Guanylate cyclase domain-containing protein

Overview
NameGuanylate cyclase domain-containing protein
Smed IDSMED30021735
Length (bp)2796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase domain-containing protein (SMED30021735) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase domain-containing protein (SMED30021735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase domain-containing protein (SMED30021735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase domain-containing protein (SMED30021735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021735h1SMcG0009506 SmedASXL_000813SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021735h1SMcG0009506 dd_Smed_v4_10678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021735h1SMcG0009506 dd_Smed_v6_10678_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 152.525 bits (384), Expect = 4.634e-71
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  373 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 612          

HSP 2 Score: 137.887 bits (346), Expect = 4.634e-71
Identity = 106/378 (28.04%), Postives = 180/378 (47.62%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 152.525 bits (384), Expect = 1.523e-67
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  353 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 592          

HSP 2 Score: 126.331 bits (316), Expect = 1.523e-67
Identity = 95/337 (28.19%), Postives = 162/337 (48.07%), Query Frame = 2
Query:  299 VYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLL--NSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:   22 IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 342          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 152.525 bits (384), Expect = 1.752e-67
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  405 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 644          

HSP 2 Score: 125.946 bits (315), Expect = 1.752e-67
Identity = 95/337 (28.19%), Postives = 162/337 (48.07%), Query Frame = 2
Query:  299 VYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:   74 IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 394          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 152.14 bits (383), Expect = 3.667e-67
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  395 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 634          

HSP 2 Score: 125.176 bits (313), Expect = 3.667e-67
Identity = 106/400 (26.50%), Postives = 180/400 (45.00%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQ----------------------GLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLIS-KIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q                       LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQKNESKHISDLHHCFLGIYLCCNNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 384          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 152.525 bits (384), Expect = 1.572e-65
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  305 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 544          

HSP 2 Score: 119.398 bits (298), Expect = 1.572e-65
Identity = 88/308 (28.57%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  386 GCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    3 GKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 294          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-31 (Soluble guanylate cyclase gcy-31 [Source:UniProtKB/Swiss-Prot;Acc:Q86C56])

HSP 1 Score: 193.356 bits (490), Expect = 3.815e-99
Identity = 124/391 (31.71%), Postives = 211/391 (53.96%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFE------KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLN---------AALKKDKANIKRLSSIVQGRIKF---KGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL++  +  +++  YG   W +   ++ +   +      ++E +  +++ A   +  +  +++M + G  F ++L+   ++K+LRVLGR F  F+ GLDNLHEYLRF++PK+KPPSF  E  + + + LHYR+KR GF HYV+GQ+ NI++  ++ ++ I L+    D    H    +  +   F       + L  SI  E   I  D+FF+IFPF +V +  + I++ G+G   +   ++    N  F+L +PFI   +E+I+ ++N+ FE+I     SS P+               D+   +R       R KF   KGQM  M  W  + F+G PV+  + Q+ ++GLF+ND    D+ +D++LA +QQS EL  L  ++   S
Sbjct:    1 MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGDPVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSI-LEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELI-----SSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKS 385          

HSP 2 Score: 189.504 bits (480), Expect = 3.815e-99
Identity = 95/233 (40.77%), Postives = 152/233 (65.24%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFP---YNYTKRGEMEIKGKGSMTTYFIESR 1971
            +KS+ + ENM  L K R++TD+LLYQ +PKS+A +LR G S++  C+ F SV+I F+ +V+F ++CS ++  +++  L  +YT+FD + + + VYKVETI D+YM+VSGAP+ T+  +  I++ A   +  A K + N       I++  G HSG +VAG+VG+ MPRYCLFG+TV  +++M  + SP K+ VS+     I +     Y + +R E+EIK   ++ T+F+ SR
Sbjct:  383 QKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGK-MVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSR 614          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-31 (Soluble guanylate cyclase gcy-31 [Source:UniProtKB/Swiss-Prot;Acc:Q86C56])

HSP 1 Score: 189.504 bits (480), Expect = 1.075e-94
Identity = 95/233 (40.77%), Postives = 152/233 (65.24%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFP---YNYTKRGEMEIKGKGSMTTYFIESR 1971
            +KS+ + ENM  L K R++TD+LLYQ +PKS+A +LR G S++  C+ F SV+I F+ +V+F ++CS ++  +++  L  +YT+FD + + + VYKVETI D+YM+VSGAP+ T+  +  I++ A   +  A K + N       I++  G HSG +VAG+VG+ MPRYCLFG+TV  +++M  + SP K+ VS+     I +     Y + +R E+EIK   ++ T+F+ SR
Sbjct:  346 QKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGK-MVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSR 577          

HSP 2 Score: 178.333 bits (451), Expect = 1.075e-94
Identity = 117/350 (33.43%), Postives = 193/350 (55.14%), Query Frame = 2
Query:  302 YAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFE------KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLN---------AALKKDKANIKRLSSIVQGRIKF---KGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            ++E +  +++ A   +  +  +++M + G  F ++L+   ++K+LRVLGR F  F+ GLDNLHEYLRF++PK+KPPSF  E  + + + LHYR+KR GF HYV+GQ+ NI++  ++ ++ I L+    D    H    +  +   F       + L  SI  E   I  D+FF+IFPF +V +  + I++ G+G   +   ++    N  F+L +PFI   +E+I+ ++N+ FE+I     SS P+               D+   +R       R KF   KGQM  M  W  + F+G PV+  + Q+ ++GLF+ND    D+ +D++LA +QQS EL  L  ++   S
Sbjct:    5 FSEGLSHKLIWACHDVTGDPVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSI-LEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELI-----SSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKS 348          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-33 (Soluble guanylate cyclase gcy-33 [Source:UniProtKB/Swiss-Prot;Acc:P90895])

HSP 1 Score: 206.453 bits (524), Expect = 4.421e-87
Identity = 120/389 (30.85%), Postives = 205/389 (52.70%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYEN----FPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEI-ILMPHTSSGPLNAALK-----KDKANIKRLSSIVQGR------IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL++  ++  ++  +G  + +Q   L  +  +S++TH  Y+E ++P++  A+  I     E I    G +FV++L   GY  ++ V+GR F DFI+GLDN+HEY RFSYPK++ PSF  +S +E  + LHYR++R G+  YV GQLV +A+ FY+ DI I ++ K E    T     I  D  G  + L++    +N     P+    F ++FPFH+  ++ L I   G G  ++ P +      D F L +P I  T E I+ + N  F+I  L P       N  ++     +DK ++++  +++         +  +G +  +      + L T V+  +  + + GL+LND  + D  ++II+A  Q+SD L  + E ++  S
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEK-KTVMDNEYESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRS 388          

HSP 2 Score: 136.346 bits (342), Expect = 4.421e-87
Identity = 83/242 (34.30%), Postives = 137/242 (56.61%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRM-MSHGSPNKVHVSDIFFEHI---SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYK 1992
            K +S+ L E  R++++ +K    LL Q +P  +A+ + +   S+D C+ F+ VSI F +V DF +I   I   ++VNLLN +Y+H D++ + + VYKVETI +SYM+ +G P   D  +  + +  L M++  K        +   + +  G  +G +V G+VG++ PRYCLFGDTVNT+SRM  S+ +P  + +     + +   +   +    +G + +KGKG M  Y IE +K    YK
Sbjct:  385 KRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRS-GSVDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIEKKKGRARYK 625          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-33 (Soluble guanylate cyclase gcy-33 [Source:UniProtKB/Swiss-Prot;Acc:P90895])

HSP 1 Score: 205.682 bits (522), Expect = 7.584e-87
Identity = 120/391 (30.69%), Postives = 205/391 (52.43%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYEN----FPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEI-ILMPHTSSGPLNAALK-----KDKANIKRLSSIVQGR--------IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL++  ++  ++  +G  + +Q   L  +  +S++TH  Y+E ++P++  A+  I     E I    G +FV++L   GY  ++ V+GR F DFI+GLDN+HEY RFSYPK++ PSF  +S +E  + LHYR++R G+  YV GQLV +A+ FY+ DI I ++ K E    T     I  D  G  + L++    +N     P+    F ++FPFH+  ++ L I   G G  ++ P +      D F L +P I  T E I+ + N  F+I  L P       N  ++     +DK ++++  +++           +  +G +  +      + L T V+  +  + + GL+LND  + D  ++II+A  Q+SD L  + E ++  S
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEK-KTVMDNEYGLESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRS 390          

HSP 2 Score: 136.346 bits (342), Expect = 7.584e-87
Identity = 83/242 (34.30%), Postives = 137/242 (56.61%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRM-MSHGSPNKVHVSDIFFEHI---SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYK 1992
            K +S+ L E  R++++ +K    LL Q +P  +A+ + +   S+D C+ F+ VSI F +V DF +I   I   ++VNLLN +Y+H D++ + + VYKVETI +SYM+ +G P   D  +  + +  L M++  K        +   + +  G  +G +V G+VG++ PRYCLFGDTVNT+SRM  S+ +P  + +     + +   +   +    +G + +KGKG M  Y IE +K    YK
Sbjct:  387 KRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRS-GSVDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIEKKKGRARYK 627          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-36 (Soluble guanylate cyclase gcy-36 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF4])

HSP 1 Score: 174.096 bits (440), Expect = 8.059e-71
Identity = 95/227 (41.85%), Postives = 138/227 (60.79%), Query Frame = 1
Query: 1291 KQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSD---IFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            +QLE   +DL   + KTD LL + +P S+A++L++G+S     + ++  ++ F+ V  F QI    +   IV+LLN+++T FD L  + K YKVET+ DSYM V G P   D H   I  +AL M+  A+  + +P  ++  + +  G HSG +VAG+VG KMPRYCLFGDTVNTSSRM SH    ++H S+      E   +F   +  RG ++IKGKG M TYF+
Sbjct:  403 EQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSV--EAREYEEATVMFTDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIPDLVDDHCEVICHLALGMVMEAR-TVCDPITNT-PLHIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRF--EFEPRGRVQIKGKGEMNTYFL 623          

HSP 2 Score: 114.39 bits (285), Expect = 8.059e-71
Identity = 103/397 (25.94%), Postives = 175/397 (44.08%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLA--EIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPK--IKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYE------------NFPIRRDM--FFEIFPFHLVLSENLTIQHCGVG-FKHICPTLLN--SNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKA----------NIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQ-SDELMEL 1273
            M+G +  +++  +   YG   W + L  A  E   ++I  H  Y++     +V+A+S IL    E +    GC+ ++Y    G+D ++R +  N   F+  LD+LH ++     K  ++ PSF  E   + TI LHY T RPG    V+G L   AK  ++ D+ + +  + + S Q      I   +    KTL      E            N+ IR     F   FP+H+V+ ++  I   G   + HI   LL+  +     F +++P I   ++ I  + N+ F + +         NA  +  +A          N   L+      +K KGQM+ M     +M+L +P +  + +L + GL L  +   D  +D+IL   Q+ SD  M L
Sbjct:    1 MFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINH-YYSDADTFSLVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSMTITGRTQRSVQMATGERIEEHVIFLVKTLNTDQSNEEALGTAVVQHSNNYKIRLTHMDFISTFPYHMVVDQDCKIVQVGRELYNHIPKDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAVFVLQVKTTPMEFQRNANKRAAQAIEASENLYEDNNGALALSQSQHLKLKGQMMLMSSGGHIMYLCSPYVTSIPELLQYGLRLTAMPIHDPTRDLILLNQQRLSDVEMNL 396          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0110961)

HSP 1 Score: 248.44 bits (633), Expect = 2.403e-130
Identity = 136/379 (35.88%), Postives = 214/379 (56.46%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT-HYTFDILLDMKGFE-KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANI--KRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            MYGLL+  L  +++S+YG + W      A ID  S + H VY E ++ ++      +L  +E D M   G YFV ++   GYD++L VLGR+  DF+ GLDNLHEYL+FSYP+++ PSF  E+ T+  + LHYR+KR GF +Y  GQ+  +A+YFY K++ I L+ + E  + T H TF +  D + F   +L ++   ++ PI   + FEIFPF +V   ++ ++  G     I P LL       F L +P I   ++ I+   N+ FE++ +      P+         ++      S  +  ++ KGQM+ M  W  +MFLGTPV+ D+  L   GL++NDL+  D  +D++LAG+QQS EL    ++++  S K
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVRE-EILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTV-----DPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKK 373          

HSP 2 Score: 238.81 bits (608), Expect = 2.403e-130
Identity = 119/232 (51.29%), Postives = 168/232 (72.41%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            ++KSK+LEE+MR L++  ++TDELLYQ IPK +A RLR+G + +DTC++F SVSI FS +V F +ICS I+  ++V++LN MY+ FD LTE   VYKVETI D+YM+V+GAP     H+  + +MAL M+  A  +LK+P+ +   + + +G HSG +VAGIVG+KMPRYCLFGDTVNT+SRM S     KVH+S+     I    Y   +RGE+++KGKG+M TY++E R+
Sbjct:  368 QQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVD-AITDLKDPS-TGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPN-YKIIERGEIDVKGKGTMGTYWLEERE 596          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0306245)

HSP 1 Score: 248.44 bits (633), Expect = 2.403e-130
Identity = 136/379 (35.88%), Postives = 214/379 (56.46%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT-HYTFDILLDMKGFE-KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANI--KRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            MYGLL+  L  +++S+YG + W      A ID  S + H VY E ++ ++      +L  +E D M   G YFV ++   GYD++L VLGR+  DF+ GLDNLHEYL+FSYP+++ PSF  E+ T+  + LHYR+KR GF +Y  GQ+  +A+YFY K++ I L+ + E  + T H TF +  D + F   +L ++   ++ PI   + FEIFPF +V   ++ ++  G     I P LL       F L +P I   ++ I+   N+ FE++ +      P+         ++      S  +  ++ KGQM+ M  W  +MFLGTPV+ D+  L   GL++NDL+  D  +D++LAG+QQS EL    ++++  S K
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVRE-EILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTV-----DPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKK 373          

HSP 2 Score: 238.81 bits (608), Expect = 2.403e-130
Identity = 119/232 (51.29%), Postives = 168/232 (72.41%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            ++KSK+LEE+MR L++  ++TDELLYQ IPK +A RLR+G + +DTC++F SVSI FS +V F +ICS I+  ++V++LN MY+ FD LTE   VYKVETI D+YM+V+GAP     H+  + +MAL M+  A  +LK+P+ +   + + +G HSG +VAGIVG+KMPRYCLFGDTVNT+SRM S     KVH+S+     I    Y   +RGE+++KGKG+M TY++E R+
Sbjct:  368 QQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVD-AITDLKDPS-TGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPN-YKIIERGEIDVKGKGTMGTYWLEERE 596          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0334926)

HSP 1 Score: 248.054 bits (632), Expect = 2.746e-130
Identity = 136/379 (35.88%), Postives = 214/379 (56.46%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT-HYTFDILLDMKGFE-KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANI--KRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            MYGLL+  L  +++S+YG + W      A ID  S + H VY E ++ ++      +L  +E D M   G YFV ++   GYD++L VLGR+  DF+ GLDNLHEYL+FSYP+++ PSF  E+ T+  + LHYR+KR GF +Y  GQ+  +A+YFY K++ I L+ + E  + T H TF +  D + F   +L ++   ++ PI   + FEIFPF +V   ++ ++  G     I P LL       F L +P I   ++ I+   N+ FE++ +      P+         ++      S  +  ++ KGQM+ M  W  +MFLGTPV+ D+  L   GL++NDL+  D  +D++LAG+QQS EL    ++++  S K
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVRE-EILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTV-----DPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKK 373          

HSP 2 Score: 238.81 bits (608), Expect = 2.746e-130
Identity = 119/232 (51.29%), Postives = 168/232 (72.41%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            ++KSK+LEE+MR L++  ++TDELLYQ IPK +A RLR+G + +DTC++F SVSI FS +V F +ICS I+  ++V++LN MY+ FD LTE   VYKVETI D+YM+V+GAP     H+  + +MAL M+  A  +LK+P+ +   + + +G HSG +VAGIVG+KMPRYCLFGDTVNT+SRM S     KVH+S+     I    Y   +RGE+++KGKG+M TY++E R+
Sbjct:  368 QQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVD-AITDLKDPS-TGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPN-YKIIERGEIDVKGKGTMGTYWLEERE 596          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273397)

HSP 1 Score: 195.282 bits (495), Expect = 7.163e-51
Identity = 104/246 (42.28%), Postives = 153/246 (62.20%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTT-DLHSAHIVEMALSMITCAKK-NLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRL 2025
            +EE  R L+  +++T+ELLYQ +P+ +A++L  G   +   + F SV+I FS +V F ++C+  S   +VN LND+Y+ FD +   Y VYKVETI D+Y++VSG P    D H+  I  MAL ++      NL++  K    I++ IG HSG + AG+VG KMP YCLFGDTVNT+SRM S G P K+HVS      + +F  +   +RG++E+KGKG++TTY++ S   G+      Q L  D +
Sbjct:  844 VEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAG--DLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRH--KPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEGEARPPTPQILTTDEV 1085          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273396)

HSP 1 Score: 194.897 bits (494), Expect = 1.113e-50
Identity = 104/246 (42.28%), Postives = 153/246 (62.20%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTT-DLHSAHIVEMALSMITCAKK-NLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRL 2025
            +EE  R L+  +++T+ELLYQ +P+ +A++L  G   +   + F SV+I FS +V F ++C+  S   +VN LND+Y+ FD +   Y VYKVETI D+Y++VSG P    D H+  I  MAL ++      NL++  K    I++ IG HSG + AG+VG KMP YCLFGDTVNT+SRM S G P K+HVS      + +F  +   +RG++E+KGKG++TTY++ S   G+      Q L  D +
Sbjct:  909 VEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAG--DLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRH--KPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEGEARPPTPQILTTDEV 1150          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 194.512 bits (493), Expect = 2.133e-82
Identity = 99/227 (43.61%), Postives = 147/227 (64.76%), Query Frame = 1
Query: 1285 KSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-SQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            K ++L    R+L   ++K+++LLY  +P  +A +L++G   ++  + F+  +I FS VV F  IC+     +IVN+LN MY+ FD LT ++ VYKVETI D+YM+V G P  T+ H+  +   AL M   A + + NP  +   I++ +G H+G ++AG+VG KMPRYCLFGDTVNT+SRM SHG P+ +HVS   F  I  +  +   +RGE+E+KGKG M TYF+
Sbjct:  419 KKEELRILSRNLEIEKQKSEKLLYAMLPTHVANQLKEG-KRVEAGE-FKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGM-RIAAREVTNPI-TGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFSVIKDKGIFEMAERGEIEVKGKGLMRTYFL 641          

HSP 2 Score: 133.265 bits (334), Expect = 2.133e-82
Identity = 108/427 (25.29%), Postives = 186/427 (43.56%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT----HYTFDILLDMK------------GFEKTLEIS-------------------IPYENFP---IR----------RDMFFEIFPFHLVLSE---------------NLTIQHCGVGFKHICPTLLNS--NFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDEL 1264
            MYG +   L+  V   +G + W + L L     ++  T+ +Y + I  R+V     +L+ + E ++   G YF  +    GYD +LR LG N V+FI+ LD LH YL  SY  +  PSF VE + +  I LHY + R G  H V G +  +AK F++ ++ + ++++ E+  +T    H  F ++   K              E+ LE+                     P +  P   +R          R  F   +P  L + E               +L ++H GV  +   P L  +    ++ F +  P +    + I ++ NS F                LK  +  +  +    Q  +K +GQM+ M   N +++L +P +R +++L+E GL L D+ + DT +D+IL   Q+  E+
Sbjct:    1 MYGFINTCLKSLVIERFGEETW-ENLRLMAGVQETFMTYEIYDDIITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEAMNAPSFRVERMDDGRILLHYYSDRKGLYHIVPGIIEAVAKDFFDSEVTMTILNQSEEDERTGKKEHVVFHMVQKEKVTKRKAQTRQNNSEEEILEVKKDKEETMRRMKARYANLQLCPRKRSPWELVRSIVMLGQGNLRQSFTPSYPKTLWIEEQAFCNAFPFHIVFDSDLVVKHTGVNIQKFVPGLQTAGIRLDEYFTIVHPEVIFNIQSIKKFINSQF---------------VLKTRREMLPEVQQ-NQPTLKLRGQMMWMESLNCMIYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEI 410          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 149.058 bits (375), Expect = 2.965e-73
Identity = 92/244 (37.70%), Postives = 133/244 (54.51%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKS 1977
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +           +++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+
Sbjct:  373 TDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQV----KVDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEY--RGPVTMKGKKEPMKVWFLSRKT 608          

HSP 2 Score: 147.902 bits (372), Expect = 2.965e-73
Identity = 110/382 (28.80%), Postives = 179/382 (46.86%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTE-STIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKI--------------FLISKIEDSYQTHYTFDILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNS--NFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG D+W      A++D +       +Y +     +V A S +L      I+   G  F E+    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      + + + LHY ++R G Q  V G +  +A+  +  +I++              FLI + +   +  Y      D+ GFE+  T E  I PY         F + FPFHL+  ++L +  CG     + P L     N +  F L +P ID ++  I+ + N+ F +     +  G LN    +   N   L+      ++ KGQM+ +P    ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFLIEEKDSEEEAFYE-----DLDGFEENGTQETRISPY--------TFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVL----RSKEGLLNVETAE---NEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 149.443 bits (376), Expect = 8.332e-72
Identity = 92/244 (37.70%), Postives = 133/244 (54.51%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKS 1977
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +           +++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+
Sbjct:  367 TDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQV----KVDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEY--RGPVTMKGKKEPMKVWFLSRKT 602          

HSP 2 Score: 143.28 bits (360), Expect = 8.332e-72
Identity = 107/375 (28.53%), Postives = 175/375 (46.67%), Query Frame = 2
Query:  200 ALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTE-STIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKI--------------FLISKIEDSYQTHYTFDILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNS--NFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            AL+  V   YG D+W      A++D +       +Y +     +V A S +L      I+   G  F E+    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      + + + LHY ++R G Q  V G +  +A+  +  +I++              FLI + +   +  Y      D+ GFE+  T E  I PY         F + FPFHL+  ++L +  CG     + P L     N +  F L +P ID ++  I+ + N+ F +     +  G LN    +   N   L+      ++ KGQM+ +P    ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    2 ALELLVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFLIEEKDSEEEAFYE-----DLDGFEENGTQETRISPY--------TFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVL----RSKEGLLNVETAE---NEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 356          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 187.963 bits (476), Expect = 6.240e-49
Identity = 101/232 (43.53%), Postives = 149/232 (64.22%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESR-KSGD 1983
            +EE  +   + ++K + LLYQ +P S+A++L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     LH   I  M+L+++  A K  K   +    ++L IG HSG + AG+VG+KMPRYCLFGDTVNTSSRM S+G P K+HVS      + +F  +    RG++E+KGKG M TY++    K+GD
Sbjct:  589 VEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQ--AEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLE-AVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGEVKAGD 817          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 187.193 bits (474), Expect = 4.018e-48
Identity = 101/232 (43.53%), Postives = 149/232 (64.22%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESR-KSGD 1983
            +EE  +   + ++K + LLYQ +P S+A++L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     LH   I  M+L+++  A K  K   +    ++L IG HSG + AG+VG+KMPRYCLFGDTVNTSSRM S+G P K+HVS      + +F  +    RG++E+KGKG M TY++    K+GD
Sbjct:  837 VEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQ--AEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLE-AVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGEVKAGD 1065          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 149.058 bits (375), Expect = 1.015e-70
Identity = 93/247 (37.65%), Postives = 136/247 (55.06%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+      VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+ +
Sbjct:  373 TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY--RGPVSMKGKTDPMQVWFLSRKAAE 610          

HSP 2 Score: 140.198 bits (352), Expect = 1.015e-70
Identity = 106/377 (28.12%), Postives = 179/377 (47.48%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V+A + +LN    DI+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D   FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N N    F L +P ID ++  I+ + N+ F +     +  G L+    + +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPY--------TFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDVEKSESE---DELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 148.673 bits (374), Expect = 1.356e-70
Identity = 93/247 (37.65%), Postives = 136/247 (55.06%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+      VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+ +
Sbjct:  373 TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY--RGPVSMKGKTDPMQVWFLSRKAAE 610          

HSP 2 Score: 140.198 bits (352), Expect = 1.356e-70
Identity = 106/377 (28.12%), Postives = 179/377 (47.48%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V+A + +LN    DI+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D   FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N N    F L +P ID ++  I+ + N+ F +     +  G L+    + +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPY--------TFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDVEKSESE---DELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 148.288 bits (373), Expect = 1.906e-70
Identity = 93/246 (37.80%), Postives = 136/246 (55.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGK-GSMTTYFIESRKS 1977
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+      VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK   M  +F+  + S
Sbjct:  373 TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY--RGPVSMKGKTDPMQVWFLSRKNS 609          

HSP 2 Score: 140.198 bits (352), Expect = 1.906e-70
Identity = 106/377 (28.12%), Postives = 179/377 (47.48%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V+A + +LN    DI+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D   FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N N    F L +P ID ++  I+ + N+ F +     +  G L+    + +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPY--------TFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDVEKSESE---DELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 148.673 bits (374), Expect = 3.118e-67
Identity = 93/247 (37.65%), Postives = 136/247 (55.06%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+      VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+ +
Sbjct:  391 TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY--RGPVSMKGKTDPMQVWFLSRKAAE 628          

HSP 2 Score: 129.028 bits (323), Expect = 3.118e-67
Identity = 106/395 (26.84%), Postives = 179/395 (45.32%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQ------------------GLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLIS-KIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V+A + +LN    DI+   G  F  +    GYD ILRVLG N  +F+Q                   LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D   FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N N    F L +P ID ++  I+ + N+ F +     +  G L+    + +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQHFIYIIDKKACFLLFPINNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPY--------TFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDVEKSESE---DELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 380          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 148.673 bits (374), Expect = 3.087e-62
Identity = 93/247 (37.65%), Postives = 136/247 (55.06%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+      VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRK+ +
Sbjct:  357 TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQY--RGPVSMKGKTDPMQVWFLSRKAAE 594          

HSP 2 Score: 112.464 bits (280), Expect = 3.087e-62
Identity = 97/376 (25.80%), Postives = 167/376 (44.41%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLIS-KIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V+A + +LN    DI+   G  F  +    GYD ILRVLG N  +F+Q               ++ P           + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D   FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N N    F L +P ID ++  I+ + N+ F +     +  G L+    + +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQ---------------VRKPFIFYYCFKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPY--------TFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDVEKSESE---DELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 346          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 149.058 bits (375), Expect = 1.034e-70
Identity = 92/242 (38.02%), Postives = 135/242 (55.79%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK      +  SRK
Sbjct:  373 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPLFHLEHRGPVSMKGKKEPMQVWFLSRK 607          

HSP 2 Score: 139.813 bits (351), Expect = 1.034e-70
Identity = 107/378 (28.31%), Postives = 180/378 (47.62%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLL--NSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIK-RLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   NL +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+     +K   +  L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLDV----EKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 144.436 bits (363), Expect = 2.586e-69
Identity = 85/214 (39.72%), Postives = 124/214 (57.94%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVD----KIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-SQFPYN 1902
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  + S  P+ 
Sbjct:  373 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRKLGSTVPFG 579          

HSP 2 Score: 139.428 bits (350), Expect = 2.586e-69
Identity = 106/377 (28.12%), Postives = 178/377 (47.21%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   NL +  CG     + P L   N +    F L +P ID ++  I+ + N+ F  +L        +     +D+     +S      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVF--VLRSKEGLLDVEKLECEDELTGAEISC-----LRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 191.045 bits (484), Expect = 6.533e-50
Identity = 105/236 (44.49%), Postives = 149/236 (63.14%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKF-------RKKTDELLYQCIPKSIAKRLRKG--VSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            E S QLE+   +L          +KKT+ LLY  +P+ +A +L++G  V++ +    F++ +I FS VV F  IC+     +IVN+LN MY+ FD LT ++ VYKVETI D+YM+V G P   + H+  +   AL M   AK+ + NP  +   I++ +G H+G ++AG+VG KMPRYCLFGDTVNT+SRM SHG PNKVH+S      +    +    RGE+E+KGKG MTTYF+
Sbjct:  477 ELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGE----FETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVM-NPV-TGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFL 706          

HSP 2 Score: 154.451 bits (389), Expect = 4.600e-38
Identity = 120/423 (28.37%), Postives = 191/423 (45.15%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT----HYTFDI-------LLDMKGFEKTL------EISIPY-------------------------------ENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN-DE-FILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMEL---FEKKR 1288
            MYG +   LQ  V   +G + W +    AE+      T++VY +TI  +++      L+ + E I+   G YF ++    GYD++LR LG N  +FI+ LD LH YL  SY ++  PSF VE   +  ++LHY + R G  H V G +  +AK F++ D+ + ++   E+  +T    H  F +       +   K  + TL       +SIP                                E   I  ++F   FPFH+V  E L ++  GV  +   P +L   F  DE F +  P +      I ++ NS F  IL       P   A K             Q  +K +GQM+ M     ++F+ +P +R +++L+E+ + L+D+   DT +D+IL   Q+  E MEL    EKK+
Sbjct:   82 MYGFINTCLQSLVTEKFGEETWEKLKASAEVQ-DVFMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEVERTGKKEHVVFLVVQKARRQIRGAKSLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNISSICKFINSQF--ILKTRREMMP--EAWKS------------QPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAE-MELSCQLEKKK 486          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 191.045 bits (484), Expect = 7.320e-50
Identity = 105/236 (44.49%), Postives = 149/236 (63.14%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKF-------RKKTDELLYQCIPKSIAKRLRKG--VSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            E S QLE+   +L          +KKT+ LLY  +P+ +A +L++G  V++ +    F++ +I FS VV F  IC+     +IVN+LN MY+ FD LT ++ VYKVETI D+YM+V G P   + H+  +   AL M   AK+ + NP  +   I++ +G H+G ++AG+VG KMPRYCLFGDTVNT+SRM SHG PNKVH+S      +    +    RGE+E+KGKG MTTYF+
Sbjct:  492 ELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGE----FETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVM-NPV-TGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFL 721          

HSP 2 Score: 142.124 bits (357), Expect = 3.991e-34
Identity = 116/438 (26.48%), Postives = 191/438 (43.61%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT----HYTFDILLDMKGFEKTLEISIPY--ENFPIRR------------------------------------------DMFFEIFP---------------FHLVLSENLTIQHCGVGFKHICPTLLNSNFN-DE-FILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMEL---FEKKR 1288
            MYG +   LQ  V   +G + W +    AE+      T++VY +TI  +++      L+ + E I+   G YF ++    GYD++LR LG N  +FI+ LD LH YL  SY ++  PSF VE   +  ++LHY + R G  H V G +  +AK F++ D+ + ++   E+  +T    H  F ++   +   +  +++ P   EN   ++                                          D F  +FP               FH+V  E L ++  GV  +   P +L   F  DE F +  P +      I ++ NS F  IL       P   A K             Q  +K +GQM+ M     ++F+ +P +R +++L+E+ + L+D+   DT +D+IL   Q+  E MEL    EKK+
Sbjct:   82 MYGFINTCLQSLVTEKFGEETWEKLKASAEVQ-DVFMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEVERTGKKEHVVFLVVQKARRQIRGAKVNRPRDSENIQAKQESLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNISSICKFINSQF--ILKTRREMMP--EAWKS------------QPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAE-MELSCQLEKKK 501          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 181.03 bits (458), Expect = 1.448e-47
Identity = 94/232 (40.52%), Postives = 146/232 (62.93%), Query Frame = 1
Query: 1291 KQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPS-TTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFP-YNYTKRGEMEIKGKGSMTTYFIESRKSG 1980
            K +EE  +   + ++K + LLYQ +P S+A++L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P      H+  I  MAL+++  A  + +   +    + L IG H+G + AG+VG+KMPRYCLFGDTVNT+SRM S+G   K+HVS    + + +   +    RG++E+KGKG M TY++   + G
Sbjct:  380 KLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQ--AEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLD-AVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKG 608          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8INF0|GCY8E_DROME (Soluble guanylate cyclase 88E OS=Drosophila melanogaster OX=7227 GN=Gyc88E PE=1 SV=4)

HSP 1 Score: 248.44 bits (633), Expect = 1.849e-129
Identity = 136/379 (35.88%), Postives = 214/379 (56.46%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT-HYTFDILLDMKGFE-KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANI--KRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            MYGLL+  L  +++S+YG + W      A ID  S + H VY E ++ ++      +L  +E D M   G YFV ++   GYD++L VLGR+  DF+ GLDNLHEYL+FSYP+++ PSF  E+ T+  + LHYR+KR GF +Y  GQ+  +A+YFY K++ I L+ + E  + T H TF +  D + F   +L ++   ++ PI   + FEIFPF +V   ++ ++  G     I P LL       F L +P I   ++ I+   N+ FE++ +      P+         ++      S  +  ++ KGQM+ M  W  +MFLGTPV+ D+  L   GL++NDL+  D  +D++LAG+QQS EL    ++++  S K
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVRE-EILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTV-----DPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKK 373          

HSP 2 Score: 238.81 bits (608), Expect = 1.849e-129
Identity = 119/232 (51.29%), Postives = 168/232 (72.41%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            ++KSK+LEE+MR L++  ++TDELLYQ IPK +A RLR+G + +DTC++F SVSI FS +V F +ICS I+  ++V++LN MY+ FD LTE   VYKVETI D+YM+V+GAP     H+  + +MAL M+  A  +LK+P+ +   + + +G HSG +VAGIVG+KMPRYCLFGDTVNT+SRM S     KVH+S+     I    Y   +RGE+++KGKG+M TY++E R+
Sbjct:  368 QQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVD-AITDLKDPS-TGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPN-YKIIERGEIDVKGKGTMGTYWLEERE 596          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86C56|GCY31_CAEEL (Soluble guanylate cyclase gcy-31 OS=Caenorhabditis elegans OX=6239 GN=gcy-31 PE=2 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 4.021e-98
Identity = 124/391 (31.71%), Postives = 211/391 (53.96%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFE------KTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLN---------AALKKDKANIKRLSSIVQGRIKF---KGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL++  +  +++  YG   W +   ++ +   +      ++E +  +++ A   +  +  +++M + G  F ++L+   ++K+LRVLGR F  F+ GLDNLHEYLRF++PK+KPPSF  E  + + + LHYR+KR GF HYV+GQ+ NI++  ++ ++ I L+    D    H    +  +   F       + L  SI  E   I  D+FF+IFPF +V +  + I++ G+G   +   ++    N  F+L +PFI   +E+I+ ++N+ FE+I     SS P+               D+   +R       R KF   KGQM  M  W  + F+G PV+  + Q+ ++GLF+ND    D+ +D++LA +QQS EL  L  ++   S
Sbjct:    1 MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGDPVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSI-LEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELI-----SSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKS 385          

HSP 2 Score: 189.504 bits (480), Expect = 4.021e-98
Identity = 95/233 (40.77%), Postives = 152/233 (65.24%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFP---YNYTKRGEMEIKGKGSMTTYFIESR 1971
            +KS+ + ENM  L K R++TD+LLYQ +PKS+A +LR G S++  C+ F SV+I F+ +V+F ++CS ++  +++  L  +YT+FD + + + VYKVETI D+YM+VSGAP+ T+  +  I++ A   +  A K + N       I++  G HSG +VAG+VG+ MPRYCLFG+TV  +++M  + SP K+ VS+     I +     Y + +R E+EIK   ++ T+F+ SR
Sbjct:  383 QKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGK-MVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSR 614          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|P90895|GCY33_CAEEL (Soluble guanylate cyclase gcy-33 OS=Caenorhabditis elegans OX=6239 GN=gcy-33 PE=2 SV=4)

HSP 1 Score: 206.453 bits (524), Expect = 4.659e-86
Identity = 120/389 (30.85%), Postives = 205/389 (52.70%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYEN----FPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEI-ILMPHTSSGPLNAALK-----KDKANIKRLSSIVQGR------IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL++  ++  ++  +G  + +Q   L  +  +S++TH  Y+E ++P++  A+  I     E I    G +FV++L   GY  ++ V+GR F DFI+GLDN+HEY RFSYPK++ PSF  +S +E  + LHYR++R G+  YV GQLV +A+ FY+ DI I ++ K E    T     I  D  G  + L++    +N     P+    F ++FPFH+  ++ L I   G G  ++ P +      D F L +P I  T E I+ + N  F+I  L P       N  ++     +DK ++++  +++         +  +G +  +      + L T V+  +  + + GL+LND  + D  ++II+A  Q+SD L  + E ++  S
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEK-KTVMDNEYESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRS 388          

HSP 2 Score: 136.346 bits (342), Expect = 4.659e-86
Identity = 83/242 (34.30%), Postives = 137/242 (56.61%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRM-MSHGSPNKVHVSDIFFEHI---SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYK 1992
            K +S+ L E  R++++ +K    LL Q +P  +A+ + +   S+D C+ F+ VSI F +V DF +I   I   ++VNLLN +Y+H D++ + + VYKVETI +SYM+ +G P   D  +  + +  L M++  K        +   + +  G  +G +V G+VG++ PRYCLFGDTVNT+SRM  S+ +P  + +     + +   +   +    +G + +KGKG M  Y IE +K    YK
Sbjct:  385 KRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRS-GSVDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIEKKKGRARYK 625          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|O75343|GCYB2_HUMAN (Guanylate cyclase soluble subunit beta-2 OS=Homo sapiens OX=9606 GN=GUCY1B2 PE=5 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 4.553e-76
Identity = 110/236 (46.61%), Postives = 152/236 (64.41%), Query Frame = 1
Query: 1282 EKSKQLE---ENMRDLNKF----RKKTDELLYQCIPKSIAKRLRKG--VSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            E S QLE   E ++ L+K     +KKT+ LLY  +PK +A +LR+G  V++ +    F+S +I FS VV F  IC+     +IVN+LN MY+ FD LT ++ VYKVETI D+YM+V G P     H+  +   AL M   AK+ + NP  +   I+L +G H+G ++A +VG KMPRYCLFGDTVNT+SRM SHG PNKVH+S   +  +    +   +RGE+E+KGKG MTTYF+
Sbjct:  334 ELSNQLERKKEELQVLSKHLAIEKKKTETLLYAMLPKHVANQLREGKKVAAGE----FKSCTILFSDVVTFTNICTACEPIQIVNVLNSMYSKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKE-VTNPV-TGEPIQLRVGIHTGPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQGFKIIERGEIEVKGKGRMTTYFL 563          

HSP 2 Score: 105.531 bits (262), Expect = 4.553e-76
Identity = 87/347 (25.07%), Postives = 145/347 (41.79%), Query Frame = 2
Query:  419 GYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQT----HYTFDI---------------LLDMKGFEKTLEI----------------SIPY----------------------------ENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSN--FNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDEL 1264
            GYD++LR LG N ++FI+ LD LH YL  SY ++  PSF VE   +  + LHY + R G  H V G +  +AK F++ D+ + ++   E+  +T    H  F I               L D +G E+  E                 + P                             E   I    F   FPFH+V  E+L ++   V  +   P L   N   ++ F +  P +      I R+ NS F +                K +  +  ++   +  +K +GQM+ M     +++L +P +R +++L+E  + L+D+   DT +D+IL   Q+  E+
Sbjct:    3 GYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERGADGKMFLHYYSDRSGLCHIVPGIIEAVAKDFFDIDVIMDILDMNEEVERTGKKEHVVFLIVQKAHRKMRKTKPKRLQDSQGMERDQEALQAAFLKMKEKYLNVSACPVKKSHWDVVRSIVMFGKGHLMNTFEPIYPERLWIEEKTFCNAFPFHIVFDESLQVKQARVNIQKYVPGLQTQNIQLDEYFSIIHPQVTFNIFSIRRFINSQFVL----------------KTRREMMPVAWQSRTTLKLQGQMIWMESMWCMVYLCSPKLRSLQELEELNMHLSDIAPNDTTRDLILLNQQRLAEI 333          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|P16068|GCYB1_BOVIN (Guanylate cyclase soluble subunit beta-1 OS=Bos taurus OX=9913 GN=GUCY1B1 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 7.856e-71
Identity = 93/247 (37.65%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-----SQFPYNYTKRGEMEIKGKG-SMTTYFIESRKSGDE 1986
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +      +  G S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +     S   ++   RG + +KGK   M  +F+  + +G E
Sbjct:  373 TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQ-----VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTE 612          

HSP 2 Score: 139.043 bits (349), Expect = 7.856e-71
Identity = 106/377 (28.12%), Postives = 181/377 (48.01%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTEST-IKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLI-SKIEDSYQTHYTF--------DILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFN--DEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  AL+  V   YG ++W      A++D +       +Y ++    +V A S +LN    +I+   G  F  +    GYD ILRVLG N  +F+Q LD LH++L   YP ++ PSF      +   + LHY ++R G Q  V G +  +A+  +  +I + +I  + E+   T +          D   D+  FE+  T E  I PY         F + FPFH++   +L +  CG     + P L   N +    F L +P ID ++  I+ + N+ F +     +  G L+  ++K +     L+      ++ KGQM+ +P  + ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDADKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPY--------TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVL----RSKEGLLD--VEKSECE-DELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A094ZRS7 (Soluble guanylate cyclase 88E OS=Schistosoma haematobium OX=6185 GN=MS3_05179 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 5.473e-147
Identity = 134/243 (55.14%), Postives = 176/243 (72.43%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGS------------IELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESR 1971
            ++KS++LE++M+ L+K RK TD LLYQCIP+++A++LR G  + +T + + SVSICF+KV +F   C   SVD+IV LLN MYT FD+LTE   VYKVET+ DSYMLVSGAP+ T  HSAHI EMAL+++     +L  P KS+ S            ++L IGCH+G IVAGIVG K PRYCLFGDTVNT+SRMMS G P+++HVS +F  H+S+FPY    RGE+++KGKG M TYF+  R
Sbjct:  364 RKKSEELEKSMKHLDKMRKLTDRLLYQCIPRAVARKLRDGTPANETIETYDSVSICFTKVFNFCAKCMNTSVDQIVELLNKMYTLFDDLTEASNVYKVETVGDSYMLVSGAPNKTRFHSAHITEMALNILKVTHASLAWP-KSNDSKDNTGNEDEKEVLKLFIGCHTGPIVAGIVGHKTPRYCLFGDTVNTASRMMSSGVPDRIHVSQMFAAHLSEFPYILEYRGEIDVKGKGKMRTYFVNGR 605          

HSP 2 Score: 273.092 bits (697), Expect = 5.473e-147
Identity = 143/378 (37.83%), Postives = 231/378 (61.11%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISK--IEDSYQTHYTFDILLDMKGFE-KTLEISIPYENF--PIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGL+V  +Q++VES+YG D+W + +  + I   +  TH+ Y++T+  R+  A S    E+ E++ +  G  F  ++S  GY+ +LRV GR+F+ F+  LDNLHEYLR SYP I+PPSF++ + T   I+L Y +KR G+ HYVRGQL+ +AK  Y+ DIK+ LIS   I + YQT Y    L   +  + +   I  P +++   I  ++FF+IF F L+++  + I+     F+ +  +L  S+FN++F+L +PFI +  E+I  + ++ FE++L+        N  L K+       S + +   KF+G+M  +  W+ L+FLG P IRD++ L E GL++ DLN FD  +D+I+ G Q S+EL++LF+ +R  S
Sbjct:    1 MYGLIVIGIQNYVESIYGEDVWFRIVEKSNIGLLTFQTHNTYSDTVPERLFLAFSHETGESIENVTYQTGLSFAAFISDYGYENLLRVQGRDFISFLHNLDNLHEYLRLSYPDIQPPSFSIINATNDCIRLKYSSKRNGYIHYVRGQLITLAKRLYDLDIKVILISTKIINNIYQTIYDIYALNGKRWIDPQNYYIQKPLDSWGDTISSNVFFDIFAFSLLITNQMKIKRASTSFRKLDSSLEGSDFNEKFLLFRPFIKSNIEEIKLHMHNTFELVLIK-------NLCLNKNNDR----SMLGKAECKFRGEMRFVEQWDMLLFLGAPSIRDIRHLNEHGLYICDLNMFDRSRDVIICGDQISNELVKLFQMQRKKS 367          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A4S2LM39 (Guanylate cyclase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007801 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 2.103e-143
Identity = 131/238 (55.04%), Postives = 175/238 (73.53%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKS-----------SGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            E+SKQLE++M+ + K RK TDELLYQCIPK +A++LR G  +++T Q F+SVS+CF+KVV+F   C +ISV++++ LLN+MYT FD LTE +KVYKVETI DSYMLVSGAP  T +H+AHI EMA+ MI   +  L  P  +           +  ++L +GC++G IVAG+VG K PRYCLFGDTVNT+SRMMS G P+K+HVS+ F E +S++PY    RG+  +KGKG M TYF+
Sbjct:  368 EESKQLEKSMKRVEKMRKITDELLYQCIPKGVAQKLRSGTPALETIQTFESVSVCFTKVVNFGAKCMQISVEEVIQLLNNMYTIFDALTESHKVYKVETIGDSYMLVSGAPQRTPMHAAHITEMAMEMIVATQHGLSWPHTAQQNTNERRHSLAEHVQLFVGCNTGPIVAGVVGYKTPRYCLFGDTVNTASRMMSTGVPDKIHVSNSFAEALSKYPYILELRGKTVVKGKGEMETYFV 605          

HSP 2 Score: 257.684 bits (657), Expect = 2.103e-143
Identity = 144/380 (37.89%), Postives = 228/380 (60.00%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIW---IQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLD-----MKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPL-WNG--LMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKK 1285
            MYGLL+  +QHF+E+ YG  IW   +    L  +DYQ   T  +Y+ET+I R++ ALS       ED+++ NG  F  + +  GY+K+LRV GR+F+  ++ LDNLHE+LRFSYPKI+PPSF   + T  +IKL Y +KR G++HYVRGQL+N+AK F+  +I + LIS+  +    H  ++I  D     + G + T + ++P  +  +  D FF I  F ++++ ++ IQ     F      L  S F+++F++ +P+ +A +E+I  + ++ FE++L+        +A L+ D+      S+    +I    Q+   PL W G  L  +    +RD KQL + GL+++DLN FD  +DIIL+G QQSDELM+LF+K+
Sbjct:    1 MYGLLIVGVQHFIETYYGQHIWPLVVARAGLTTLDYQ---TQKIYSETVIERLMVALSQETGRNVEDLLYQNGLSFAAFTADYGYEKLLRVQGRSFIHLLRNLDNLHEHLRFSYPKIRPPSFFTVTETVDSIKLVYSSKRVGYEHYVRGQLINLAKRFFNLNITVTLISRWMEGLVHHVMYEITHDGRTWGLPGGDYT-QTTLPTWSPTLHSDDFFSIVSFFILITPSMIIQRASESFNQFDNELEGSVFSEKFLIGRPYTNANFEEIKLHRHNTFELVLVS-------DANLQSDRGKKSNASTCFCSKIL---QICSEPLTWFGAELGRMCFTKLRDTKQLADCGLYISDLNLFDRSRDIILSGDQQSDELMKLFKKQ 366          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1S8X7N9 (Heme NO binding protein OS=Opisthorchis viverrini OX=6198 GN=X801_01344 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 2.731e-141
Identity = 131/238 (55.04%), Postives = 175/238 (73.53%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGS-----------IELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            E+SKQLE++M+ + K RK TDELLYQCIPK +A++LR G  +++T Q F+SVS+CF+KVV+F   C +ISV++++ LLN+MYT FD LTE +KVYKVET+ DSYMLVSGAP  T +H+AHI EMA+ MI   +  L  P  +  S           ++L +GC++G IVAG+VG K PRYCLFGDTVNT+SRMMS G P+K+HVS+ F E +S++PY    RG+  +KGKG M TYF+
Sbjct:  623 EESKQLEKSMKRVEKMRKITDELLYQCIPKGVAQKLRSGTPALETIQTFESVSVCFTKVVNFGAKCMQISVEEVIQLLNNMYTIFDALTESHKVYKVETVGDSYMLVSGAPQRTPMHAAHITEMAMEMIVATQHGLSWPQTAQKSANERRHSLTEHVQLFVGCNTGPIVAGVVGYKTPRYCLFGDTVNTASRMMSTGVPDKIHVSNSFAEALSKYPYIVELRGKTVVKGKGEMETYFV 860          

HSP 2 Score: 250.751 bits (639), Expect = 2.731e-141
Identity = 138/374 (36.90%), Postives = 214/374 (57.22%), Query Frame = 2
Query:  200 ALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDIL--------LDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
             L+ ++   +  ++W  A+       + I T  +Y E+++PR+V+ +S I + +E+DI F  GC+F  YL+  GY  +LRV+G  F  F+  LD+LH +L+FSYP+IKPPSF V  +T++T+ + Y +KR  F  +VRGQL  IA   Y+ D+++ +   +++     Y + I            K  +KT   S    +  I    FF +F FHL+ +ENL I   G G+      ++     D F L +P ID T+ +I  + ++ FE++L+        +  L+K   N  R  S+ Q   KFKGQM  +  WN ++FLGTPV+RD KQL + GL+++DLN FD  +DIIL+G QQSDELM+LF+K+   S
Sbjct:  264 GLKQYLTKAFSEELWWSAILHVTGKRKVIQTRQIYPESLLPRLVSYVSEITDLSEDDIFFEYGCFFTHYLTDSGYYSLLRVIGEGFPQFMNELDDLHYHLQFSYPRIKPPSFVVAEMTDTTMIIVYVSKRNSFPQFVRGQLTAIAALLYDLDVEVEITDCVKELTTHKYIYRITNKGGEWPKGKCKDIDKTQHDS--SASLHICSQPFFRLFRFHLLFTENLYITSVGEGYNQFGAVVVEKLLTDIFFLHRPKIDLTFSEIKLHRHNTFELVLVS-------DVNLQK---NAGRGVSLSQAACKFKGQMCYIEEWNMILFLGTPVLRDTKQLADCGLYISDLNLFDRSRDIILSGDQQSDELMKLFKKQLEES 625          

HSP 3 Score: 197.593 bits (501), Expect = 4.865e-48
Identity = 104/267 (38.95%), Postives = 163/267 (61.05%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIW---IQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMK-----GFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEK 955
            MYGLL+  +QHF+E+ YG  +W   +    L  +DYQ   T  +Y+ETII R++ ALS     + E++ + NG  F  +    GY+K+LRV GR+F+  ++ LDNLHE+LRFSYPKI+PPSF   + T  +IKL Y +KR G++HYVRGQLVN+AK F+  +I + LIS+  +    H  ++I  D K     G + T + ++P  +  +  D FF +  F ++++  + IQ     F      L  S F+++F++ +P+I+AT+E+
Sbjct:    1 MYGLLIVGVQHFIETYYGQHVWPLVVARAGLTTLDYQ---TQKIYSETIIERLMVALSQETGRSVEELRYQNGLSFAAFTVEYGYEKLLRVQGRSFIHLLRNLDNLHEHLRFSYPKIRPPSFFTVTETVDSIKLVYSSKRVGYEHYVRGQLVNLAKRFFNLNITVTLISRRMEGLVHHVMYEITHDGKTWGLPGGDYT-QTTLPTWSPTLHSDEFFGVVSFFILITPTMIIQRASESFNRFDNELEGSVFSEKFLIGRPYINATFEE 263          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A4E0S2T5 (Soluble guanylate cyclase 88E OS=Fasciola hepatica OX=6192 GN=D915_001078 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.698e-139
Identity = 141/244 (57.79%), Postives = 183/244 (75.00%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAK-------SSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYK 1992
            E+SKQLE++M+ ++K RK TDELLYQCIPK++A++LR G  +M+T Q F SVSICF+KVV+F   C +I V++I++LLN MYT FD LTE +KVYKVETISDSYM+VSGAP  T LH+AHI EMAL ++   +  L  P+        S   ++L +GCH+G IVAG+VG K PRYCLFGDTVNTSSRMMS+G P+++HVS+ F   +S +PY    RGEM+IKGKG+M TYF+  RK   +YK
Sbjct:  341 EESKQLEKSMKRVDKMRKMTDELLYQCIPKAVARKLRNGTPTMETIQAFDSVSICFTKVVNFAARCMKIEVNQIISLLNSMYTLFDALTETHKVYKVETISDSYMIVSGAPQRTPLHAAHITEMALVILDATRTGLGWPSPDGMARRNSMDPLQLFVGCHTGPIVAGVVGYKTPRYCLFGDTVNTSSRMMSNGVPDRIHVSNTFASALSLYPYEVELRGEMQIKGKGAMKTYFVTGRKDNFQYK 584          

HSP 2 Score: 220.32 bits (560), Expect = 2.698e-139
Identity = 131/389 (33.68%), Postives = 212/389 (54.50%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKG---------FEKTLE---------ISIPYENFPIRRDMFFEIFPFHLVLSENLTI--QHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKK 1285
            MYG+ +  L+ +VE ++G D+W   +       + I T  VY ++    ++++LS +++  +++I+F  G YF++YL   G++ +L VLG  FV+F+  +D+LH  L+FSYP+I+ P+F V   TE+ I+L Y +KR  F+H+VRGQL+ IA+ FY+ D+ +  I  IE    +     ++ +  G          E+TL+          S+    F +R + FF +FP+ LV+S+++ I   HC                                    YN   FE++L+  T  G LN           R+ S+ Q   KFKGQM  +  W+ L+FLG+PVIRD KQL E GL+++DLN FD+ ++I++ G +QSDELM+LF+K+
Sbjct:    1 MYGVFIEGLKQYVEKVFGTDVWWAMVMQVSGQRKVIQTLQVYGDSFYSELLDSLSELISVPKDEILFEVGSYFIQYLIDIGFNSLLHVLGTEFVNFLHNVDDLHHQLQFSYPRIRAPAFVVLQKTETEIRLLYESKRTMFEHFVRGQLITIAQAFYDLDVDVD-IESIEKHGNSQKVVLVIRNKNGEWPDDIKRKREETLKEQQELDADAASLKPSTF-LRSESFFSLFPYFLVISQSMEIIKIHC------------------------------------YN--TFELVLV--TDPGLLNTT--------DRVVSLSQATCKFKGQMSYVAEWDMLLFLGSPVIRDTKQLSECGLYISDLNMFDSSREIVMRGEEQSDELMKLFKKQ 339          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A504YE80 (Soluble guanylate cyclase 88E OS=Fasciola gigantica OX=46835 GN=FGIG_10903 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.322e-138
Identity = 137/243 (56.38%), Postives = 179/243 (73.66%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAK-------SSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEY 1989
            E+SKQLE++M+ ++K RK TDELLYQCIPK++A++LR G  +M+T   F SVSICF+KVV F   C +I V++I++LLN MYT +D LTE +KVYKVETI DSYM+VSGAP  T LH+AHI EMAL ++   +  L  P+        S   ++L +GCH+G IVAG+VG K PRYCLFGDTVNTSSRMMS+G P+++HVS+ F   +S +PY    RGEM+IKGKG+M TYF+  RK   +Y
Sbjct:  341 EESKQLEKSMKRVDKMRKMTDELLYQCIPKAVARKLRNGTPTMETIHAFDSVSICFTKVVSFAARCMKIEVNQIISLLNSMYTLYDALTETHKVYKVETIGDSYMIVSGAPQRTPLHAAHITEMALVILDATRTGLGWPSPDGMARRNSMDPLQLFVGCHTGPIVAGVVGYKTPRYCLFGDTVNTSSRMMSNGVPDRIHVSNTFASALSLYPYEVELRGEMQIKGKGAMKTYFVTGRKENFQY 583          

HSP 2 Score: 225.328 bits (573), Expect = 1.322e-138
Identity = 134/389 (34.45%), Postives = 213/389 (54.76%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKG---------FEKTLE---------ISIPYENFPIRRDMFFEIFPFHLVLSENLTI--QHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKK 1285
            MYG+ +  L+ +VE ++G D+W   +       + I T  VY ++   ++++ LS  +   +++I+F  G YF++YL   G++ +L VLG  FVDF+  +D+LH  L+FSYP+I+ P+F V   TE+ I+L Y +KR  F+H+VRGQL++IA+ FY+ D+++  I  IE    +   F ++ +  G          E+TL           S+    F +R + FF +FP++LV+S+++ I   HC                                    YN   FE++L+  T  G LN A         R  S+ Q   KFKGQM  +  W+ L+FLG+PVIRD KQL E GL+++DLN FD+ ++I++ G +QSDELM+LF+K+
Sbjct:    1 MYGVFIEGLKQYVEKVFGTDVWWAIVMQVSGQRKVIQTLQVYGDSFYSQLLDTLSESIGVPKDEILFEVGSYFIQYLIDIGFNSLLHVLGTEFVDFLHNVDDLHHQLQFSYPRIRAPAFVVLQKTETEIRLLYESKRTMFEHFVRGQLISIAQAFYDLDVEVD-IESIEKQGNSQKVFLVIRNKNGEWPDDIKRKREETLREQEELDADAASLKPSTF-LRGESFFSLFPYYLVISQSMEIIRIHC------------------------------------YN--TFELVLV--TDPGLLNQA--------DRAVSLSQATCKFKGQMSYVAEWDMLLFLGSPVIRDTKQLSECGLYISDLNMFDSSREIVMRGEEQSDELMKLFKKQ 339          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045584.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103027224])

HSP 1 Score: 268.855 bits (686), Expect = 8.826e-132
Identity = 142/412 (34.47%), Postives = 224/412 (54.37%), Query Frame = 2
Query:  164 TIPIEMYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEK-TLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMP-------------------HTSSGPLNAALK----------KDKANIKRLSSIVQGR--IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            ++ + MYGLL  +L  F++  YG D+W      A++   S  TH VY+E++IPRI  A S +      ++M   G YF+ ++   GYD+IL+VLGR+  DF+ GLDNLHEYLRFSYPK++PP+F  +  + + + LHYR+KR G+ HY  GQL  + K FY+ DI + ++S+      +H T  +  D   +     E     E  PI  D FFE+FPF++V  +++ + + G G   + P L     ND F+L++P ++ T+  I+ + N+ FEI+                         S  ++  L           KD  +   + S   G   +K KGQM  MP W  ++FLGTPV+  +  + + GL++NDL+  D+ +D++LAG+QQS+EL     +++  S K
Sbjct:   30 SLSVSMYGLLCESLHDFIKESYGDDVWKLVRERADVRLHSFVTHQVYSESVIPRIAKAASGVTGTPYNELMNSWGVYFLGFVGKYGYDRILKVLGRHVRDFVNGLDNLHEYLRFSYPKVQPPTFFCQEESATGVTLHYRSKRKGYLHYAMGQLRQMGKQFYDTDIHVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDEEEQEILPITSDFFFEVFPFNIVFRQDMVVHNVGSGLATVFPDLDGKKINDAFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRVQNSDYENANRSADVDVELMAFQSIIGDDYKDGNSANAMESWGDGSRCLKLKGQMRYMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQSEELKRALIQEQKKSSK 441          

HSP 2 Score: 223.402 bits (568), Expect = 8.826e-132
Identity = 109/235 (46.38%), Postives = 167/235 (71.06%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            ++KS +LEE+M+ L+   KKTD+LLY+ IPK +AKRLRKG  +++TC+VF  V+I FS VV F +ICS I+  ++V++LN MYT FD L+E ++V+KVETI D+YM+V+GAP  T  H+ +I +MAL M+     +LK+P+  + +I++ +G HSGM+VAG+VG KMPRY L GDTV+T+S M S+G    + +S   +EH+    + + +RG + IKG   + TY+++ ++  D
Sbjct:  436 QKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVFPDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHRVFKVETIGDAYMVVAGAPEKTKYHAHNICDMALDMVRSI-DHLKDPSNGN-NIQIRVGIHSGMVVAGVVGHKMPRYGLHGDTVHTASAMESNGKEMHIQLSSATYEHLKGSHFIFERRGTITIKGNVEIETYWLKGKRDKD 668          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 195.667 bits (496), Expect = 3.363e-88
Identity = 97/226 (42.92%), Postives = 145/226 (64.16%), Query Frame = 1
Query: 1285 KSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            K ++L    R+L   +KKT+ LLY  +P+ +A +L++G   +D  + F+  +I FS VV F  IC+     +IV++LN MY+ FD LT ++ VYKVETI D+YM+V G P   D H+  +   AL M   A + + NP  +   I++ +G H+G ++AG+VG KMPRYCLFGDTVNT+SRM SHG P+ +H+S   +  +    +   +RGE+++KGKG M TYF+
Sbjct:  382 KKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEG-KKVDAGE-FKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGM-RIAAREVTNPI-TGKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFL 603          

HSP 2 Score: 151.369 bits (381), Expect = 3.363e-88
Identity = 108/400 (27.00%), Postives = 187/400 (46.75%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDM--------------KGFEKTLEISIPYEN--------FP----IRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSN--FNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQ--SDELMELFEKKR 1288
            MYG +   L+  V   +G + W +   LAE+   +  T+ +Y + I  R+V     +L+ + E ++   G YF  +    GYD +LR LG N V+FI+ LD LH YL  SY ++  PSF VE   +    LHY + R G  + V G +  +AK F+   + + ++ + ++  +T     ++  M               G + T+E  +  ++        +P    I    F   FPFH+V  +NL ++H GV  +   P L  +    ++ F +  P +      I ++ NS F +     T    L  +L+             Q  +K +GQM+ M   + +++L +P +R +++L+E GL L D+ + DT +D+IL   Q+    EL    E+K+
Sbjct:    1 MYGFINTCLRTLVVEKFGEETWEKLRLLAEVQ-DTFMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVL----KTRREMLPESLQN------------QTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKK 383          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 195.667 bits (496), Expect = 7.652e-88
Identity = 97/226 (42.92%), Postives = 145/226 (64.16%), Query Frame = 1
Query: 1285 KSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            K ++L    R+L   +KKT+ LLY  +P+ +A +L++G   +D  + F+  +I FS VV F  IC+     +IV++LN MY+ FD LT ++ VYKVETI D+YM+V G P   D H+  +   AL M   A + + NP  +   I++ +G H+G ++AG+VG KMPRYCLFGDTVNT+SRM SHG P+ +H+S   +  +    +   +RGE+++KGKG M TYF+
Sbjct:  388 KKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEG-KKVDAGE-FKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGM-RIAAREVTNPI-TGKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFL 609          

HSP 2 Score: 150.214 bits (378), Expect = 7.652e-88
Identity = 109/405 (26.91%), Postives = 190/405 (46.91%), Query Frame = 2
Query:  164 TIPIEMYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDM--------------KGFEKTLEISIPYEN--------FP----IRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSN--FNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQ--SDELMELFEKKR 1288
            T+P + YG +   L+  V   +G + W +   LAE+   +  T+ +Y + I  R+V     +L+ + E ++   G YF  +    GYD +LR LG N V+FI+ LD LH YL  SY ++  PSF VE   +    LHY + R G  + V G +  +AK F+   + + ++ + ++  +T     ++  M               G + T+E  +  ++        +P    I    F   FPFH+V  +NL ++H GV  +   P L  +    ++ F +  P +      I ++ NS F +     T    L  +L+             Q  +K +GQM+ M   + +++L +P +R +++L+E GL L D+ + DT +D+IL   Q+    EL    E+K+
Sbjct:    3 TLPSQ-YGFINTCLRTLVVEKFGEETWEKLRLLAEVQ-DTFMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVL----KTRREMLPESLQN------------QTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKK 389          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031087.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103027224])

HSP 1 Score: 223.402 bits (568), Expect = 1.132e-87
Identity = 109/235 (46.38%), Postives = 167/235 (71.06%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGD 1983
            ++KS +LEE+M+ L+   KKTD+LLY+ IPK +AKRLRKG  +++TC+VF  V+I FS VV F +ICS I+  ++V++LN MYT FD L+E ++V+KVETI D+YM+V+GAP  T  H+ +I +MAL M+     +LK+P+  + +I++ +G HSGM+VAG+VG KMPRY L GDTV+T+S M S+G    + +S   +EH+    + + +RG + IKG   + TY+++ ++  D
Sbjct:  258 QKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVFPDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHRVFKVETIGDAYMVVAGAPEKTKYHAHNICDMALDMVRSI-DHLKDPSNGN-NIQIRVGIHSGMVVAGVVGHKMPRYGLHGDTVHTASAMESNGKEMHIQLSSATYEHLKGSHFIFERRGTITIKGNVEIETYWLKGKRDKD 490          

HSP 2 Score: 121.709 bits (304), Expect = 1.132e-87
Identity = 76/262 (29.01%), Postives = 127/262 (48.47%), Query Frame = 2
Query:  614 GQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEK-TLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMP-------------------HTSSGPLNAALK----------KDKANIKRLSSIVQGR--IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            GQL  + K FY+ DI + ++S+      +H T  +  D   +     E     E  PI  D FFE+FPF++V  +++ + + G G   + P L     ND F+L++P ++ T+  I+ + N+ FEI+                         S  ++  L           KD  +   + S   G   +K KGQM  MP W  ++FLGTPV+  +  + + GL++NDL+  D+ +D++LAG+QQS+EL     +++  S K
Sbjct:    2 GQLRQMGKQFYDTDIHVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDEEEQEILPITSDFFFEVFPFNIVFRQDMVVHNVGSGLATVFPDLDGKKINDAFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRVQNSDYENANRSADVDVELMAFQSIIGDDYKDGNSANAMESWGDGSRCLKLKGQMRYMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQSEELKRALIQEQKKSSK 263          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037807.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103038777])

HSP 1 Score: 243.047 bits (619), Expect = 1.968e-77
Identity = 111/232 (47.84%), Postives = 172/232 (74.14%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRK 1974
            ++K  QL+E ++ L++ +K+ D LLY  IPK++A RLRKG+++++TCQVF  V+I FS VV F +IC  I+  ++V++LN++Y  FD L+E + VYKVETI D+YM+V+G P+ T  H+ HI +MAL M++    +LK+P+ +  +I++ +G HSGM+VAG+VG+KMPRYCLFGDTVNT+SRM S+G   ++H+S    +H+   PY   +RG++ +KGKG M TY+++ +K
Sbjct:  437 QQKYAQLQEIIKKLDEEKKRGDSLLYAMIPKAVADRLRKGITALETCQVFPDVTILFSDVVKFNEICIHITPMQVVDMLNEIYIVFDTLSEKHNVYKVETIRDAYMVVAGVPNKTTFHAHHICDMALDMLSSI-DHLKDPS-TGDNIQIRVGIHSGMVVAGVVGLKMPRYCLFGDTVNTASRMESNGVGMQIHISQTTKDHLEHEPYIIEERGKIFVKGKGYMKTYWLKGKK 666          

HSP 2 Score: 68.1662 bits (165), Expect = 1.968e-77
Identity = 29/60 (48.33%), Postives = 45/60 (75.00%), Query Frame = 2
Query: 1085 IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDEL 1264
            +  KGQM  +P W+ L+FLGTP+I  V+ + + G+++NDLN  D+ +++ILAG+QQS EL
Sbjct:  370 LHLKGQMKYVPQWDSLIFLGTPIIETVEDMIKMGVYVNDLNLHDSSRELILAGTQQSAEL 429          

HSP 3 Score: 207.608 bits (527), Expect = 1.310e-55
Identity = 103/298 (34.56%), Postives = 169/298 (56.71%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTL---EISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRL 1063
            MYGL + A+  ++   YG D+W      AEI +     H +Y + +I R+  A   +L +  +++M+  G Y V+ +   GY++IL+VLGRN  DFI  LDNLHEY RFS+PK++PPSF VE   E+++ LHYR+ R GF  +V+GQL  + + FY  DI++ ++SK E    T+  + +  D   F+  +   + +  YE  P++R +FF++FPF ++   ++T+   G G K +   L     N+EF L +P ++ +++ I  + N+ FE++      S        K K NI +L
Sbjct:    1 MYGLYLEAVNDYINESYGEDVWRLIEARAEIPHLKFVRHQMYNDNLILRLAKAAGEVLGKTHDELMYAFGVYMVKRIGNYGYERILKVLGRNVRDFINELDNLHEYFRFSFPKVQPPSFCVEEECETSLTLHYRSTRKGFTQFVKGQLSQVGRQFYNTDIEVEILSKEETEKMTYVVYKMNFDNAAFKHRMPQQKTAPGYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDLQGKKVNEEFTLVRPMLEFSWDNIYTHLNNVFELLSKAVVES--------KQKVNIPKL 290          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 200.675 bits (509), Expect = 2.710e-57
Identity = 106/246 (43.09%), Postives = 156/246 (63.41%), Query Frame = 1
Query: 1282 EKSKQLE---ENMRDLNK----FRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVF 1998
            E S QLE   E +R L+K     +KKT+ LLY  +P  +A +L++G   ++  + F+  +I FS VV F  IC+     +IV++LN MY  FD LT ++ VYKVETI D+YM+V G P     H+  +   AL M+  A++ + NP   S +I++ +G HSG ++AG+VG KMPRYCLFGDTVNT+SRM SHG P ++H+S    E +    ++  +RGE+E+KGKG M+TYF+   +S  E ++ 
Sbjct:  129 ELSTQLERKKEELRVLSKNLQVEKKKTEALLYAMLPHHVANQLKEG-KKVEAGE-FKVCTILFSDVVTFTNICAVCEPIQIVHMLNAMYMRFDRLTTVHNVYKVETIGDAYMVVGGVPIPVPSHAERVANFALGMVLAARE-VTNPVTGS-AIQIRVGIHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPGRIHLSPSTREALQGKEFDVEERGEIEVKGKGRMSTYFLLGNRSVGEQEIL 370          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 5.122e-47
Identity = 94/224 (41.96%), Postives = 146/224 (65.18%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFP-YNYTKRGEMEIKGKGSMTTYFI 1962
            +EE  +   + ++K + LLYQ +P S+A++L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     L++  I  M+L+++  A K  K   +    ++L IG H+G + AG+VG+KMPR+CLFGDTVNT+SRM S+G   K+HVS    E + +F  +    RG++E+KGKG M TY++
Sbjct:  597 VEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQ--AEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLD-AVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWL 817          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 1.590e-46
Identity = 100/238 (42.02%), Postives = 142/238 (59.66%), Query Frame = 1
Query: 1288 SKQLE----ENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVE---MALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKS 1977
            SK LE    E  +DL   ++KTD LLY  +PK IA  LR+G   +   Q + S ++ FS +V F Q+ S  +  ++V+ LN +YT FD + + Y VYKVETI D+YM+VSG P  T+ H+ H VE   MAL ++   +  +  P K    +++  G H+G +VAG+VG KMPRYCLFGDTVNT+SRM S     K+  S      + Q   Y  + RG + +KGKG M T+++E R +
Sbjct:  267 SKHLESVVTERTQDLVLEKQKTDRLLYSMLPKQIADDLRQG--RVTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYDVYKVETIGDAYMVVSGVP--TENHNQHAVETANMALDLVNVCQAFVI-PHKPEMQLKIRAGIHTGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSPSTSSILQQIGSYLLSCRGTVTVKGKGEMITWWLEGRDT 499          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 163.31 bits (412), Expect = 4.738e-43
Identity = 84/224 (37.50%), Postives = 141/224 (62.95%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDL-HSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFI 1962
            +EE  +   + + K + LLYQ +P S+A++L++G +     + F SV+I  S +V F  + ++ +  ++V  LND+YT FD + + + VYKVETI D+YM+VSG P      H+  +  MAL++++ A +      + +  + L IG H+G + AG+VG+KMPRYCLFGDTVNT+SRM + G  +++H+S      + ++  +     G+++IKGKG+M TY++
Sbjct:  280 VEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETV--PAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLS-AVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWL 500          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000043.1 (pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 gene:ENSPMAG00000000040.1 transcript:ENSPMAT00000000043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 1.088e-39
Identity = 89/221 (40.27%), Postives = 129/221 (58.37%), Query Frame = 1
Query: 1279 KEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSA-HIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHIS--QFPYNYTKRGEMEIK 1932
            K   + +EE      + R + D L YQ +PK++ + L K V S+   ++F+ V+I FS +V F  IC      ++V LLND+Y  FD++ + + VYKVETI D+YMLVSG P     H A  I  +AL +++    +          + + IG HSG   AG+VG KMPRYCLFGDTVNT+SRM S G P ++HVS    + ++  Q  + +T RG +E+K
Sbjct:  221 KNLERLVEERTELYKRERDRADHLNYQLLPKTVVQAL-KSVGSVQP-ELFEEVTIYFSDIVGFTTICKHCEPMEVVCLLNDLYKEFDSIVDSHDVYKVETIGDAYMLVSGLPKRNGCHHAMEIANVALDILS-FMGSFHIQHLPGLPVWVRIGIHSGKCAAGVVGNKMPRYCLFGDTVNTASRMESTGYPYRIHVSQSTVDTLNAQQSGHQFTCRGIIELK 438          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN70])

HSP 1 Score: 155.221 bits (391), Expect = 1.695e-75
Identity = 98/255 (38.43%), Postives = 150/255 (58.82%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAK--RLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVD-KIVNLLNDMYTHFDNLTELYK-VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSG-SIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYN---YTKRGEMEIKGKG-SMTTYFIES----RKSGDEYKVFKQKLE 2013
            + +L++  R+L   ++  D LLY  +P S+A   RLRK V++      ++ V+I FS +VDF   C++I    +IV +LN++YT FD LT+    +YKVET+ D YM VSG P+  D H+ +I  +AL MI  +K       K+ G  +++ IG HSG +VAG+VG K PRYCLFG+TVN +SR  + G   K++VS+  +  +   P+    + KRG + +KGK   M TY ++     +  G E  +  Q+LE
Sbjct:  384 TDKLQQTSRELENEQQLNDRLLYSILPASVANDLRLRKPVNA----NKYEIVTIMFSGIVDFTNYCNKIKEPMEIVEMLNEVYTEFDQLTDSNDDIYKVETVGDKYMAVSGLPTRCDKHALNIANLALDMIDISKG-----MKAKGIQLQVTIGIHSGEVVAGVVGQKKPRYCLFGNTVNLTSRTETTGLKGKINVSEYAYRCLLVQPHEQFVFKKRGPVVMKGKKEPMITYILQRNDKYQPDGAEQDISLQQLE 629          

HSP 2 Score: 147.517 bits (371), Expect = 1.695e-75
Identity = 107/383 (27.94%), Postives = 181/383 (47.26%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDY---QSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVT-ESTIKLHYRTKRPGFQHYVRGQLVNIAKYFY--EKDIKIFLISKIEDSYQTHYTFD--------ILLDMKGFEKTL-EISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLL--NSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAA-----LKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            MYG +  ALQ  V   YG D+W + L  A +D    +  N   +Y +     ++     ++  ++  I+   G  F E+    GYD ++R LG N +DF   LD LHE L   YP ++PPSF  +       ++L Y ++R G ++ V G +  +A   Y  + ++++  +S  + S+   Y           IL      E+T+ E+SI   +  I    F    PFH V  + + I   G+    + P +    S   D F   +P I  T++ I++Y N  + I     T SG L++A      + D  N++  S      ++F+GQM+ +P  N +MFL +P + ++  L E GL+++D+   D  +D+IL   Q + E
Sbjct:    1 MYGFVNRALQDLVIQGYGPDVWKEILEKANLDLGDSREFNERRIYDDQNTSDLLIVAEDVIGLSKNAILERFGDAFFEHCIGSGYDSMIRSLGGNLMDFFNSLDGLHEQLLLLYPGMRPPSFRAKQHNINMKLELVYTSERSGLEYMVVGLVKTVASKLYGIQVNVELASMSSKDQSWAMFYVLPQHQDEMKYILPTDTTLERTMKELSIMTLSSRIGTAAFCRACPFHAVFDQRMVIYQAGISLCRVLPAVRVGKSKLTDIFESIRPPIKLTFDNILQYINKVYVI----KTKSGLLDSASLSTVSEDDYGNLESPS------MRFRGQMMYLPECNSIMFLASPSVVNLDGLNEKGLYMSDIPIHDATRDLILLSEQHNAE 373          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN69])

HSP 1 Score: 149.828 bits (377), Expect = 3.514e-69
Identity = 89/233 (38.20%), Postives = 132/233 (56.65%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTE--LYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDI----FFEHISQFP-YNYTKRGEMEIKGKG-SMTTYFI 1962
            + +L +    L + ++ TD+LLY  +P S+A  LR         +  + V++ FS +VDF QIC      +IV LLN++YT FD LT+  +  VYKVET+ D YM VSG P     H+  I  MAL M    K   ++       I++ IG HSG +VAG+VG K PRYCLFG+TVN +SR  + G+P +V++++       E   Q P + + +RG + +KG+   M TY +
Sbjct:  480 TDKLRQTHNALAEKKQLTDQLLYSVLPPSVANELRHNRPVQ--AERAEMVTLLFSGIVDFAQICKNSKPMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDM----KHVTQSIIHKGDKIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTYRCLLEPECQDPSFVFERRGPVAMKGRQEPMVTYLL 706          

HSP 2 Score: 131.724 bits (330), Expect = 3.514e-69
Identity = 99/375 (26.40%), Postives = 180/375 (48.00%), Query Frame = 2
Query:  182 YGLLVGALQHFVESLYGADIWIQALNLAEIDYQS-INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNV-ESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKI--------------FLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFP-IRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLL--NSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQ 1249
            YG +  AL+  V   +G   W +    AE++ +       +Y + +   +V A + +L+     I+   G  F ++    GYD+IL+VLG    DFI  LD LH++L   YP ++ PSF V +  ++  + LHY ++R G +  V G +  +A+     ++ +              F+I +I D  +     D    +K ++  ++ S    N P I    F + FPFHL+ + +L +   G     + P+L   +++ ++ F L +P +  TYE I+ + N+ F +       S P N    K+        S+    ++ KGQM+ +P  + ++FL +P + +++ L + GL+L+D+   D  KD+IL   Q
Sbjct:  100 YGFVNHALELLVVRNFGVAKWEEIKRAAELEIEGHFLQRIIYDDVMTYSLVGAATRVLDIETSAILEKFGEMFFDFCQESGYDRILQVLGGTLRDFIGNLDALHDHLGSIYPGMRAPSFRVSDRESDGALILHYYSERDGLEPIVVGIVKTVARKLLNTEVSVEVVKGKEYDGDDVQFVIKEISDRGR-----DCDSQVKNYDP-IKDSFQLSNEPKISPATFCKAFPFHLMFNRDLKVTQAGESVSRVVPSLTPGDADMSEIFELIRPQLRFTYEAIIAHINTVFVLRTREGKLSKPANNMCNKNGCCKLCWDSLP---LRLKGQMVYIPESDNMIFLCSPSVGNLEDLADVGLYLSDIPLHDATKDLILLSEQ 465          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO43095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH8])

HSP 1 Score: 241.121 bits (614), Expect = 6.835e-69
Identity = 114/227 (50.22%), Postives = 164/227 (72.25%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            +KS +LEE+MR+L+  + +TD LLYQ IPK++A RLRKG  +++TC+ F +V+I FS VV F  ICS I+  ++V +LN MYT FD L+E + VYKVETI D+YM+VSG P  T  H+ H+ +MAL+M++ A   +++PA  +  + + IG H+G +VAG+VG+KMPRYCLFGDTVNT+SRM S G    +HVS+   + +++  Y   +RG M+IKGKG M TY++
Sbjct:  395 QKSAKLEESMRELDNEKLRTDALLYQMIPKTVADRLRKGEPALNTCETFSNVTILFSDVVGFTTICSLIAPMQVVTMLNCMYTTFDKLSEKHNVYKVETIGDAYMVVSGIPERTKYHAEHVADMALNMLS-AMPEIEDPAGLNDHLRIRIGIHTGTVVAGVVGLKMPRYCLFGDTVNTASRMESTGLAMAIHVSEDTQKFLAKANYALKQRGSMDIKGKGGMKTYWL 620          

HSP 2 Score: 207.223 bits (526), Expect = 6.325e-57
Identity = 109/351 (31.05%), Postives = 180/351 (51.28%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGF---------EKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEI----ILMPHTSSGPLNAALKKDKANIKRLSSIVQG-------------RIKFKGQMLDMPLWNGLMFLGTPV 1153
            +YGLL+  +   + S YG D W +    A +   +   H++Y+++I  R+V++   I  E    ++   G  FV ++   GYDKILR+LGR+  DF+ GLDNLHE++RF+YPK+K PSF+    TE  +KLHYR+ R GF +YV GQ+  + K FY++ I++ ++ + E          +  D + F            + +    ++  I  D+F+E+FPFH+V  +++TI   G   + + P L+     DEF L +PF+D ++E +  + N  FE+      +    +G +   L      +  L   V G             RI  KGQM+ +  W  + +L TP+
Sbjct:    2 VYGLLIENVSSLLTSRYGEDTWHKIRENAGVQQHTFAIHNIYSDSIFQRLVSSAEEITGEDRNSLLESTGALFVSFIGQFGYDKILRILGRHIRDFLNGLDNLHEFMRFTYPKLKAPSFHCSEETERGMKLHYRSSRKGFLYYVVGQIREVGKMFYDQQIEVEVLEQHESKEGFVAVMQLYFDNRAFISARKRPKRHSVISLGGETDSLSIHIDVFYEVFPFHVVYDKSMTITSVGSSLEAVLPNLVGCKITDEFSLIRPFLDFSWESVFVHTNVVFELQSRSKALSMRKNGKVQNGLLMGCPIMDALGEGVNGNHDNNHNVTEFDSRIHLKGQMMYIDEWKAMAYLATPI 352          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO40362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B2])

HSP 1 Score: 194.126 bits (492), Expect = 8.531e-53
Identity = 128/401 (31.92%), Postives = 212/401 (52.87%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEE-----DIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFY---EKDIKIFLISKIEDSY-QTHYTFDILLDMKGFEKTLEISIPYENF-------PIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTL-LNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGR---IKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAG-----------SQQSDELMELFEKKR 1288
            MYGLL+ +++HF+   YG ++W + +N+A        TH +Y E  I +I NA +++L + +E     D M   G  FV++ S  GYD I+RV GR+F DF+ G+D+LHE++RF YPK+K P+F  +  T + I LHY ++R GF  YV GQ+  IA+ FY     ++KI      + S  Q H  + +  + +G++       P  +F        +  ++FF IFPF LV+S ++T+   G G + +   L L  +  + FIL +P  D T+  ++      FE++     S  PL          I+R     QG    +  +GQM  M  W+  +F+ +P+I ++  + ++GL++NDL+  DT +++ L+G            QQ ++ +EL E  R
Sbjct:    1 MYGLLLESIRHFIVGKYGEELWSEIVNIAGTSSHEFVTHRLYDENWIFKIANAATTVLGDLDEHITVDDCMRLFGVCFVKFFSFYGYDPIIRVSGRHFRDFLIGIDSLHEHMRFGYPKMKSPTFYCDEETSTGINLHYESRRKGFMFYVVGQVEEIARKFYGISNINVKILKNESSQSSREQCHIVYRLEFNNEGYKP------PPPDFLTVGTKKAVSTEVFFSIFPFSLVISPDMTLSMFGNGLQSLLGKLVLGRDIREVFILRRPKTDFTWHTLLT-RKVVFELL-----SKVPL----------IRRPQPKHQGSTMTLHLRGQMKFMHDWDKFLFICSPLIANLDTMLQSGLYMNDLSMHDTSQEMALSGIKPLPQLEYARDQQFEQGIELEENMR 379          

HSP 2 Score: 169.859 bits (429), Expect = 1.921e-44
Identity = 85/218 (38.99%), Postives = 143/218 (65.60%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDS-YMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIK 1932
            E+  +LEENMR L + R+++++LLY+ +PK IA+RL++G + +DTC+ F + ++ FS +  F  IC+ ++  + V L+N+++  FD LTE + VYK ET+ D+ YM VSG P  T+ H+  +  MAL M+  A + +K+P  +   + + +G HSG + AG+VG +  +YCLFGDTVN +SR+ +   P ++H+S+   E + +  +    RGE+E+K
Sbjct:  369 EQGIELEENMRKLEEERQRSEDLLYRMVPKPIAERLKRGGNPIDTCEEFDAATVLFSYMDGFTSICTRLNAMQAVTLINNLFIKFDLLTEKHNVYKFETLGDALYMAVSGVPVRTEHHAEPMAAMALDMLK-AVQLVKDPI-TKKPMTITVGIHSGPVAAGLVGERTLQYCLFGDTVNIASRLRTTALPMRIHISENCRECLEESDFITEFRGEIELK 584          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO40401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B3])

HSP 1 Score: 181.415 bits (459), Expect = 4.030e-52
Identity = 99/243 (40.74%), Postives = 153/243 (62.96%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKV----------ETISDS-YMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKG-KGSMTTYFIESRK 1974
            EKS++LE+NM+ + + R ++++LLYQ IPK IA RL++G  ++DTCQ F  V+I FS +  FVQ+CS +S  ++V+++N M+T FD L+E + VYK           ET+ D+ YM VSGAP     H+  +  MAL MI  A   +K    S+  + + IG HSG +VAG+VG + P+YCLFG TVN +SR+ +   P ++H+S+   E +    ++   RG + +KG +G M TY++  R+
Sbjct:  659 EKSRELEKNMKRVERERMRSNQLLYQMIPKQIADRLKEGQDAIDTCQHFDCVTILFSYLDGFVQLCSHVSAMEVVSVVNTMFTVFDKLSEKHDVYKAFDLHCSILKFETLGDAIYMAVSGAPVPKARHAEPMAAMALDMID-AMDEIKKFC-SNALLTITIGMHSGAVVAGVVGKRTPQYCLFGHTVNIASRLRTTALPMRIHISNSCNECLLNTEFHTEFRGTILLKGIQGEMKTYWLIGRE 899          

HSP 2 Score: 43.1282 bits (100), Expect = 4.030e-52
Identity = 23/75 (30.67%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1076 QGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELM----ELFEKKR 1288
            Q RI  KG+M  +   N ++F+ +PVI    ++   G++++DL   D  ++++L+G Q   +L     +L EK R
Sbjct:  588 QPRIHLKGEMKYIKQNNKVLFVCSPVIGGFNEMMRCGVYMSDLGMHDRSQEMVLSGIQPLQQLEYARDQLLEKSR 662          

HSP 3 Score: 160.999 bits (406), Expect = 1.489e-40
Identity = 90/277 (32.49%), Postives = 151/277 (54.51%), Query Frame = 2
Query:  200 ALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNE----AEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLE---ISIPY-ENFPIRRDM----FFEIFPFHLVLSENLTIQHCGVGFKHIC-PTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEII 991
            ++QH+++ L+G  +W Q   LA +++    TH  Y++ I  ++    + +L +     ++D M   G  FV++ S  GYDK+++V GR+  DF+ G+D +HE +RF YPK++ P+F+    T + + LHYR+KR GF+HYV GQ+  + K FY+  I+I +++  E + Q H  + +  D     K L    +S+P     P  + M    FF IFPF  V+S N+ I   G     I    LL +   D F L +P  + T+E +  +  + FE++
Sbjct:   27 SIQHYIKELHGEGVWDQIRFLAGVEHHVFVTHQRYSDAIFQKLAEGSAKVLGKEMGWGKDDFMQFFGKCFVKFFSNYGYDKVIKVFGRHLRDFLNGIDTIHEQMRFGYPKMESPTFHCTEETSTGLTLHYRSKRKGFKHYVIGQMHEVVKQFYDMSIQIDILAITETTNQCHVAYRLTFDNHA-SKPLAPDLLSLPVIHEAPNLKSMPLENFFNIFPFSFVISANMRISMAGHSLLSILGKELLGAKVTDAFTLRRPKTEFTWENLQVW-RAAFELV 301          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: gucy1b1 (fatty acid binding protein 2 [Source:NCBI gene;Acc:101170642])

HSP 1 Score: 153.295 bits (386), Expect = 4.156e-60
Identity = 96/249 (38.55%), Postives = 136/249 (54.62%), Query Frame = 1
Query: 1288 SKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEIS----VDKIVNLLNDMYTHFDNLTELYK---VYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHI-------SQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYK 1992
            + +L+  +R L   +KKTD LLY  +P S+A  LR         + + +V+I FS +V F   CS+ +      KIVNLLND+YT FD LT+  K   VYKVET+ D YM VSG P     H+  I  +AL M+  A +          S+++ IG H+G +V G++G +MPRYCLFG+TVN +SR  + G   K++VS+  +  +        QF   Y  RG + +KGK      +  SRKS D  K
Sbjct:  329 TDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQV----KVDDESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQCAENADPQFQLEY--RGPITMKGKKEPMKVWFLSRKSSDADK 569          

HSP 2 Score: 99.7525 bits (247), Expect = 4.156e-60
Identity = 76/286 (26.57%), Postives = 136/286 (47.55%), Query Frame = 2
Query:  455 FVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTE-STIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISK-----------IEDSYQTHYTFDILLDMKGFEK--TLEISI-PYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSN--FNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDE 1261
            + ++   LD LH++L   YP ++ PSF      + + + LHY ++R G Q  V G +  +A+  +  +I++ +I +           IE+       F+   D+ GFE+  T E  I PY         F + FPFHL+  ++L +  CG     + P L   +      F L +P ID ++  I+ + N+ F +     +  G LN    +   N   L+ +    ++ KGQM+ +P    ++FL +P + ++  L   GL+L+D+   D  +D++L G Q  +E
Sbjct:   50 WTEWFDNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSEECDHIKFLIEEKDSEEEAFN--EDLDGFEENGTQETRISPY--------TFCKAFPFHLMFDKDLMLTQCGNAIYRVLPQLQPGSCILPSVFSLVRPHIDFSFHGILSHINTVFVL----RSKEGLLNVETVE---NEDELTGVEISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 318          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 192.2 bits (487), Expect = 8.066e-50
Identity = 99/226 (43.81%), Postives = 147/226 (65.04%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIES 1968
            +EE  +  N+ ++K + LLYQ +P S+A +L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     LH   +  MAL+++  A K+ K   + S  + L IG HSG + AG+VG+KMPRYCLFGDTVNT+SRM S G   K+HVS+   + + +F  +    RGE+E+KGKG M TY+++ 
Sbjct:  827 VEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQ--AEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLD-AVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQG 1049          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 191.43 bits (485), Expect = 9.846e-50
Identity = 99/226 (43.81%), Postives = 147/226 (65.04%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIES 1968
            +EE  +  N+ ++K + LLYQ +P S+A +L++G +     + F SV+I FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     LH   +  MAL+++  A K+ K   + S  + L IG HSG + AG+VG+KMPRYCLFGDTVNT+SRM S G   K+HVS+   + + +F  +    RGE+E+KGKG M TY+++ 
Sbjct:  768 VEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQ--AEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLD-AVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQG 990          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 185.267 bits (469), Expect = 1.376e-47
Identity = 99/227 (43.61%), Postives = 145/227 (63.88%), Query Frame = 1
Query: 1297 LEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAP-STTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVS----DIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFI 1962
            +EE  +  ++ ++K + LLYQ +P S+A++L++G +     + F SVSI FS +V F  + +E +  ++V LLND+YT FD + + + VYKVETI D+YM+VSG P     LH   I  MAL+++   +   +   +    ++L IG HSG + AG+VG+KMPRYCLFGDTVNTSSRM S G   K+HVS    D+  E  S   +    RG+++IKGKG MTTY++
Sbjct:  836 VEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQ--AEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVR-TFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNS---FQLELRGDIDIKGKGKMTTYWL 1056          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc8 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100049174])

HSP 1 Score: 183.726 bits (465), Expect = 1.890e-47
Identity = 101/236 (42.80%), Postives = 144/236 (61.02%), Query Frame = 1
Query: 1288 SKQLE----ENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTD-LHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKS 1977
            SK LE    E  +DL   ++KTD LLY  +PK +A  LR+G  S    Q + S ++ FS +V F Q+ S  +  ++V+ LN +YT FDN+ + Y VYKVETI D+YM+VSG P     LH++ I  MAL ++   +   + P K S  +++  G HSG +VAG+VG KMPRYCLFGDTVNT+SRM S  +  K+  S   F  + +   Y    RG  ++KGKG M TY+++ +K+
Sbjct:  586 SKHLEVLVAERTQDLTHEKQKTDRLLYSMLPKQVADDLRQGKPSQA--QSYVSATVFFSDIVGFTQLSSSSTPYQVVDFLNKLYTTFDNIIDNYDVYKVETIGDAYMVVSGVPQENGILHASEIASMALDLVGVCQ-TFRIPHKPSMQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSTALKIQCSSSTFYLLEEIGGYVLECRGVQQVKGKGDMVTYWLQGKKT 818          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 494/494 (100.00%), Postives = 494/494 (100.00%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHXXXXXXXXXXXXRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVXXXXXXXXXXXXXXXXXXXXXXRTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK 2763
            EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHDDSPDDSLSLCSRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVSAADSTADINSASSNTSNTNSDRTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK
Sbjct:  371 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHDDSPDDSLSLCSRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVSAADSTADINSASSNTSNTNSDRTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK 864          

HSP 2 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 369/369 (100.00%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKK 1285
            MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEK+
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQ 369          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 494/506 (97.63%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHXXXXXXXXXXXXRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVXXXXXXXXXXXXXXXXXXXXXX------------RTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK 2763
            EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHDDSPDDSLSLCSRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVSAADSTADINSASSNTSNTNSD            RTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK
Sbjct:  371 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHDDSPDDSLSLCSRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLSEQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESNIFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVSAADSTADINSASSNTSNTNSDKNELDIIIIISIRTIENYLNGREIYCQNSENNQQIPLWSNLSKCLIKGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK 876          

HSP 2 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 369/369 (100.00%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKK 1285
            MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEK+
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQ 369          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 295.819 bits (756), Expect = 1.320e-146
Identity = 150/378 (39.68%), Postives = 237/378 (62.70%), Query Frame = 2
Query:  173 IEMYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEII-LMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            + MYGL++  ++ F+ S YG D W   L  A+ID  +  TH VY ET+IP I+ + S  LN   ++IMF NG +F+ ++S  GYD ILRVLGR+  DF+ GLDNLHEYLRFSYPK+KPPSF   + +++ I L YRT+R G+ HYVRGQ+  IA+ FY  ++ I ++S+  +   ++    +  + K F +  ++       P+  ++FFE+FPF++V +  +   +CG G  +  P L +    + F+L++P I+ T++ ++ + N+ FE+I L P  SS  +    + + ++ KR  S     +K +GQM  MP W+ ++FLGTP++RDV+ + +AGLF+NDL+  D+ +D++LAG QQS EL    E++   S K
Sbjct:    3 LAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDL------LPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKI--LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKK 372          

HSP 2 Score: 245.358 bits (625), Expect = 1.320e-146
Identity = 116/230 (50.43%), Postives = 167/230 (72.61%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIES 1968
            EKSK+LEE++  L++  KKTDELL+Q IPKS+A+RLR G  ++DTC+ F  V+I FS VV F  ICS+I+   +V +LN +Y+ FD LTE +KVYKVETI D+YM+ SG P+ T  H+  I+EM+L MI      L +P+  S S+++ +G H+GM+VAG+VG+KMPRYCLFGDTVNT+SRM S+  P K+H+S+     ++    Y  ++RG ++IKGKG++ TY+++ 
Sbjct:  368 EKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSI-GFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 596          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 295.434 bits (755), Expect = 1.625e-146
Identity = 150/376 (39.89%), Postives = 236/376 (62.77%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEII-LMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANSWK 1303
            MYGL++  ++ F+ S YG D W   L  A+ID  +  TH VY ET+IP I+ + S  LN   ++IMF NG +F+ ++S  GYD ILRVLGR+  DF+ GLDNLHEYLRFSYPK+KPPSF   + +++ I L YRT+R G+ HYVRGQ+  IA+ FY  ++ I ++S+  +   ++    +  + K F +  ++       P+  ++FFE+FPF++V +  +   +CG G  +  P L +    + F+L++P I+ T++ ++ + N+ FE+I L P  SS  +    + + ++ KR  S     +K +GQM  MP W+ ++FLGTP++RDV+ + +AGLF+NDL+  D+ +D++LAG QQS EL    E++   S K
Sbjct:    1 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDL------LPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKI--LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKK 368          

HSP 2 Score: 245.743 bits (626), Expect = 1.625e-146
Identity = 116/230 (50.43%), Postives = 168/230 (73.04%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIES 1968
            EKSK+LEE++  L++  KKTDELL+Q IPKS+A+RLR G  ++DTC+ F  V+I FS VV F  ICS+I+   +V +LN +Y+ FD LTE +KVYKVETI D+YM+ SG P+ T  H+  I+EM+L MI  +   L +P+  S S+++ +G H+GM+VAG+VG+KMPRYCLFGDTVNT+SRM S+  P K+H+S+     ++    Y  ++RG ++IKGKG++ TY+++ 
Sbjct:  364 EKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIK-SIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 592          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000079311.1 (SMESG000079311.1)

HSP 1 Score: 258.07 bits (658), Expect = 2.571e-131
Identity = 139/376 (36.97%), Postives = 215/376 (57.18%), Query Frame = 2
Query:  179 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQG---RIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKKRANS 1297
            MYGLL+  ++ F+ S YG   W Q L  +++D      H VY E ++ RIV   +      ++++MF NG YF+ +LS  GYD ILRVLGR+  DF+ GLDNLHEYLRFSYPK+KPPSF   + + + I L YRT+R GF HYVRGQ+  IAK FY   I+I +I                          E  +P        +  F  FPF++V +  L + +CG G +++ P ++     D F +++P I  +++ I+ ++N+ FE+IL+           +KK + +    S+ ++    R++ +GQM  M  W+ ++FLGTP++RDV+ + +AGL++NDL+  D+ +D++LAG QQS EL    E++   S
Sbjct:    1 MYGLLLEGIRQFICSTYGLQAWTQILEKSKLDVNVFAIHEVYDEELLKRIVFTAADYCRITKDELMFQNGKYFISFLSHYGYDSILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESRTGITLQYRTQRAGFVHYVRGQIFEIAKTFYNTTIEIEIIG-------------------------ENKMP--------NKVFNCFPFNIVFNRGLRVVNCGRGMRNLIPDIIGDYVGDVFHVNRPIIQISWDTIILHSNNVFELILL----------HIKKSRLSDSDSSNSLKESNYRLRMRGQMKYMNEWDAIVFLGTPIMRDVESMWKAGLYINDLSMHDSSRDLVLAGEQQSAELRLALEQESEKS 333          

HSP 2 Score: 232.261 bits (591), Expect = 2.571e-131
Identity = 115/231 (49.78%), Postives = 162/231 (70.13%), Query Frame = 1
Query: 1282 EKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMI--TCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIE 1965
            EKSK+LE++++ L+   ++TDELLYQ IP+++A RLR G  S++TC+ F  V+I FS VV F +ICS I+   +V +LN MY+ FD LTE +KVYKVET+ D+YM+ SG P  T L++  I EMAL MI   C    +KNPA    S+++ +G H+G +VAG+VGIKMPRYCLFGDTVNT+SRM S G   K+ +S    + +     Y   +RG +E+KGKG+++TY++E
Sbjct:  331 EKSKRLEDSLKRLDDEMRRTDELLYQMIPRAVANRLRNGEKSVNTCETFNEVTILFSDVVGFTKICSNITPLDVVEMLNSMYSVFDQLTERHKVYKVETVGDAYMIASGCPVLTTLNAPLIAEMALEMIDKICT---IKNPANEIESLKIRVGIHTGTVVAGVVGIKMPRYCLFGDTVNTASRMESTGETQKIQISSSTQKKLMMHNVYQIVERGVVEVKGKGNVSTYWLE 558          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1B14.634e-7137.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.523e-6737.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.752e-6737.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B13.667e-6737.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.572e-6537.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-313.815e-9931.71Soluble guanylate cyclase gcy-31 [Source:UniProtK... [more]
gcy-311.075e-9440.77Soluble guanylate cyclase gcy-31 [Source:UniProtK... [more]
gcy-334.421e-8730.85Soluble guanylate cyclase gcy-33 [Source:UniProtK... [more]
gcy-337.584e-8730.69Soluble guanylate cyclase gcy-33 [Source:UniProtK... [more]
gcy-368.059e-7141.85Soluble guanylate cyclase gcy-36 [Source:UniProtK... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gyc88E2.403e-13035.88gene:FBgn0038295 transcript:FBtr0110961[more]
Gyc88E2.403e-13035.88gene:FBgn0038295 transcript:FBtr0306245[more]
Gyc88E2.746e-13035.88gene:FBgn0038295 transcript:FBtr0334926[more]
CG32167.163e-5142.28gene:FBgn0034568 transcript:FBtr0273397[more]
CG32161.113e-5042.28gene:FBgn0034568 transcript:FBtr0273396[more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b22.133e-8243.61guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b12.965e-7337.70guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
gucy1b18.332e-7237.70guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
npr1b6.240e-4943.53natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr1b4.018e-4843.53natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1B11.015e-7037.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.356e-7037.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.906e-7037.80guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B13.118e-6737.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B13.087e-6237.65guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy1b11.034e-7038.02guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1b12.586e-6939.72guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1b26.533e-5044.49guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b27.320e-5044.49guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Npr21.448e-4740.52natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8INF0|GCY8E_DROME1.849e-12935.88Soluble guanylate cyclase 88E OS=Drosophila melano... [more]
sp|Q86C56|GCY31_CAEEL4.021e-9831.71Soluble guanylate cyclase gcy-31 OS=Caenorhabditis... [more]
sp|P90895|GCY33_CAEEL4.659e-8630.85Soluble guanylate cyclase gcy-33 OS=Caenorhabditis... [more]
sp|O75343|GCYB2_HUMAN4.553e-7646.61Guanylate cyclase soluble subunit beta-2 OS=Homo s... [more]
sp|P16068|GCYB1_BOVIN7.856e-7137.65Guanylate cyclase soluble subunit beta-1 OS=Bos ta... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZRS75.473e-14755.14Soluble guanylate cyclase 88E OS=Schistosoma haema... [more]
A0A4S2LM392.103e-14355.04Guanylate cyclase domain-containing protein OS=Opi... [more]
A0A1S8X7N92.731e-14155.04Heme NO binding protein OS=Opisthorchis viverrini ... [more]
A0A4E0S2T52.698e-13957.79Soluble guanylate cyclase 88E OS=Fasciola hepatica... [more]
A0A504YE801.322e-13856.38Soluble guanylate cyclase 88E OS=Fasciola gigantic... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045584.18.826e-13234.47soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
gucy1b23.363e-8842.92guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b27.652e-8842.92guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSAMXT00000031087.11.132e-8746.38soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
ENSAMXT00000037807.11.968e-7747.84soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b22.710e-5743.09guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSPMAT00000006352.15.122e-4741.96pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
ENSPMAT00000002650.11.590e-4642.02pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
NPR14.738e-4337.50natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000000043.11.088e-3940.27pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 ge... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470841.695e-7538.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470833.514e-6938.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430956.835e-6950.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403628.531e-5331.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404014.030e-5240.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b14.156e-6038.55fatty acid binding protein 2 [Source:NCBI gene;Acc... [more]
olgc78.066e-5043.81membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc79.846e-5043.81membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc21.376e-4743.61membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc81.890e-4742.80membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051217.10.000e+0100.00SMESG000051217.1[more]
SMESG000051217.10.000e+097.63SMESG000051217.1[more]
SMESG000035922.11.320e-14639.68SMESG000035922.1[more]
SMESG000035922.11.625e-14639.89SMESG000035922.1[more]
SMESG000079311.12.571e-13136.97SMESG000079311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021735 ID=SMED30021735|Name=Guanylate cyclase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2796bp
CAGATTCAAAGAATTCGGATCCTGAAGCTCTTCGATAACGACCTAATTAT
TATTTTCAAAAGAACTTTTGTTCGATTAATTATTCATTGTTTTGAAAATA
TTTCCAAAATTCGACCAATGAGAATCATTCTAGAAAATCTATTTAATAAA
TTGATTTTCTAAAACAATTCCAATTGAAATGTACGGATTGTTAGTTGGGG
CACTGCAGCATTTTGTTGAGTCGCTATATGGAGCTGATATTTGGATTCAA
GCGCTAAATCTTGCCGAAATCGACTACCAATCAATTAATACTCATTCGGT
CTATGCGGAAACGATTATTCCGAGAATAGTCAACGCCCTGTCAAGCATCC
TCAATGAAGCCGAAGAAGATATAATGTTTCACAATGGATGCTATTTTGTG
GAATATCTCTCCACTTGTGGATATGATAAAATTCTCCGAGTGCTCGGACG
AAATTTTGTCGACTTCATTCAAGGCCTCGACAATCTTCATGAGTATTTGA
GATTTTCCTATCCGAAAATCAAGCCGCCTTCTTTCAACGTCGAATCGGTG
ACAGAGTCGACAATCAAGCTCCACTATCGAACGAAACGGCCGGGATTTCA
GCATTACGTTCGAGGACAGCTGGTAAATATCGCGAAATATTTCTATGAGA
AAGACATAAAAATCTTTTTGATTTCGAAAATCGAAGACAGCTATCAAACT
CATTACACGTTTGACATTTTGTTGGACATGAAAGGCTTTGAGAAAACTTT
GGAAATCTCAATTCCTTATGAGAATTTCCCCATTAGACGGGACATGTTTT
TTGAAATTTTTCCGTTCCATTTGGTGTTGTCGGAAAACTTGACGATTCAA
CATTGCGGAGTCGGATTCAAGCACATTTGTCCGACTTTGTTGAATTCGAA
TTTCAATGATGAATTCATTTTATCAAAGCCCTTCATTGATGCTACATATG
AAAAGATTGTTCGATATAACAACAGCAATTTCGAAATCATATTAATGCCT
CACACTTCCAGTGGTCCTTTAAATGCTGCTTTAAAAAAAGACAAAGCCAA
TATTAAAAGACTGAGCTCAATAGTCCAAGGTAGAATAAAGTTCAAAGGAC
AAATGCTAGATATGCCATTGTGGAATGGATTGATGTTCCTTGGAACTCCT
GTAATTCGTGATGTGAAACAACTGAAAGAAGCCGGTTTATTTTTAAATGA
TTTAAACAAATTCGACACTGGTAAAGATATTATTTTAGCTGGAAGTCAGC
AGTCTGATGAATTAATGGAATTATTTGAAAAGAAAAGAGCAAACAGTTGG
AAGAAAACATGCGAGATTTAAATAAATTCCGAAAAAAAACAGATGAATTA
CTTTATCAATGCATTCCCAAATCAATCGCAAAAAGATTACGAAAAGGTGT
TTCATCAATGGACACGTGTCAGGTATTTCAATCTGTTTCCATTTGCTTTA
GCAAAGTTGTTGACTTCGTCCAAATATGCAGCGAAATCAGCGTGGATAAA
ATCGTCAATTTATTAAATGACATGTATACTCATTTCGACAATTTAACTGA
ACTCTATAAAGTTTACAAGGTTGAAACAATAAGTGACAGCTACATGTTGG
TCTCTGGGGCACCGAGTACCACAGACTTGCATAGTGCACATATTGTTGAG
ATGGCACTAAGTATGATTACTTGTGCAAAGAAAAATCTAAAAAATCCTGC
GAAATCTAGTGGAAGCATTGAATTATTGATTGGATGCCACAGTGGAATGA
TTGTAGCGGGAATAGTTGGCATAAAGATGCCAAGATATTGCCTGTTTGGC
GACACTGTCAATACTTCTTCCAGAATGATGAGCCACGGATCACCAAATAA
AGTACATGTATCAGACATATTTTTTGAGCATATCTCTCAATTTCCATACA
ACTACACCAAGAGAGGAGAAATGGAAATTAAAGGTAAAGGGAGCATGACA
ACGTATTTTATTGAATCACGAAAATCTGGAGATGAATACAAAGTTTTCAA
ACAAAAGCTTGAAGAAGATCGTCTCATGCACGATGATAGTCCAGATGATT
CTTTATCACTTTGTTCCAGAATTAATTCAGGATTTATTTTGGGAAACTCT
GTTACAGTTTCATACAATCACAATGCCAGTACCAGTGACGAAGAGAACAT
CACAGACAGCACGATATCAAAAGAAGATGTGTTTAAAGAAGCACTCCGGT
TGCTATCAGAACAAGAGGTTAATGGAAATTCAAAAATAGCAAAATACGAA
CAATCATATTCAAATTCCAATACTTTAAGGAAAAGGGAAAAATCTGAAGA
AATATATAATCAGTTGATTCATTCAAAATCTAACGCACCTTTAAGAAAAG
AATCGAATATATTTACTGAAGACCTTATTCAAGATATAAATGATAATAAT
CTTCCACAGTCGATTATGAAATCTGTCAATAGTAGACGTAAAAAGGGAAT
TGTCTATTTTGGACAGGAAAAGTTTATTTCTCCTTCAGTTTCAGCTGCAG
ATTCAACAGCAGACATTAACAGTGCAAGTTCCAACACTAGTAATACTAAT
TCTGATAGAACGATTGAAAATTACTTGAATGGGCGAGAAATTTATTGTCA
AAATTCGGAAAACAATCAACAAATTCCGTTATGGAGCAATTTGAGTAAAT
GTTTAATAAAAGGCCTGGCAATTATAGCCAACCAGAGGCCATCTGATCCA
ATTGAAGCTTTAGCAATTTGGCTCAAAAGCAGTGCATTAAAAAATCAACA
AGATGATACAAAATGATTTTTTAAATACAATTTTTACATTGTTTAA
back to top

protein sequence of SMED30021735-orf-1

>SMED30021735-orf-1 ID=SMED30021735-orf-1|Name=SMED30021735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKV
VDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSG
APSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVA
GIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYT
KRGEMEIKGKGSMTTYFIESRKSGDEYKVFKQKLEEDRLMHDDSPDDSLS
LCSRINSGFILGNSVTVSYNHNASTSDEENITDSTISKEDVFKEALRLLS
EQEVNGNSKIAKYEQSYSNSNTLRKREKSEEIYNQLIHSKSNAPLRKESN
IFTEDLIQDINDNNLPQSIMKSVNSRRKKGIVYFGQEKFISPSVSAADST
ADINSASSNTSNTNSDRTIENYLNGREIYCQNSENNQQIPLWSNLSKCLI
KGLAIIANQRPSDPIEALAIWLKSSALKNQQDDTK*
back to top

protein sequence of SMED30021735-orf-2

>SMED30021735-orf-2 ID=SMED30021735-orf-2|Name=SMED30021735-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRI
VNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGL
DNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVN
IAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENF
PIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSK
PFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQ
GRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKD
IILAGSQQSDELMELFEKKRANSWKKTCEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011644Heme_NO-bd
IPR011645HNOB_dom_associated
IPR024096NO_sig/Golgi_transp_ligand-bd
IPR001054A/G_cyclase
IPR007858Dpy-30_motif
IPR029787Nucleotide_cyclase
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0004383guanylate cyclase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005525GTP binding
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0006182cGMP biosynthetic process
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0008074guanylate cyclase complex, soluble
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 6..203
e-value: 6.5E-57
score: 205.1
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 38..219
e-value: 5.1E-50
score: 169.6
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 44..174
score: 35.691
IPR007858Dpy-30 motifPFAMPF05186Dpy-30coord: 444..472
e-value: 6.4E-8
score: 32.2
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 34..222
e-value: 5.6E-61
score: 207.3
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 40..217
NoneNo IPR availablePANTHERPTHR45655:SF10SOLUBLE GUANYLATE CYCLASE 88Ecoord: 1..224
NoneNo IPR availablePANTHERPTHR45655FAMILY NOT NAMEDcoord: 1..224
NoneNo IPR availableCDDcd07302CHDcoord: 43..218
e-value: 1.22838E-50
score: 168.527