G   CKL    +  ++G S+FTLT ++ DR+ AIV P++ Q+S    W S K V      IW+V++L+ +P    +E+ +     + S  T  +   + + +     +V+            I I   +I   L        G     + + +  RK+L+KIVL F+  FV C  P+ +
Sbjct:   45 VIPSLYLIIISVGLLGNIMLVKIFLTNSAMRNVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIPAIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVLLWTSLKAV-----GIWVVSVLLAVPEAVFSEVAR-IGSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHV 284          
BLAST of GCR060 vs. UniProt/SwissProt
Match: sp|A1ZAX0|CCH1R_DROME (Neuropeptide CCHamide-1 receptor OS=Drosophila melanogaster OX=7227 GN=CCHa1-R PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 9.761e-17
Identity = 80/254 (31.50%), Postives = 139/254 (54.72%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLST------FIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPL---NHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI-FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLE-TQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLP 864
            + Y+V  L A+I V+G + N  + V+ + V+ ++ VPN  I +LA+AD+      ++T +P  L ST      +  G FLC L  F +  ++G S+FTLT ++ DR+ AIV PL   +      R+ +      +SIWL+AIL  LP +  + +    I  N+  +   +C  + +E  +   ++++ + F +Y+  P ++I + Y+ IAL L  +    G +Q  + R +  R+K++  VLAF++IF IC LP
Sbjct:   80 ETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLV----IITTVP--LASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGI--NEKSI--VICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQ-GAVRQVRARRKVAVTVLAFVVIFGICFLP 322          
BLAST of GCR060 vs. UniProt/SwissProt
Match: sp|P47751|BRS4_BOMOR ([Phe13]-bombesin receptor OS=Bombina orientalis OX=8346 GN=BB4 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 3.471e-15
Identity = 65/241 (26.97%), Postives = 112/241 (46.47%), Query Frame = 1
Query:  151 VTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            VT   IISV G + N  +  +  K+KS++TVPN+ I +LA  D+  L   V  +    ++ T++ G   CK+  F +  ++G S+FTLTV++ DR+ AIV PL  Q+S    K     V   +W++++L+  P    +++ +       +           E +LQ   ++I            I      I   L   T          + + I  RK+++K VL  + +F +C LP+ +
Sbjct:   51 VTYAVIISV-GILGNTILIKVFFKIKSMQTVPNIFITSLAFGDLLLLLTCVPVDASRYIVDTWMFGRAGCKIISFIQLTSVGVSVFTLTVLSADRYRAIVKPLQLQTSDAVLKTCGKAVC--VWIISMLLAAPEAVFSDLYEFGSSEKNTTFEACAPYPVSEKILQETHSLICFLVFYIVPLSIISAYYFLIAKTLYKSTFNMPAEEHTHARKQIESRKRVAKTVLVLVALFAVCWLPNHM 288          
BLAST of GCR060 vs. UniProt/SwissProt
Match: sp|Q8K418|BRS3_RAT (Bombesin receptor subtype-3 OS=Rattus norvegicus OX=10116 GN=Brs3 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.133e-15
Identity = 72/271 (26.57%), Postives = 123/271 (45.39%), Query Frame = 1
Query:   88 LTNCSNPKLYRGS----VNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRA-----VIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            ++N + PK + G     +     + +T   IISV G + N  +  +  K KS++TVPN+ I +LA  D+  L   V  +  + L   ++ G   CK+  F R  ++G S+FTLT+++ DR+ A+V PL  Q S    K         IW++A++  LP    + +     P       +       E +LQ   +     V +I         + +I        L + T+E S      + + I  RK+++K VL  + +F +C LP+ L
Sbjct:   27 VSNDTTPKGWTGDNSPGIEALCAIYITYAVIISV-GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCAKAG--GIWIMAMIFALPEAIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSH-----ARKQIESRKRIAKTVLVLVALFALCWLPNHL 289          
BLAST of GCR060 vs. UniProt/SwissProt
Match: sp|O62709|EDNRB_HORSE (Endothelin receptor type B OS=Equus caballus OX=9796 GN=EDNRB PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 5.430e-15
Identity = 72/260 (27.69%), Postives = 139/260 (53.46%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIH 891
            +Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     ++I  T  Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y     ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+ H
Sbjct:  102 KYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINVYKLLAEDWPFGVEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAVGFDMI--TADYKGSYL--RICLLHPTQKTAFMQFYKNAKDWWLFSFYFCLPLAITAFFYTLETCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKH 348          
BLAST of GCR060 vs. UniProt/SwissProt
Match: sp|P24530|EDNRB_HUMAN (Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.292e-15
Identity = 74/273 (27.11%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  103 NPKLYRGSVNFQQ---YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIF---RKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            +P   +G +  ++   Y+   +  ++ VLG I N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  +CKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ +V I+ IW+V++++ +P     +II  T+ Y  S L   +C+    +K + +Q Y+ A  W  F  YF  P  I    Y  +  ++  ++ SG +QI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   86 SPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAV-------ASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDII--TMDYKGSYL--RICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM-LRKKSG-MQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 345          
BLAST of GCR060 vs. TrEMBL
Match: A0A193KU91 (GCR060 OS=Schmidtea mediterranea OX=79327 GN=gcr060 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.301e-36
Identity = 120/335 (35.82%), Postives = 178/335 (53.13%), Query Frame = 1
Query:   73 MVILNLTN--CSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKS-----CLTTTLCIFRKESVLQAYRAVI---WXXXXXXXXXXXXXXXXXXXXXALKLETQ-ETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHLFHLFRSTRYDRS 1044
            MV+ NL++  C+    YR   + + Y++  ++ +I + G + N  + ++I+  K ++T+PN LI NLA+ D  +L  HVL+ +P  +LS F     LCKL  FTR  TLG SIFTL  +AIDR   IV PL  Q S  +S+ F +  ++ IWL + ++  P    + I +  I          CL T +C  R +    +Y+  I   WI F  +F  PF++I  CY  IAL L     T G +   S+  I  RKKL+KIVL  IIIF+ C+LP+Q+    I        F+ +  + LT+V+P LNPLTL +LS  +R          + DR 
Sbjct:    1 MVMFNLSSESCTKWIQYRAGKSVESYVMFFVVLLIFIFGLLGNFVLIIIILANKRMRTLPNFLIVNLAVGDTIFLLAHVLSTLPTYILSKFHADSTLCKLLTFTRNYTLGISIFTLMFLAIDRLRVIVCPLRRQLSPDQSRLFATTGVVGIWLTSTVLATPNAINSYIAKINISIENEGNQTICLFTEVCSSRAD--YHSYQEKIFQFWITFSAFFLIPFVVIGTCYTFIALYLMCHSRTPGNINSISTVQITSRKKLAKIVLGLIIIFLFCKLPEQIQKFWIIFYDVGFQFVQIMCEILTFVYPCLNPLTLCILSLSYRRQFISCIFRCKIDRG 333          
BLAST of GCR060 vs. TrEMBL
Match: A0A193KUA5 (GCR074 OS=Schmidtea mediterranea OX=79327 GN=gcr074 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.820e-30
Identity = 69/180 (38.33%), Postives = 110/180 (61.11%), Query Frame = 1
Query:   82 LNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLC 621
            +N +N +  + Y+  ++ Q YL+    ++I ++G + N+ V  +I     + TVPNLLIANL++ DI ++FGH+  +IP+ LL  F GG FLC+L +F + + LG SIFTLT MA+DRF AI  PL+ Q+    S+  V  V+++IW+ ++  ++P +  TEI    I  N +C     C
Sbjct:    6 MNFSNGTLCEEYKADLSLQNYLLPIFYSVIFLMGLMGNITVIYIIFFKPGMTTVPNLLIANLSLGDIVFIFGHMCFSIPSYLLPGFYGGNFLCRLMVFVKCSCLGISIFTLTFMAVDRFRAITRPLHQQA---LSRVAVITVMVTIWIFSMAASVPTIMYTEIKVHPISNNDTCFILRFC 182          
BLAST of GCR060 vs. TrEMBL
Match: A0A1S3D5Z2 (neuropeptide CCHamide-2 receptor OS=Diaphorina citri OX=121845 GN=LOC103512124 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.585e-18
Identity = 106/349 (30.37%), Postives = 179/349 (51.29%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLC-IFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXA--LKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHI--SQYSHY-----FLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHL-FHLFRSTRYDRSI-HSNSYVPKSKMYCIEKKKEKCTTNSDTILNNEE 1146
            + Y+V  L AII ++G + N  + ++  + K++++VPN  I +LA+ D+  +   V        L ++  G  +CKL   TR  ++G S+FTLT ++ +R+ AIV P+    S+  SK    V   +IW++AI++ LP    + +   T   N    T   C  F  E   Q  + V+  +F  Y+  P  +I   YI +A  L+L T+   G +   SS+S   RKK++K+VL+F+IIF+IC LP  +  +  H     Y +Y     FL +T   L++++  +NP+ L  +S +FR H   +LF      R + H  + VP +   C  +++    T+  TI   E+
Sbjct:   14 ETYIVPVLFAIIFLVGVLGNGTLVLIFARHKNMRSVPNTYILSLALGDLLVIICGVPFTSTLYTLESWPYGPHICKLSEATRDISIGVSVFTLTALSAERYCAIVNPIR---SHISSKPLTIVTAFAIWVLAIILALPSALFSHVQPATTASND---TIYFCSPFPIEYGQQYKQTVVLCKFLAYYLGPLCVIACFYILMARHLELSTRNMPGELLGQSSQS-RARKKVAKMVLSFVIIFIICFLPLHIFEMWYHFYPDSYDNYDNFWHFLRITGFCLSFINSCINPIALYFISGVFRKHFNRYLFCCCTSRRQLQHDVTLVPFNSTSC--RRQHSVLTSHFTISQEEK 353          
BLAST of GCR060 vs. TrEMBL
Match: A0A147BH63 (Putative bombesin receptor subtype-3 OS=Ixodes ricinus OX=34613 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.919e-18
Identity = 94/333 (28.23%), Postives = 176/333 (52.85%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLP-LNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI-FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKL-ETQETSGTVQICSS----RSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHI-----SQYSHYFLL--VTAQFLTYVHPXXXXXXXXXXXXXFRYHLFHLFRSTRYD-----------RSIHSNS 1059
            + Y+V TL A+I ++G + N  + ++ ++ +++++VPN+ I +L+I D   + G V       +L ++  G FLCKL  F R  ++G ++ TLT+++IDR+ AI +P LNH+      +    V+ IS+W+VAIL+ +P  + + ++Q     N   L  ++C  F  E      + ++ ++F I +  P +II   Y  +A +L  T     +   C      + +  R K++KI LAF+++F +C  P+ +  +  +      SQY+ ++ +  +    +T+V+  LNP+ L ++S +FR H  H     R+            R+IHS+S
Sbjct:   54 ETYVVPTLFALIFIVGLLGNGTLILVFIRNRTMRSVPNIYIMSLSIGDFIVIAGTVPFISTIYVLDSWPYGLFLCKLSEFLRDVSIGVTVLTLTILSIDRYVAIAMPLLNHKGRRHTRRTVTIVLAISVWIVAILMAIPGTHYSFVMQVQATPN---LHYSVCYPFPPEMWPWYPKLMVLLKFLIQYAIPLVIIGTFYCLMARQLIRTSRAHLSQTSCGGVAHLKQMKARVKVAKIALAFVLLFAVCFFPNHVFMMWYYFAPNAPSQYNSFWHVWKIMGYVMTFVNSCLNPVALYLVSGVFRNHFKHYLFCGRHPNVHARHNSYSFRTIHSSS 383          
BLAST of GCR060 vs. TrEMBL
Match: A0A2U9PG12 (Neuropeptide receptor OS=Diaphorina citri OX=121845 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.402e-18
Identity = 106/349 (30.37%), Postives = 179/349 (51.29%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLC-IFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXA--LKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHI--SQYSHY-----FLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHL-FHLFRSTRYDRSI-HSNSYVPKSKMYCIEKKKEKCTTNSDTILNNEE 1146
            + Y+V  L AII ++G + N  + ++  + K++++VPN  I +LA+ D+  +   V        L ++  G  +CKL   TR  ++G S+FTLT ++ +R+ AIV P+    S+  SK    V   +IW++AI++ LP    + +   T   N    T   C  F  E   Q  + V+  +F  Y+  P  +I   YI +A  L+L T+   G +   SS+S   RKK++K+VL+F+IIF+IC LP  +  +  H     Y +Y     FL +T   L++++  +NP+ L  +S +FR H   +LF      R + H  + VP +   C  +++    T+  TI   E+
Sbjct:   38 ETYIVPVLFAIIFLVGVLGNGTLVLIFARHKNMRSVPNTYILSLALGDLLVIICGVPFTSTLYTLESWPYGPHICKLSEATRDISIGVSVFTLTALSAERYCAIVNPIR---SHISSKPLTIVTAFAIWVLAIILALPSALFSHVQPATTASND---TIYFCSPFPVEYGQQYKQTVVLCKFLAYYLGPLCVIACFYILMARHLELSTRNMPGELLGQSSQS-RARKKVAKMVLSFVIIFIICFLPLHIFEMWYHFYPDSYDNYDNFWHFLRITGFCLSFINSCINPIALYFISGVFRKHFNRYLFCCCTSRRQLQHDVTLVPFNSTSC--RRQHSVLTSHFTISQEEK 377          
BLAST of GCR060 vs. Ensembl Cavefish
Match: nmbr (neuromedin B receptor [Source:NCBI gene;Acc:103031806])

HSP 1 Score: 83.9593 bits (206), Expect = 2.513e-17
Identity = 62/251 (24.70%), Postives = 125/251 (49.80%), Query Frame = 1
Query:  139 QYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSS---YWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI---FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            +Y++ ++  +I  +G + N+ +  + +   ++++VPN+ I++LA+ D+  L   V  +        +I G   CKL    +  ++G S+FTLT ++ DR  AIV P++ Q+S   +W   K      ISIW++++L+ +P    ++++  T       +T   C+   F  E   + +  +I++ + +       +         +K    +  G V   S R +  RK+L+KIVL F+ +F +C  P+ +
Sbjct:   36 RYVIPSVYILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFFEEWIFGTVACKLIPVIQLTSVGVSVFTLTALSADRHKAIVNPMDIQTSSAVFWTCLK-----AISIWVISVLLAVPEAIFSQVVHIT----DRNVTFPACMPYPFSNEMHPKIHSIMIFLVYFLIPLGIISVYYYHIARTLIK-SAHDMPGEVSEHSKRQMETRKRLAKIVLVFVGLFALCWFPNHV 276          
BLAST of GCR060 vs. Ensembl Cavefish
Match: ednrba (endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-980526-16])

HSP 1 Score: 78.5666 bits (192), Expect = 1.633e-15
Identity = 70/270 (25.93%), Postives = 135/270 (50.00%), Query Frame = 1
Query:   97 CSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSK-----KFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLC-IFRKESVLQAYR-AVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTII 885
            C+ P   R +  +   +V  L+ ++ ++G   N  +  +I K K ++  PN+LIA+LA+ D+ ++   +  N+  +L   +  G  LCKL  F + A++G ++ +L  ++IDR+ A+       +S+ R K     K+ ++ I  IWL++I++ +P     ++I  T+ Y    L   L    +K   ++ Y+ A  W  F  YF  P     + Y    +  E       VQI  +  + +R++++K V   +++F +C LP  L+ I+
Sbjct:   51 CTGPTEIRDTFKYINTVVSCLVFVVGIIG---NSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGVGLCKLVPFVQKASVGITVLSLCALSIDRYRAV-------ASWNRIKGIGVPKWTAIEITLIWLLSIVLAVPEAIAFDMI--TMDYKGEHLRICLLHPMQKSQFMKFYKSAKDWWLFSFYFCMPLACTAVFYTL--MTCEMLRKKNGVQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 306          
BLAST of GCR060 vs. Ensembl Cavefish
Match: kiss1rb (G-protein coupled receptor 54-like [Source:NCBI gene;Acc:103024304])

HSP 1 Score: 78.1814 bits (191), Expect = 1.759e-15
Identity = 76/289 (26.30%), Postives = 128/289 (44.29%), Query Frame = 1
Query:  142 YLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYL-----FGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPV---------------VYVTEIIQPTIPYNKSCL-----------TTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYF 915
            +LV  +  +I V+G   N  V  +I K K + T  N  IANLA+ DI++L     F  VL  +P     ++I G F+CK   + +  +   +  TLTVM++DR+   V PL  +S   R+ +  + V + IW+ + L+++PV               V+ TEI  PT  + K  +             T+C+     + Q  R  +                          E  E++  +Q+ + +S   R K+S++VL  +++FV C  P QL    I +  +S +F
Sbjct:   29 WLVPLVFGLIMVMGLAGNSLVLCVIYKHKKMWTATNFYIANLAMTDITFLVCCVPFTAVLYPLP-----SWIFGNFMCKFVSYIQQMSAQATCMTLTVMSVDRWYVTVYPL--RSLQCRTLRVATTVSLGIWIGSFLVSVPVPLYTQTLAGDWHGPQVFCTEIF-PTAMHKKGFILYNFLAVYMLPLVTICVCYMSMLYQMGRPAV--------------------------EPVESNYQLQVQTEQSAAVRAKVSRMVLVIVLLFVFCWGPIQL---FIMVQAFSPHF 280          
BLAST of GCR060 vs. Ensembl Cavefish
Match: ENSAMXT00000056157.1 (somatostatin receptor type 5-like [Source:NCBI gene;Acc:103047489])

HSP 1 Score: 78.1814 bits (191), Expect = 2.177e-15
Identity = 50/142 (35.21%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  157 LIAIIS----VLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEI 570
            L AIIS    ++G + N     ++++   +KTV N+ I NLA+AD  Y+ G       N+ LS +  G FLC++ M         SIF LTVM+IDR+ A+V P+  +S+ WR  +   VV  ++W ++ ++ LPVV  +++
Sbjct:   56 LTAIISLTVFIVGLVGNTLAIYVVLRYAKMKTVTNIYILNLAVADELYILGLPFLTTQNV-LSYWPFGSFLCRVLMTADSLNQFTSIFCLTVMSIDRYLAVVHPI--RSTRWRRPRVAKVVSAAVWAISFVVILPVVIFSDV 194          
BLAST of GCR060 vs. Ensembl Cavefish
Match: sstr3 (somatostatin receptor type 5-like [Source:NCBI gene;Acc:103034757])

HSP 1 Score: 78.1814 bits (191), Expect = 3.037e-15
Identity = 52/166 (31.33%), Postives = 85/166 (51.20%), Query Frame = 1
Query:   85 NLTNCSNPKLYRG--SVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQ 576
            N + CSN     G         L+  +  I+ ++G   N  V  +++     ++V N+ I NLAIAD  ++ G     + N ++S +  G F+C+L M         SIF LTVM+IDR+ A+V P+  +SS WR  +    V  S+W V+ L+ LP+    ++I+
Sbjct:   37 NTSKCSNETTSGGRPGTGVTGVLISLIYIIVCIVGLGGNTLVIHIVLHYSKTESVTNIYILNLAIADELFMLGLPFLAVQNAMMS-WPFGSFMCRLVMTVDGINQFTSIFCLTVMSIDRYLAVVHPI--RSSKWRRPQVAKAVNASVWAVSFLVVLPMFIFADVIE 199          
BLAST of GCR060 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 67.781 bits (164), Expect = 1.082e-12
Identity = 69/265 (26.04%), Postives = 127/265 (47.92%), Query Frame = 1
Query:  136 QQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVV--YVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXA----LKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
              +LV  L A+I ++G + N  V  +I K + ++TV N  I NLA  DI +L   V        L +++ G F+CK   + +  T+  +  TLT M++DR    V P+  +S   R+    + + I IW+ +++++LP+   + T+  +   P        T C     SV   +  V++    +Y      I     I I       +E Q+ +  +Q+ + R+   R K++++V+  +++F++C  P QL   I+  S Y H+
Sbjct:   35 DAWLVPLLFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPI--RSLQHRTPCLAACISIGIWIGSLVMSLPMALYHKTDTKEWYGP-------KTYCFDAFPSVPHEHAFVLYSFVLVYMLPLVTISVCYSIMIKKIGRPAVEPQDDNVQLQMLTERNEATRAKVTRMVVVVVLVFMLCWGPIQL--FILFQSFYPHF 288          
BLAST of GCR060 vs. Ensembl Sea Lamprey
Match: NPBWR1 (neuropeptides B and W receptor 1 [Source:HGNC Symbol;Acc:HGNC:4522])

HSP 1 Score: 65.0846 bits (157), Expect = 5.497e-12
Identity = 60/174 (34.48%), Postives = 86/174 (49.43%), Query Frame = 1
Query:   49 TKYHRTQIMVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVL---GFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLT-NIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRF---TAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLP 549
            + + ++     LN T  S     R  V++     +TL  I SV+   G   N AV  +I++   +KTV N+ I NLAIAD   LF  VL  NI N LL  +  G  +CK+ +      +  SI+ LTVM+ DRF   TA V   N     +R+ K VS     +WL+  ++ LP
Sbjct:    6 SGWTQSNATSFLNETAVSANGTNRTQVDYSSDFYITLPIIYSVICAIGLTGNTAVIYVILRAPKMKTVTNMFILNLAIAD--ELFTLVLPINIANHLLQDWPFGKTMCKVILSIDQYNMFTSIYFLTVMSADRFFVVTATVKSENLPRRTYRNAKLVSR---GVWLLVSVVILP 174          
BLAST of GCR060 vs. Ensembl Sea Lamprey
Match: cysltr1 (cysteinyl leukotriene receptor 1 [Source:ZFIN;Acc:ZDB-GENE-050522-250])

HSP 1 Score: 61.2326 bits (147), Expect = 1.209e-10
Identity = 47/152 (30.92%), Postives = 78/152 (51.32%), Query Frame = 1
Query:  106 PKLYRGSVNFQQYLVVTLIAIISVLGFILN-MAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRS-KKFVSVVIISIWLVAILITLPVV 555
            P L +   +F+  +   +  +I+VLG   + +A++V     K   +  +  I NLA AD+ Y+    L  +     S +  G  LC+L ++T Y  L GSIF LT ++++R+ A+  P+      WR   K+  VV +SIW    L +LP+V
Sbjct:   14 PSLCQLHDSFKHDVYTAVYTVIAVLGLPAHSLALYVFTRHYKKNNSSRSYCI-NLACADLLYILTLPLQIVYYSRNSDWPFGDALCRLTIYTFYVNLYGSIFFLTAISVNRYLAVARPMQQ----WRGHGKWTRVVCVSIWAFTALCSLPIV 160          
BLAST of GCR060 vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 60.4622 bits (145), Expect = 2.266e-10
Identity = 37/136 (27.21%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  163 AIISVLGFIL----NMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVY 558
            A++  L F L    N  V  ++ + K+L TV N+ + +LA++D+      +   +     S +I G  LCKL  F +   +  S+ T+  +A++RF  I+ PL  +S Y  ++   + ++  +WLV + +  P+ Y
Sbjct:   49 AVVGALVFTLALSGNALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARA--ASMLCGVWLVGLCVAAPMFY 182          
BLAST of GCR060 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001343.1 (pep scaffold:Pmarinus_7.0:GL480096:18103:20287:1 gene:ENSPMAG00000001212.1 transcript:ENSPMAT00000001343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 7.964e-10
Identity = 47/176 (26.70%), Postives = 88/176 (50.00%), Query Frame = 1
Query:   34 LKRKLTKYHRTQIMVILNLT---NCSNPKLYRGSVNFQQYLVV-TLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLP 549
             K+KL    R+  +V +N +   N + P     S  +  Y  +  ++ II ++G  + + VF+ + + KS  T+    + NLA+AD+ ++    L  +  +    +  G  +C++  FT YA L  SIF LT +++ R+ A+V P+    +    +  ++ V  SIW+   L+T P
Sbjct:    1 FKKKLCNLKRSAGIVTMNSSAAPNGTGPCSMDDSYKYPIYSAIYGIVCIIGMMGNAIALYVFLCLTRTKSASTI---YLINLALADMFFVLTLPLRVVYYVRDGDWPFGDAMCRISSFTFYANLYSSIFFLTGLSVTRYLAVVHPVRSLKAVTARRAVIACV--SIWVFVTLVTSP 171          
BLAST of GCR060 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 73.1738 bits (178), Expect = 1.585e-14
Identity = 62/236 (26.27%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  163 AIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINK--RKKLSKIVLAFIIIFVICRLP 864
            A I  L  + N  V   + + + +K+V NL IANLA +D+   F  +   I  +  + ++ G  LCKL ++ +  ++G S+ TL  +  DRF AI+ P   + S+    K    +I+ IW +++ I  P++Y T++      +N  C       F  ++  + Y  V+++           ++    +    KL  +   G V I S+ S N+  RKK+ K+++  I++F    LP
Sbjct:    4 ATIIALSLVGNTVVIFTVCRNRHMKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSF----KTAKTIIMLIWSLSLGIMAPLIYATKV------HNNQCTEDWTPAFDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVR---KLWRRRRIGEV-IPSASSKNEVSRKKVIKMLITVIMLFTFSWLP 225          
BLAST of GCR060 vs. Ensembl Nematostella
Match: EDO33446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS83])

HSP 1 Score: 71.633 bits (174), Expect = 3.575e-14
Identity = 69/251 (27.49%), Postives = 128/251 (51.00%), Query Frame = 1
Query:  157 LIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIP----------NILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQ-AYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQI-CSSRSINKRKKLSKIVLAFIIIFVICRLPDQL 873
            L++++++LG   N+ V   +  VK ++TV N LI NLA+A++ Y    +L  +P          N  +ST+  G + CK+  F +Y  +  S+ TL  +A DRF AIV+PL        +K+    ++  IW+V+  +  PV+Y   +++    +    + +    + +  + Q A R    + F + +  PF ++   Y  I  KL  ++  G+     SS+++  RKK+ K+++   ++FV C LP Q+
Sbjct:   10 LVSLVAILG---NILVISAVFHVKRMRTVTNYLIVNLAVAELLY----ILVAMPPFFVEIFSLYNWCMSTYTRGVYFCKIVNFGQYLLVPVSVLTLACIAADRFFAIVVPLKRV----LTKRVFYWLVPGIWVVSAGLAAPVLYAYRVVE----WGGHLMCSEE--WGEGGIAQHASRIYTSMLFVVAYCVPFAVMATMYTVICRKLWLRKVPGSQSAKKSSKAVESRKKVVKMLITVFVVFVACWLPVQV 243          
BLAST of GCR060 vs. Ensembl Nematostella
Match: EDO35936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK22])

HSP 1 Score: 68.9366 bits (167), Expect = 5.171e-13
Identity = 51/152 (33.55%), Postives = 83/152 (54.61%), Query Frame = 1
Query:  175 VLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQ----------PTIPYNKS 600
            ++G I N+ V +++   +  +TV ++ I NLAI+D++YLF  + TN+   L    +   F C     T   T+  SIFTLT MAI R   I+ P   +  +    ++V + I+ IW++AILI +P++ VT I+Q          P+I Y K+
Sbjct:   28 IVGTIGNVLVLIVVAGRRERRTVNDIFILNLAISDLTYLFICITTNL--YLTVGTVPMEFYCWFVWPTMTVTICLSIFTLTSMAIHRRKVILNPFKPEIKH----RYVFIWIVVIWIMAILIVIPMLLVTRILQVEPYGCMEVWPSIEYRKA 173          
BLAST of GCR060 vs. Ensembl Nematostella
Match: EDO34996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT8])

HSP 1 Score: 68.1662 bits (165), Expect = 6.996e-13
Identity = 68/260 (26.15%), Postives = 117/260 (45.00%), Query Frame = 1
Query:  208 VLIVKVKS----LKTVPNLLIANLAIADI-------SYL---FGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSR-SINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHI------SQYSHYFLLV 924
            V+++KV S    L+T  N LI N+A+AD+       S+    F      +P +      G  FLCK   F +  ++   + TLT +A +RF A+V PL        + KF  V+I+ IW+ A +   P +YV E+I      N  C+      F  E+  + Y  +I+I            +  C I    K+  ++  G V   + R   + +K++ K+++  ++ F +C LP  +  ++++        Q SH  L V
Sbjct:   16 VIVIKVFSTSQRLRTEVNFLIVNMAVADVMTSLFNMSFFVRYFVREALGMPQVWFGGHFGA-FLCKFVDFIQGVSMFCCVLTLTAIAFNRFFAVVFPLKSI----MNPKFTKVLILLIWICACVFAAPTLYVMEVIVNPEDGNYYCIENWAPTFDNETTPRYYTLLIFIVMYAIPLTFITCLYACVIR---KVWIRQVPGNVTRANQRLEGDMKKRVLKMLITVVVTFALCWLPFHIYLLLVNFYYGIYSCQISHIVLFV 267          
BLAST of GCR060 vs. Ensembl Nematostella
Match: EDO50023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF33])

HSP 1 Score: 68.9366 bits (167), Expect = 7.360e-13
Identity = 46/158 (29.11%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  175 VLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLT--NIPNILLSTFIGGYF---------LCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQ-PTIPYNKSCLTT 612
            ++ F  N+ V V +V  + ++TV N LI N+A+AD+      +LT  N+P+   +     YF         +CKL  F +  ++  S+  +T +A+DRF A+VLPL    ++        +++ ++W+VAI ++ P +Y   +I  P +P   +C+ T
Sbjct:   32 LISFPGNILVIVTVVTNRRMRTVTNYLIVNMAVADL------LLTVFNMPSTTSTVISPSYFWYTGEFWIAMCKLLPFIQSVSVASSVLNMTAIAVDRFFAVVLPLRRYITF----NVAYIMMAAVWVVAIGVSAPFLYAQNVISFPGMPGKVACMET 179          
BLAST of GCR060 vs. Ensembl Medaka
Match: grpr (gastrin-releasing peptide receptor-like [Source:NCBI gene;Acc:101159797])

HSP 1 Score: 84.3445 bits (207), Expect = 1.899e-17
Identity = 73/276 (26.45%), Postives = 131/276 (47.46%), Query Frame = 1
Query:   91 TNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPY-NKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALK-LETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
            T+ S P+++   V      + ++  +ISVLG + N+ +       KS + VPNL +++LA+ D+  L      +    L   ++ G   CK+  F +  ++G S+FTLT ++ DR+ AIV PL+ Q+S   +   +     SIW+ ++++ +P    +++    IP  N+S +T        +   Q +    ++ F +       +         +K   T    G V +   R I  RK+L+K VL F+ +F IC LP      II++ +  HY
Sbjct:   15 TDISTPEMWSTGV-----AIASIYGVISVLGLVGNITLIKTFCSSKSARNVPNLFMSSLALGDVLLLVTCAPVDASRYLSDEWLFGRVGCKVIPFIQLTSVGVSVFTLTALSADRYRAIVKPLDIQTSVTTASIILRAA--SIWVFSLILAIPEAVYSDLHTFNIPSTNESFVTCAPYPHAGKLHPQIHSMASFLIFYVIPLLVISMYYTVIAQSLIKSASTLPVEGNVHM--RRQIESRKRLAKTVLVFVGLFAICWLPSH----IIYLYRSYHY 277          
BLAST of GCR060 vs. Ensembl Medaka
Match: grpr (gastrin-releasing peptide receptor-like [Source:NCBI gene;Acc:101159797])

HSP 1 Score: 81.6481 bits (200), Expect = 1.245e-16
Identity = 69/257 (26.85%), Postives = 123/257 (47.86%), Query Frame = 1
Query:  148 VVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPY-NKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALK-LETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHY 912
            + ++  +ISVLG + N+ +       KS + VPNL +++LA+ D+  L      +    L   ++ G   CK+  F +  ++G S+FTLT ++ DR+ AIV PL+ Q+S   +   +     SIW+ ++++ +P    +++    IP  N+S +T        +   Q +    ++ F +       +         +K   T    G V +   R I  RK+L+K VL F+ +F IC LP      II++ +  HY
Sbjct:    8 IASIYGVISVLGLVGNITLIKTFCSSKSARNVPNLFMSSLALGDVLLLVTCAPVDASRYLSDEWLFGRVGCKVIPFIQLTSVGVSVFTLTALSADRYRAIVKPLDIQTSVTTASIILRAA--SIWVFSLILAIPEAVYSDLHTFNIPSTNESFVTCAPYPHAGKLHPQIHSMASFLIFYVIPLLVISMYYTVIAQSLIKSASTLPVEGNVHM--RRQIESRKRLAKTVLVFVGLFAICWLPSH----IIYLYRSYHY 256          
BLAST of GCR060 vs. Ensembl Medaka
Match: grpr (gastrin-releasing peptide receptor [Source:NCBI gene;Acc:101154817])

HSP 1 Score: 77.411 bits (189), Expect = 2.622e-15
Identity = 61/242 (25.21%), Postives = 113/242 (46.69%), Query Frame = 1
Query:  148 VVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLN-HQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQ 870
            +  +  I+ V+G + N+ +    + VKS++TVPNL +++LA+ D   L      +    L+  ++ G   CKL  F +  ++G S+FTLT ++ DR+ AIV PL+ H+ S   +   V V   +IWL+++ + +P    +++   T  +      T         +     +              I +  C+I  +L   + +      +   + I  RK+L+K VL F+ +F +C LP  
Sbjct:   15 IAAVYGILIVVGVVGNVTLVKTCLLVKSMRTVPNLFLSSLAVGDALLLLTCAPVDASRYLVDEWLFGRVGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPLDMHRPS---ASLGVGVRAAAIWLLSVTLAVPEAVFSDLHTFTTSHTNETFVTCAPYPHAGDLHPKIHSTASFLIFYIIPLFIISVYYCFIARSLVRSSADLPAEGHLHVQKQIKSRKRLAKTVLVFVGLFAVCWLPSH 253          
BLAST of GCR060 vs. Ensembl Medaka
Match: grpr (gastrin-releasing peptide receptor [Source:NCBI gene;Acc:101154817])

HSP 1 Score: 77.411 bits (189), Expect = 3.158e-15
Identity = 69/273 (25.27%), Postives = 124/273 (45.42%), Query Frame = 1
Query:   73 MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVF--VLIVK----VKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLN-HQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQ 870
            M  L   +   P +   S ++   + +  I I +V G ++ + V   V +VK    VKS++TVPNL +++LA+ D   L      +    L+  ++ G   CKL  F +  ++G S+FTLT ++ DR+ AIV PL+ H+ S   +   V V   +IWL+++ + +P    +++   T  +      T         +     +              I +  C+I  +L   + +      +   + I  RK+L+K VL F+ +F +C LP  
Sbjct:    1 MEDLTPEDGGGPCVNASSAHWAHRVWLPGIGIAAVYGILIVVGVVGNVTLVKTCLLVKSMRTVPNLFLSSLAVGDALLLLTCAPVDASRYLVDEWLFGRVGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPLDMHRPS---ASLGVGVRAAAIWLLSVTLAVPEAVFSDLHTFTTSHTNETFVTCAPYPHAGDLHPKIHSTASFLIFYIIPLFIISVYYCFIARSLVRSSADLPAEGHLHVQKQIKSRKRLAKTVLVFVGLFAVCWLPSH 270          
BLAST of GCR060 vs. Ensembl Medaka
Match: sstr3 (somatostatin receptor 3 [Source:ZFIN;Acc:ZDB-GENE-061009-35])

HSP 1 Score: 77.0258 bits (188), Expect = 8.167e-15
Identity = 53/159 (33.33%), Postives = 86/159 (54.09%), Query Frame = 1
Query:   79 ILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVV 555
            + N TN + P  + G  +    L+  +  ++ V+G   N  V  +++    +++V N+ I NLAIAD  ++ G     + N L S +  G F+C+L M         SIF LTVM+IDR+ A+V P+  +SS WR  +   VV  ++W ++ L+ LPVV
Sbjct:   73 LFNSTNSTFPDFFSGP-SVAGVLIPLIYIVVCVIGLGGNTLVIHIVLHYSKIESVTNIYILNLAIADELFMLGLPFLAVQNTLQS-WPFGSFMCRLVMTVDSINQFTSIFCLTVMSIDRYLAVVHPI--RSSKWRRPQVAKVVNGTVWALSFLVVLPVV 227          
BLAST of GCR060 vs. Planmine SMEST
Match: SMESG000022911.1 (SMESG000022911.1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 363/363 (100.00%), Postives = 363/363 (100.00%), Query Frame = 1
Query:   73 MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHLFHLFRSTRYDRSIHSNSYVPKSKMYCIEKKKEKCTTNSDTILNNEEMHSCL 1161
            MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWIQFGIYFFFPFIIICICYITIALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPLLNPLTLLMLSALFRYHLFHLFRSTRYDRSIHSNSYVPKSKMYCIEKKKEKCTTNSDTILNNEEMHSCL
Sbjct:    1 MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWIQFGIYFFFPFIIICICYITIALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPLLNPLTLLMLSALFRYHLFHLFRSTRYDRSIHSNSYVPKSKMYCIEKKKEKCTTNSDTILNNEEMHSCL 363          
BLAST of GCR060 vs. Planmine SMEST
Match: SMESG000044458.1 (SMESG000044458.1)

HSP 1 Score: 147.517 bits (371), Expect = 6.400e-40
Identity = 120/335 (35.82%), Postives = 178/335 (53.13%), Query Frame = 1
Query:   73 MVILNLTN--CSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKS-----CLTTTLCIFRKESVLQAYRAVI---WXXXXXXXXXXXXXXXXXXXXXALKLETQ-ETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHLFHLFRSTRYDRS 1044
            MV+ NL++  C+    YR   + + Y++  ++ +I + G + N  + ++I+  K ++T+PN LI NLA+ D  +L  HVL+ +P  +LS F     LCKL  FTR  TLG SIFTL  +AIDR   IV PL  Q S  +S+ F +  ++ IWL + ++  P    + I +  I          CL T +C  R +    +Y+  I   WI F  +F  PF++I  CY  IAL L     T G +   S+  I  RKKL+KIVL  IIIF+ C+LP+Q+    I        F+ +  + LT+V+P LNPLTL +LS  +R          + DR 
Sbjct:    1 MVMFNLSSESCTKWIQYRAGKSVESYVMFFVVLLIFIFGLLGNFVLIIIILANKRMRTLPNFLIVNLAVGDTIFLLAHVLSTLPTYILSKFHADSTLCKLLTFTRNYTLGISIFTLMFLAIDRLRVIVCPLRRQLSPDQSRLFATTGVVGIWLTSTVLATPNAINSYIAKINISIENEGNQTICLFTEVCSSRAD--YHSYQEKIFQFWITFSAFFLIPFVVIGTCYTFIALYLMCHSRTPGNINSISTVQITSRKKLAKIVLGLIIIFLFCKLPEQIQKFWIIFYDVGFQFVQIMCEILTFVYPCLNPLTLCILSLSYRRQFISCIFRCKIDRG 333          
BLAST of GCR060 vs. Planmine SMEST
Match: SMESG000044458.1 (SMESG000044458.1)

HSP 1 Score: 144.821 bits (364), Expect = 4.924e-39
Identity = 118/333 (35.44%), Postives = 175/333 (52.55%), Query Frame = 1
Query:   73 MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKS-----CLTTTLCIFRKESVLQAYRAVI---WXXXXXXXXXXXXXXXXXXXXXALKLETQ-ETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPXXXXXXXXXXXXXFRYHLFHLFRSTRYDRS 1044
            M  L+  +C+    YR   + + Y++  ++ +I + G + N  + ++I+  K ++T+PN LI NLA+ D  +L  HVL+ +P  +LS F     LCKL  FTR  TLG SIFTL  +AIDR   IV PL  Q S  +S+ F +  ++ IWL + ++  P    + I +  I          CL T +C  R +    +Y+  I   WI F  +F  PF++I  CY  IAL L     T G +   S+  I  RKKL+KIVL  IIIF+ C+LP+Q+    I        F+ +  + LT+V+P LNPLTL +LS  +R          + DR 
Sbjct:    1 MFNLSSESCTKWIQYRAGKSVESYVMFFVVLLIFIFGLLGNFVLIIIILANKRMRTLPNFLIVNLAVGDTIFLLAHVLSTLPTYILSKFHADSTLCKLLTFTRNYTLGISIFTLMFLAIDRLRVIVCPLRRQLSPDQSRLFATTGVVGIWLTSTVLATPNAINSYIAKINISIENEGNQTICLFTEVCSSRAD--YHSYQEKIFQFWITFSAFFLIPFVVIGTCYTFIALYLMCHSRTPGNINSISTVQITSRKKLAKIVLGLIIIFLFCKLPEQIQKFWIIFYDVGFQFVQIMCEILTFVYPCLNPLTLCILSLSYRRQFISCIFRCKIDRG 331          
BLAST of GCR060 vs. Planmine SMEST
Match: SMESG000040268.1 (SMESG000040268.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.415e-33
Identity = 69/180 (38.33%), Postives = 110/180 (61.11%), Query Frame = 1
Query:   82 LNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLC 621
            +N +N +  + Y+  ++ Q YL+    ++I ++G + N+ V  +I     + TVPNLLIANL++ DI ++FGH+  +IP+ LL  F GG FLC+L +F + + LG SIFTLT MA+DRF AI  PL+ Q+    S+  V  V+++IW+ ++  ++P +  TEI    I  N +C     C
Sbjct:    1 MNFSNGTLCEEYKADLSLQNYLLPIFYSVIFLMGLMGNITVIYIIFFKPGMTTVPNLLIANLSLGDIVFIFGHMCFSIPSYLLPGFYGGNFLCRLMVFVKCSCLGISIFTLTFMAVDRFRAITRPLHQQA---LSRVAVITVMVTIWIFSMAASVPTIMYTEIKVHPISNNDTCFILRFC 177          
BLAST of GCR060 vs. Planmine SMEST
Match: SMESG000019758.1 (SMESG000019758.1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.365e-19
Identity = 79/290 (27.24%), Postives = 157/290 (54.14%), Query Frame = 1
Query:   85 NLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVKVKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQMFTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIWLVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCI-FRKESVLQAYRAVIWXXXXXXXXXXXXXXXXXXXXXALKLETQETSGTVQICSSRSINKRKKLSKIVLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVH 951
            N + C++ K +   +  ++  +V +  ++ ++G   N+++   +++  S + +PNL + NL + DI +L  H+     + ++S +  G  LCKL    +  TLG +  TL  +AI+R+ A  + L       + K+FV V +  IW+  ++  +P+   + +    +    +C+    C  F+ ++ L    +++W +F IYF  P  +I + Y+ +A+KL   + S   +  + R I +R+KL+KIVL  +I+FVIC LP+ L+++   + +YSH+     A+ LTY++
Sbjct:   14 NASFCTSWKPHYPRIGVKEISIVFICFVVFIIGMAGNVSLIYHLMRPPSRRMLPNLFLINLTLGDIIFLIFHLPHTALSYIISHWEIGAPLCKLWNLIKLLTLGVTTLTLVALAIERYLA-TMSLTSIFINAKRKRFVKVSLHIIWIFPLIFAIPIGINSNV---GLYQFSNCVYVQFCSEFQTKTDLYFVISMVWSKFVIYFLIPAGVIAVFYVLMAIKLYKNDLSLVQRFSNCRRIKERRKLAKIVLGLVIVFVICWLPEHLHSLSYFLFRYSHFLWKTVAKTLTYLY 299          
The following BLAST results are available for this feature:
BLAST of GCR060 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EDNRB1.518e-1527.11endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB1.518e-1527.11endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB1.518e-1527.11endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB1.518e-1527.11endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
EDNRB1.801e-1526.37endothelin receptor type B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of GCR060 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-353.008e-1028.24NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
tyra-23.736e-1029.94Tyramine receptor tyra-2 [Source:UniProtKB/Swiss-... [more]
tyra-24.242e-1029.94Tyramine receptor tyra-2 [Source:UniProtKB/Swiss-... [more]
ckr-25.820e-1022.52CholecystoKinin Receptor homolog [Source:UniProtK... [more]
ckr-25.891e-1022.52CholecystoKinin Receptor homolog [Source:UniProtK... [more]
back to top
BLAST of GCR060 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCHa1-R9.738e-1831.50gene:FBgn0050106 transcript:FBtr0086893[more]
Lkr1.166e-1430.37gene:FBgn0035610 transcript:FBtr0077149[more]
RYa-R8.029e-1423.65gene:FBgn0004842 transcript:FBtr0345268[more]
RYa-R1.688e-1323.99gene:FBgn0004842 transcript:FBtr0085100[more]
RYa-R4.622e-1323.65gene:FBgn0004842 transcript:FBtr0345267[more]
back to top
BLAST of GCR060 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ednrba7.549e-1728.04endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-9... [more]
grpr1.867e-1625.27gastrin-releasing peptide receptor [Source:ZFIN;Ac... [more]
nmbr4.967e-1623.79neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nmbr7.541e-1623.79neuromedin B receptor [Source:ZFIN;Acc:ZDB-GENE-04... [more]
sstr58.190e-1532.86somatostatin receptor 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GCR060 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc26.464e-1725.59glypican 2 [Source:Xenbase;Acc:XB-GENE-6258957][more]
dguok2.178e-1626.14deoxyguanosine kinase [Source:Xenbase;Acc:XB-GENE-... [more]
SSTR55.181e-1632.92somatostatin receptor 5 [Source:NCBI gene;Acc:1004... [more]
kiss1r2.969e-1525.46KISS1 receptor [Source:NCBI gene;Acc:100316929][more]
wwtr16.228e-1525.10WW domain containing transcription regulator 1 [So... [more]
back to top
BLAST of GCR060 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brs32.256e-1527.24bombesin-like receptor 3 [Source:MGI Symbol;Acc:MG... [more]
Ednrb9.290e-1526.95endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
Ednrb9.290e-1526.95endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
Ednrb9.290e-1526.95endothelin receptor type B [Source:MGI Symbol;Acc:... [more]
Nmbr1.824e-1425.61neuromedin B receptor [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of GCR060 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1ZAX0|CCH1R_DROME9.761e-1731.50Neuropeptide CCHamide-1 receptor OS=Drosophila mel... [more]
sp|P47751|BRS4_BOMOR3.471e-1526.97[Phe13]-bombesin receptor OS=Bombina orientalis OX... [more]
sp|Q8K418|BRS3_RAT5.133e-1526.57Bombesin receptor subtype-3 OS=Rattus norvegicus O... [more]
sp|O62709|EDNRB_HORSE5.430e-1527.69Endothelin receptor type B OS=Equus caballus OX=97... [more]
sp|P24530|EDNRB_HUMAN7.292e-1527.11Endothelin receptor type B OS=Homo sapiens OX=9606... [more]
back to top
BLAST of GCR060 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU912.301e-3635.82GCR060 OS=Schmidtea mediterranea OX=79327 GN=gcr06... [more]
A0A193KUA55.820e-3038.33GCR074 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
A0A1S3D5Z26.585e-1830.37neuropeptide CCHamide-2 receptor OS=Diaphorina cit... [more]
A0A147BH637.919e-1828.23Putative bombesin receptor subtype-3 OS=Ixodes ric... [more]
A0A2U9PG129.402e-1830.37Neuropeptide receptor OS=Diaphorina citri OX=12184... [more]
back to top
BLAST of GCR060 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmbr2.513e-1724.70neuromedin B receptor [Source:NCBI gene;Acc:103031... [more]
ednrba1.633e-1525.93endothelin receptor Ba [Source:ZFIN;Acc:ZDB-GENE-9... [more]
kiss1rb1.759e-1526.30G-protein coupled receptor 54-like [Source:NCBI ge... [more]
ENSAMXT00000056157.12.177e-1535.21somatostatin receptor type 5-like [Source:NCBI gen... [more]
sstr33.037e-1531.33somatostatin receptor type 5-like [Source:NCBI gen... [more]
back to top
BLAST of GCR060 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiss1rb1.082e-1226.04KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
NPBWR15.497e-1234.48neuropeptides B and W receptor 1 [Source:HGNC Symb... [more]
cysltr11.209e-1030.92cysteinyl leukotriene receptor 1 [Source:ZFIN;Acc:... [more]
qrfpr42.266e-1027.21pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
ENSPMAT00000001343.17.964e-1026.70pep scaffold:Pmarinus_7.0:GL480096:18103:20287:1 g... [more]
back to top
BLAST of GCR060 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR060 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444181.585e-1426.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334463.575e-1427.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359365.171e-1333.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349966.996e-1326.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500237.360e-1329.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR060 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grpr1.899e-1726.45gastrin-releasing peptide receptor-like [Source:NC... [more]
grpr1.245e-1626.85gastrin-releasing peptide receptor-like [Source:NC... [more]
grpr2.622e-1525.21gastrin-releasing peptide receptor [Source:NCBI ge... [more]
grpr3.158e-1525.27gastrin-releasing peptide receptor [Source:NCBI ge... [more]
sstr38.167e-1533.33somatostatin receptor 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GCR060 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022911.10.000e+0100.00SMESG000022911.1[more]
SMESG000044458.16.400e-4035.82SMESG000044458.1[more]
SMESG000044458.14.924e-3935.44SMESG000044458.1[more]
SMESG000040268.11.415e-3338.33SMESG000040268.1[more]
SMESG000019758.15.365e-1927.24SMESG000019758.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021741 ID=SMED30021741|Name=GCR060|organism=Schmidtea mediterranea sexual|type=transcript|length=1304bp
ATTCCATCTTAAAACATTCTTTGTGATTTTCAACTGAAAAGAAAATTAAC
TAAATATCACCGAACTCAAATAATGGTAATTCTAAATTTAACAAATTGCT
CAAATCCAAAACTTTATCGCGGTTCGGTTAATTTTCAACAATATCTCGTC
GTTACTTTAATCGCAATCATTTCTGTTTTGGGATTCATTTTAAACATGGC
GGTTTTTGTATTGATTGTAAAAGTTAAGAGTTTAAAAACCGTTCCGAATC
TTTTGATTGCTAATTTGGCAATAGCTGATATATCATATTTGTTTGGACAT
GTTTTGACCAATATTCCAAACATTCTTCTGTCGACATTTATCGGTGGATA
TTTTCTGTGCAAATTGCAAATGTTTACCAGATACGCGACTTTGGGTGGCA
GTATTTTTACATTGACAGTCATGGCAATAGACAGGTTTACGGCTATCGTG
TTGCCGCTTAATCATCAGTCGTCTTATTGGAGGTCAAAAAAGTTTGTCTC
TGTTGTCATAATATCGATTTGGCTCGTAGCGATTTTAATCACTTTGCCAG
TTGTCTATGTAACAGAAATTATCCAGCCAACTATTCCTTACAACAAAAGC
TGTCTGACAACGACTTTATGCATTTTTCGAAAAGAATCGGTTTTGCAAGC
ATATAGAGCAGTAATATGGATTCAGTTTGGAATTTATTTCTTTTTCCCTT
TCATTATTATCTGTATATGCTACATTACAATAGCTCTAAAACTTGAAACT
CAAGAAACATCAGGAACTGTTCAAATCTGTTCTTCAAGATCGATAAATAA
ACGGAAGAAATTGTCAAAAATCGTTCTGGCATTTATAATAATATTTGTCA
TATGCCGACTACCAGATCAACTTAACACGATTATCATTCATATCAGCCAA
TACAGTCATTATTTTCTACTCGTTACAGCGCAGTTTCTAACTTATGTCCA
TCCGCTCCTTAATCCTCTGACTTTGTTAATGCTCAGTGCTCTATTTCGAT
ATCATTTATTCCATTTATTCCGTTCTACTCGATATGATAGATCGATTCAT
TCGAATTCATACGTTCCAAAATCAAAAATGTATTGCATTGAAAAAAAGAA
AGAGAAATGTACGACAAACTCAGACACAATTTTGAATAATGAAGAGATGC
ACAGCTGTTTGTAAACAAATTAGTATTTATTTGAGTTGATATTTATTAGT
TATTTGGTTGGTATTACATTTAGATGCGATATCTTAAAATGTCAAAAATT
ATTAACAATTTTACAAAAATTTCCAATTTCATCTAAAATATTTTTTGATT
CCGT
back to top

protein sequence of SMED30021741-orf-1

>SMED30021741-orf-1 ID=SMED30021741-orf-1|Name=SMED30021741-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MVILNLTNCSNPKLYRGSVNFQQYLVVTLIAIISVLGFILNMAVFVLIVK
VKSLKTVPNLLIANLAIADISYLFGHVLTNIPNILLSTFIGGYFLCKLQM
FTRYATLGGSIFTLTVMAIDRFTAIVLPLNHQSSYWRSKKFVSVVIISIW
LVAILITLPVVYVTEIIQPTIPYNKSCLTTTLCIFRKESVLQAYRAVIWI
QFGIYFFFPFIIICICYITIALKLETQETSGTVQICSSRSINKRKKLSKI
VLAFIIIFVICRLPDQLNTIIIHISQYSHYFLLVTAQFLTYVHPLLNPLT
LLMLSALFRYHLFHLFRSTRYDRSIHSNSYVPKSKMYCIEKKKEKCTTNS
DTILNNEEMHSCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0008528G-protein coupled peptide receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 198..221
score: 23.19
coord: 283..309
score: 22.74
coord: 58..79
score: 28.62
coord: 103..125
score: 30.49
coord: 247..271
score: 20.67
coord: 25..49
score: 20.21
coord: 141..162
score: 23.44
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 41..299
e-value: 2.0E-35
score: 122.4
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 109..125
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 4..356
e-value: 2.2E-54
score: 186.3
NoneNo IPR availablePANTHERPTHR45695:SF9NEUROPEPTIDE CCHAMIDE-1 RECEPTOR-RELATEDcoord: 21..332
NoneNo IPR availablePANTHERPTHR45695FAMILY NOT NAMEDcoord: 21..332
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 26..293
e-value: 6.89894E-30
score: 113.912
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 18..328
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 291..313
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..301
score: 37.122