Multidrug resistance protein 1-like protein

Overview
NameMultidrug resistance protein 1-like protein
Smed IDSMED30021731
Length (bp)7813
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance protein 1-like protein (SMED30021731) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance protein 1-like protein (SMED30021731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug resistance protein 1-like protein (SMED30021731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug resistance protein 1-like protein (SMED30021731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021731SMESG000004996.1 dd_Smed_v6_4124_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30021731SMESG000004996.1 dd_Smed_v6_4124_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30021731SMESG000030105.1 Contig44917uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30021731SMESG000030105.1 Contig44917newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30021731SMESG000004996.1 Contig42584uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021731SMESG000004996.1 Contig42584newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021731SMESG000030105.1 Contig44917uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021731SMESG000030105.1 Contig44917uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021731SMESG000030105.1 Contig44917newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021731SMESG000030105.1 Contig44917newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021731SMESG000030111.1 Contig29479uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021731SMESG000030111.1 Contig29479uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021731SMESG000030111.1 Contig29479uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021731SMESG000030111.1 Contig29479newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021731SMESG000030111.1 Contig29479newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021731SMESG000030111.1 Contig29479newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021731SMESG000004996.1 dd_Smed_v4_4124_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Match: ABCB1 (ATP binding cassette subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:40])

HSP 1 Score: 562.377 bits (1448), Expect = 8.937e-170
Identity = 299/615 (48.62%), Postives = 403/615 (65.53%), Query Frame = 1
Query:  304 VGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            V  +F Y+   D + M+   + +I  G   PL++LVFG  T   A       +L   +++    IT+ + I D           F +   N+   M+  +  ++GI   + + +Y+ V+F+ + +  QI  IR  FF A+MRQ IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F  G I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY +NL+EA +IGI+K+I     +G    L++ SYAL FWYG +L+  G  + +G +L VFFS L+    +GQA+P + +F  AR AA EIF+IID  P ID  ++ G K ++ +G + F+ V F+YP+R +  IL GL+L +Q GQTVALVG SGCGKS+ +QLMQR YD  EG V +D  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  +GRTTI++AHRLSTVRNA VI G  DG + E+G H ELM   G+Y  LV  Q
Sbjct:   36 VFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFAN----AGNLEDLMSN----ITNRSDINDT---------GFFM---NLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGE-YSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQ 629          

HSP 2 Score: 553.518 bits (1425), Expect = 1.252e-166
Identity = 271/583 (46.48%), Postives = 408/583 (69.98%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F+++M LN  E  Y  +G   AI NG +QP+F+I+F  ++       +P  ++Q++++  + +    + +++F++  LQ   FG +GE LTKR R + F +ML+QD++WFD+P N  GALTTRL+++A Q++G  G  L  +   I ++G  + ISF + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LT+E  F   Y ++++       +KAH  G  +  TQA ++ +YA  F    YL+ + +    +V + F A++FGAM +G+  + AP++ K KI+AAH+  ++++ P I+S+ST+G++ +   + G++    V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LP++Y TKVG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  697 FWRIMKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNL--FSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPN--TLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1275          

HSP 3 Score: 418.313 bits (1074), Expect = 7.902e-121
Identity = 235/540 (43.52%), Postives = 333/540 (61.67%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRR 2175
            +SN+F+L+      F  + +  FI  ++    F    +     +R   FR+++RQ++ WFD     +GALT +L +D   V   IG ++  + Q  A    GII++F+ GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS   E+     Y ++L    +  +RK+ + G        +M+ SYA  F +GA L+         D+L+VF + +     +GQ +     + +A+ +AA I  II++ P ID  + EG   N  +G +TF  V F YPTR D P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G+VL+D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI +LPNK  T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q     TKR+
Sbjct:  751 NSNLFSLL------FLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAH-KLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAG---TKRQ 1280          

HSP 4 Score: 371.318 bits (952), Expect = 3.196e-105
Identity = 222/595 (37.31%), Postives = 344/595 (57.82%), Query Frame = 2
Query: 2327 NAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--------NIEQQS------------ADIRTYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            N  +K Y+ +G ++AI +GA  P   ++FG +    AN         NI  +S             D+  Y    +GI     V++ +Q V F    +G Q+ K  R   F A+++Q+I WFD   +++G L TRL+D+ ++I    G+ +G    ++ +      + F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G     I+ +YA  F     L+L     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+S+S  G   D  N+ G+++  NV FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G + +D   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA++GRT +VIAHRLST++NAD I  F DG I E G H EL+ + GIY +++++Q+
Sbjct:   44 NWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQ-VSFWCLAAGRQIHK-IRKQFFHAIMRQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPD--NIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT 630          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Match: ABCB1 (ATP binding cassette subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:40])

HSP 1 Score: 562.377 bits (1448), Expect = 8.937e-170
Identity = 299/615 (48.62%), Postives = 403/615 (65.53%), Query Frame = 1
Query:  304 VGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            V  +F Y+   D + M+   + +I  G   PL++LVFG  T   A       +L   +++    IT+ + I D           F +   N+   M+  +  ++GI   + + +Y+ V+F+ + +  QI  IR  FF A+MRQ IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F  G I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY +NL+EA +IGI+K+I     +G    L++ SYAL FWYG +L+  G  + +G +L VFFS L+    +GQA+P + +F  AR AA EIF+IID  P ID  ++ G K ++ +G + F+ V F+YP+R +  IL GL+L +Q GQTVALVG SGCGKS+ +QLMQR YD  EG V +D  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  +GRTTI++AHRLSTVRNA VI G  DG + E+G H ELM   G+Y  LV  Q
Sbjct:   36 VFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFAN----AGNLEDLMSN----ITNRSDINDT---------GFFM---NLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGE-YSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQ 629          

HSP 2 Score: 553.518 bits (1425), Expect = 1.252e-166
Identity = 271/583 (46.48%), Postives = 408/583 (69.98%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F+++M LN  E  Y  +G   AI NG +QP+F+I+F  ++       +P  ++Q++++  + +    + +++F++  LQ   FG +GE LTKR R + F +ML+QD++WFD+P N  GALTTRL+++A Q++G  G  L  +   I ++G  + ISF + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LT+E  F   Y ++++       +KAH  G  +  TQA ++ +YA  F    YL+ + +    +V + F A++FGAM +G+  + AP++ K KI+AAH+  ++++ P I+S+ST+G++ +   + G++    V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LP++Y TKVG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  697 FWRIMKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNL--FSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPN--TLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1275          

HSP 3 Score: 418.313 bits (1074), Expect = 7.902e-121
Identity = 235/540 (43.52%), Postives = 333/540 (61.67%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRR 2175
            +SN+F+L+      F  + +  FI  ++    F    +     +R   FR+++RQ++ WFD     +GALT +L +D   V   IG ++  + Q  A    GII++F+ GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS   E+     Y ++L    +  +RK+ + G        +M+ SYA  F +GA L+         D+L+VF + +     +GQ +     + +A+ +AA I  II++ P ID  + EG   N  +G +TF  V F YPTR D P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G+VL+D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI +LPNK  T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q     TKR+
Sbjct:  751 NSNLFSLL------FLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAH-KLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAG---TKRQ 1280          

HSP 4 Score: 371.318 bits (952), Expect = 3.196e-105
Identity = 222/595 (37.31%), Postives = 344/595 (57.82%), Query Frame = 2
Query: 2327 NAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--------NIEQQS------------ADIRTYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            N  +K Y+ +G ++AI +GA  P   ++FG +    AN         NI  +S             D+  Y    +GI     V++ +Q V F    +G Q+ K  R   F A+++Q+I WFD   +++G L TRL+D+ ++I    G+ +G    ++ +      + F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G     I+ +YA  F     L+L     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+S+S  G   D  N+ G+++  NV FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G + +D   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA++GRT +VIAHRLST++NAD I  F DG I E G H EL+ + GIY +++++Q+
Sbjct:   44 NWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQ-VSFWCLAAGRQIHK-IRKQFFHAIMRQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPD--NIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT 630          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Match: ABCB1 (ATP binding cassette subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:40])

HSP 1 Score: 553.518 bits (1425), Expect = 2.283e-167
Identity = 271/583 (46.48%), Postives = 408/583 (69.98%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F+++M LN  E  Y  +G   AI NG +QP+F+I+F  ++       +P  ++Q++++  + +    + +++F++  LQ   FG +GE LTKR R + F +ML+QD++WFD+P N  GALTTRL+++A Q++G  G  L  +   I ++G  + ISF + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LT+E  F   Y ++++       +KAH  G  +  TQA ++ +YA  F    YL+ + +    +V + F A++FGAM +G+  + AP++ K KI+AAH+  ++++ P I+S+ST+G++ +   + G++    V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LP++Y TKVG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  633 FWRIMKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNL--FSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPN--TLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1211          

HSP 2 Score: 494.967 bits (1273), Expect = 3.480e-147
Identity = 253/460 (55.00%), Postives = 327/460 (71.09%), Query Frame = 1
Query:  769 LTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            L   +  D++ ++ GIGDKIG   Q  A F  G I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY +NL+EA +IGI+K+I     +G    L++ SYAL FWYG +L+  G  + +G +L VFFS L+    +GQA+P + +F  AR AA EIF+IID  P ID  ++ G K ++ +G + F+ V F+YP+R +  IL GL+L +Q GQTVALVG SGCGKS+ +QLMQR YD  EG V +D  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  +GRTTI++AHRLSTVRNA VI G  DG + E+G H ELM   G+Y  LV  Q
Sbjct:  107 LEEDMTSDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGE-YSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQ 565          

HSP 3 Score: 419.083 bits (1076), Expect = 1.644e-121
Identity = 235/540 (43.52%), Postives = 333/540 (61.67%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRR 2175
            +SN+F+L+      F  + +  FI  ++    F    +     +R   FR+++RQ++ WFD     +GALT +L +D   V   IG ++  + Q  A    GII++F+ GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS   E+     Y ++L    +  +RK+ + G        +M+ SYA  F +GA L+         D+L+VF + +     +GQ +     + +A+ +AA I  II++ P ID  + EG   N  +G +TF  V F YPTR D P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G+VL+D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI +LPNK  T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q     TKR+
Sbjct:  687 NSNLFSLL------FLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAH-KLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAG---TKRQ 1216          

HSP 4 Score: 327.791 bits (839), Expect = 2.967e-91
Identity = 203/574 (35.37%), Postives = 317/574 (55.23%), Query Frame = 2
Query: 2327 NAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP-NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            N  +K Y+ +G ++AI +GA  P   ++FG +    AN  N+E   ++I                 S + + GF             +  E  +  D++  +E                    G+ G+ +G    ++ +      + F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G     I+ +YA  F     L+L     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+S+S  G   D  N+ G+++  NV FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G + +D   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA++GRT +VIAHRLST++NAD I  F DG I E G H EL+ + GIY +++++Q+
Sbjct:   44 NWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITN--------------RSDINDTGF------------FMNLEEDMTSDVSKINE--------------------GI-GDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPD--NIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT 566          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Match: ABCB4 (ATP binding cassette subfamily B member 4 [Source:HGNC Symbol;Acc:HGNC:45])

HSP 1 Score: 554.288 bits (1427), Expect = 5.241e-167
Identity = 282/583 (48.37%), Postives = 406/583 (69.64%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPN---IEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F KV+ LN  E  Y  +G V AI NG +QP+FS++F  ++ A+  P    ++QQ  +I + +    GI  ++F +  LQ   FG +GE LT+R RS+ F+AML+QD++WFD+  N+ GAL+TRL+ +A Q++G +G  L  +   I ++G  + ISF + WQ++L++LA VPII V GI++++++ G +  DK  LE +GKIA E IENIRTV +LT+E  F   Y E +        +KAH  G  + ++QA ++ +YA  F    YL++    +  +V + F A++FGA+ LG + + AP++ K K++AAH+F L +R P I+S+S +G  L  +   G+I    V F+YP R N+ +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  + K +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + D+I++AAKA+NIH FI  LP +YET+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  697 FLKVLKLNKTEWPYFVVGTVCAIANGGLQPAFSVIFSEII-AIFGPGDDAVKQQKCNIFSLIFLFLGI--ISFFTFFLQGFTFGKAGEILTRRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGHMRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSYSEEG--LKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1274          

HSP 2 Score: 534.258 bits (1375), Expect = 4.836e-160
Identity = 289/616 (46.92%), Postives = 403/616 (65.42%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  LF Y+   D + M    IM+I  G   PL+++VFG  T +      ++++   F    + P+  S S+ +  +I+  +              M+  +  ++G+   + + +Y+ V+F+ + +  QI  IR  FF A++RQ IGWFD  ++  L  +L DDI+ +  GIGDK+G   Q  A F  G I+ F+RGWKLTLV ++ISP++ +   + +K +   + K   AY KAG +AEE LG+IRT+++F G+  E+ RY ++L+ A +IGI+K+I     +G+   L++ SYAL FWYG++L+     + +G+ + VFFS L+    +GQA P + +F  AR AA  IF+IID  P+ID  +E G K +  +G + F  V F+YP+R +  IL GL+L +Q GQTVALVG+SGCGKS+ +QL+QR YD +EG + ID  +I++ NV +LRE IGVVSQEPVLF  +I ENI YGR +VT +EI +A+  ANA  FI  LP K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE  VQ ALDK  EGRTTI++AHRLSTVRNA VI G +DG + EQG+H+ELM   G+Y  LV+ Q
Sbjct:   41 GVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDK------FVDTAGNF----SFPVNFSLSLLNPGKILEEE--------------MTRYAYYYSGLGAGVLVAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDDISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKE-YTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVHFSYPSRANVKILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENICYGRGNVTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELMKKEGVYFKLVNMQ 631          

HSP 3 Score: 415.616 bits (1067), Expect = 6.089e-120
Identity = 220/488 (45.08%), Postives = 318/488 (65.16%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ++ WFD    ++GAL+ +L  D   V    G ++  + Q  A    GII++F+ GW+LTL+ L++ P+I +  ++  K +    ++  +    AG IA E + +IRT+VS   E+   + Y E L    +  ++K+ + G    +    M+ SYA  F +GA LI  G+     D+++VF + +     +G A+     + +A+ +AA +F + +R P ID  +EEG K + F+G ITF  V F YPTR + P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G VL+D    K LNV WLR Q+G+VSQEP+LF CSI ENI YG     V+ +EI  A   AN   FI  LP+K +T VGD+GTQLSGGQKQRIAIARAL+R P+ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q
Sbjct:  787 LRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGH-MRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSYSEEGLKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQ 1273          

HSP 4 Score: 359.377 bits (921), Expect = 2.446e-101
Identity = 223/590 (37.80%), Postives = 346/590 (58.64%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG------------FLLP-----AMANPN--IEQQSADIRTYVIAL-AGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            +K ++ LG + AI +G+  P   I+FG            F  P     ++ NP   +E++      Y   L AG+ V A++      +    +G Q+ ++ R   F A+L+Q+I WFD   N+   L TRL+D+ ++I    G+ +G    A+ +  A   + F   W+++LV++A  PI+ +   +  +I+  FS+ +  A  ++G +A E +  IRTV     ++  ++ Y++ ++       KKA +     G+    I+ +YA  F     L++     + N    F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  ++ G+++  +V FSYP R N+ IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G I ID   I++ N+  LR++  +VSQEP LFS +I ENI YG      T D+I  A K +N ++FI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE  VQ ALDKA+EGRT +VIAHRLST++NAD I  F+DG I E G+H EL+ K G+Y +++++Q+
Sbjct:   53 DKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILEEEMTRYAYYYSGLGAGVLVAAYIQVSFWTLA---AGRQI-RKIRQKFFHAILRQEIGWFD--INDTTELNTRLTDDISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPD--SIKGNLEFNDVHFSYPSRANVKILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENICYGRGN--VTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELMKKEGVYFKLVNMQT 632          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Match: ABCB4 (ATP binding cassette subfamily B member 4 [Source:HGNC Symbol;Acc:HGNC:45])

HSP 1 Score: 554.288 bits (1427), Expect = 5.241e-167
Identity = 282/583 (48.37%), Postives = 406/583 (69.64%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPN---IEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F KV+ LN  E  Y  +G V AI NG +QP+FS++F  ++ A+  P    ++QQ  +I + +    GI  ++F +  LQ   FG +GE LT+R RS+ F+AML+QD++WFD+  N+ GAL+TRL+ +A Q++G +G  L  +   I ++G  + ISF + WQ++L++LA VPII V GI++++++ G +  DK  LE +GKIA E IENIRTV +LT+E  F   Y E +        +KAH  G  + ++QA ++ +YA  F    YL++    +  +V + F A++FGA+ LG + + AP++ K K++AAH+F L +R P I+S+S +G  L  +   G+I    V F+YP R N+ +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  + K +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + D+I++AAKA+NIH FI  LP +YET+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  697 FLKVLKLNKTEWPYFVVGTVCAIANGGLQPAFSVIFSEII-AIFGPGDDAVKQQKCNIFSLIFLFLGI--ISFFTFFLQGFTFGKAGEILTRRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGHMRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSYSEEG--LKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1274          

HSP 2 Score: 534.258 bits (1375), Expect = 4.836e-160
Identity = 289/616 (46.92%), Postives = 403/616 (65.42%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  LF Y+   D + M    IM+I  G   PL+++VFG  T +      ++++   F    + P+  S S+ +  +I+  +              M+  +  ++G+   + + +Y+ V+F+ + +  QI  IR  FF A++RQ IGWFD  ++  L  +L DDI+ +  GIGDK+G   Q  A F  G I+ F+RGWKLTLV ++ISP++ +   + +K +   + K   AY KAG +AEE LG+IRT+++F G+  E+ RY ++L+ A +IGI+K+I     +G+   L++ SYAL FWYG++L+     + +G+ + VFFS L+    +GQA P + +F  AR AA  IF+IID  P+ID  +E G K +  +G + F  V F+YP+R +  IL GL+L +Q GQTVALVG+SGCGKS+ +QL+QR YD +EG + ID  +I++ NV +LRE IGVVSQEPVLF  +I ENI YGR +VT +EI +A+  ANA  FI  LP K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE  VQ ALDK  EGRTTI++AHRLSTVRNA VI G +DG + EQG+H+ELM   G+Y  LV+ Q
Sbjct:   41 GVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDK------FVDTAGNF----SFPVNFSLSLLNPGKILEEE--------------MTRYAYYYSGLGAGVLVAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDDISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKE-YTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVHFSYPSRANVKILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENICYGRGNVTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELMKKEGVYFKLVNMQ 631          

HSP 3 Score: 415.616 bits (1067), Expect = 6.089e-120
Identity = 220/488 (45.08%), Postives = 318/488 (65.16%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ++ WFD    ++GAL+ +L  D   V    G ++  + Q  A    GII++F+ GW+LTL+ L++ P+I +  ++  K +    ++  +    AG IA E + +IRT+VS   E+   + Y E L    +  ++K+ + G    +    M+ SYA  F +GA LI  G+     D+++VF + +     +G A+     + +A+ +AA +F + +R P ID  +EEG K + F+G ITF  V F YPTR + P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G VL+D    K LNV WLR Q+G+VSQEP+LF CSI ENI YG     V+ +EI  A   AN   FI  LP+K +T VGD+GTQLSGGQKQRIAIARAL+R P+ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q
Sbjct:  787 LRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIANLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGH-MRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSYSEEGLKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQ 1273          

HSP 4 Score: 359.377 bits (921), Expect = 2.446e-101
Identity = 223/590 (37.80%), Postives = 346/590 (58.64%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG------------FLLP-----AMANPN--IEQQSADIRTYVIAL-AGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            +K ++ LG + AI +G+  P   I+FG            F  P     ++ NP   +E++      Y   L AG+ V A++      +    +G Q+ ++ R   F A+L+Q+I WFD   N+   L TRL+D+ ++I    G+ +G    A+ +  A   + F   W+++LV++A  PI+ +   +  +I+  FS+ +  A  ++G +A E +  IRTV     ++  ++ Y++ ++       KKA +     G+    I+ +YA  F     L++     + N    F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  ++ G+++  +V FSYP R N+ IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G I ID   I++ N+  LR++  +VSQEP LFS +I ENI YG      T D+I  A K +N ++FI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE  VQ ALDKA+EGRT +VIAHRLST++NAD I  F+DG I E G+H EL+ K G+Y +++++Q+
Sbjct:   53 DKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILEEEMTRYAYYYSGLGAGVLVAAYIQVSFWTLA---AGRQI-RKIRQKFFHAILRQEIGWFD--INDTTELNTRLTDDISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPD--SIKGNLEFNDVHFSYPSRANVKILKGLNLKVQSGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENICYGRGN--VTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELMKKEGVYFKLVNMQT 632          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Match: pgp-9 (p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EG58])

HSP 1 Score: 534.258 bits (1375), Expect = 2.928e-160
Identity = 286/631 (45.32%), Postives = 388/631 (61.49%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDM-EEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ-----KNRPWTKRRERR 2184
            +L+ Y +  D +M+   II+S   GV  PL+ ++ GN +    T        T FL   +     + +  +   E+++N                     ++  +   +F   ++  + F++  +   +  R  FF +VMRQ I W+D   SG L+NKL D++  V  G GDK+G   Q  A FIGG  +AF   W LTL+ +S+SP ++IC L L+K +     K ++ Y  AGGIAEEVL SIRT+++F G++YE  RY + L+   K GI+KS L G  L     +++ SY L FW G + +  G     G +L VFFS +M +  +GQA     +   A  AAA ++E+IDR+PEID  + EG   +   G+I+   V+FTYPTR D  IL G+SL  QPGQTVALVG+SGCGKS++IQL+QRFY+ + G++LIDD  I+D N+ +LR+ +GVVSQEP LF  SI++NIRYGR DV+DE+I +AL  ANA  FI   P  L+TLVGDRG Q+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ AL+    GRTTI++AHRLSTVRNA  I  +K G+V E GTH  L+   GLY +LV  Q      ++P  K  ERR
Sbjct:   33 QLYRYTSTVDRLMLAVGIIVSCATGVGLPLMSIIMGNVSQNFVTLG------TIFLDPNSTASEKAAARAEFSHEVIQN-------------------CLKYVYLGCGIFAAGFLQASCFMVICEKLSNRFRRQFFHSVMRQEIAWYDKNTSGTLSNKLFDNLERVREGTGDKVGLAFQMMAQFIGGFAVAFTYDWLLTLIMMSLSPFMMICGLFLAKLLATAATKEAKQYAVAGGIAEEVLTSIRTVIAFNGQEYECKRYEDALEHGKKTGIKKSFLIGAGLASFFVIIYASYCLAFWVGTNFVYSGR-LESGTVLTVFFSVMMGSMALGQAGQQFATIGTALGAAASLYEVIDRIPEIDAYSTEGQTPSKISGRISVNKVEFTYPTRADVKILKGVSLDAQPGQTVALVGSSGCGKSTIIQLLQRFYNPDAGQILIDDIPIEDFNIKYLRQLVGVVSQEPNLFNTSIEQNIRYGRSDVSDEDIARALKEANAADFIKTFPEGLNTLVGDRGVQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESESIVQSALENASRGRTTIVIAHRLSTVRNADKIIVMKAGQVMEVGTHETLIEQKGLYHELVHAQVFADVDDKPKKKEAERR 637          

HSP 2 Score: 443.351 bits (1139), Expect = 1.983e-129
Identity = 247/585 (42.22%), Postives = 352/585 (60.17%), Query Frame = 2
Query: 2300 AGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYN---MSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            A  FK++    PE  YIF   ++A+  GAV P+FS+ F  ++   +NP+ +Q   D   + +    +A V   S + Q   FG + E+LT R RS  +  +L+QD  +FD P ++ G +TTRL+ +A  I+      LG++  AI S+G  + I+F + WQ++ +V+A  P + VG  L ++   G + SD   +E +GK A+E IENIRTV  LT +      +   +    G    KA  +G  YG   +  F  YAA F   G  L+++   + +  NV     A+ F    +G + +  P + K   AA  +F +L+  P I+  ++ G       +SG++K+  V F YP RP + IL  ++ ++   QT+ALVGPSGCGKST+I LL+R YD L G + +DNN ++ +N ++LR+  ++VSQEP LF  SIRENI YG     +T +QI  A   +NIH FI  LPD YET+VGEKG+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESEK VQ ALD A + RTC+V+AHRLSTI NA  I+V K+G++ E GTH EL++K G Y  +   QS
Sbjct:  690 ANLFKILRYARPEWIYIFFAIIAALIQGAVMPAFSLFFSQIINVFSNPDRDQMKKDGHFWALMFLVLAAVQGTSMLFQCSLFGVAAERLTMRIRSKVYRNVLRQDATYFDMPKHSPGRITTRLATDAPNIKSAIDYRLGSIFNAIASVGGGLGIAFYYGWQMAFLVMAIFPFMAVGQALMMKYHGGSATSDAKEMENAGKTAMEAIENIRTVQALTLQTKLYNIFCSHLDAPHGGNISKAIIRGLTYGFANSIQFFTYAAAFRF-GLFLIFDKNVLMEPENVLRVLFAISFSFGTIGFAASYFPEYIKATFAAGLIFNMLEEEPRIDGMTSSGTY---PQLSGEVKLNKVFFRYPERPAVPILQGLNVHVKPGQTLALVGPSGCGKSTVISLLERLYDPLEGAVTVDNNDLRQMNPKHLRKHIALVSQEPILFDTSIRENIVYGLQPGEYTHEQIETACSKANIHKFIDELPDGYETRVGEKGTQLSGGQKQRIAIARALIRNPKILLLDEATSALDTESEKQVQVALDAAAKDRTCIVVAHRLSTIVNAGCIMVVKNGQVVEQGTHNELIAKRGAYFALTQKQS 1270          

HSP 3 Score: 343.584 bits (880), Expect = 1.714e-96
Identity = 205/514 (39.88%), Postives = 309/514 (60.12%), Query Frame = 2
Query: 2513 FVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYL---LLYNMS-KMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F +  LQ   F    E+L+ R R   F ++++Q+IAW+D+  N  G L+ +L D   ++R  +G+ +G     +       A++F + W ++L++++  P + + G+   +++   +  +      +G IA E + +IRTV     +    + Y++A++       KK+    FL G   A+ F    A++ LA ++    +Y+   +   V   F +++ G+M LG++       G    AAA ++E++DR+P I+++ST+G       +SG I +  V+F+YP R ++ IL  VS +    QT+ALVG SGCGKSTII LLQRFY+   G ILID+  I+D NI+ LRQL  +VSQEP LF+ SI +NI YG S    +D+ I  A K +N  DFI   P+   T VG++G   SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ AL+ A  GRT +VIAHRLST++NADKI+V K G++ E GTH  L+ + G+Y +++  Q
Sbjct:  117 FAAGFLQASCFMVICEKLSNRFRRQFFHSVMRQEIAWYDK--NTSGTLSNKLFDNLERVREGTGDKVGLAFQMMAQFIGGFAVAFTYDWLLTLIMMSLSPFMMICGLFLAKLLATAATKEAKQYAVAGGIAEEVLTSIRTVIAFNGQEYECKRYEDALEHGKKTGIKKS----FLIGAGLASFFVIIYASYCLAFWVGTNFVYSGRLESGTVLTVFFSVMMGSMALGQAGQQFATIGTALGAAASLYEVIDRIPEIDAYSTEGQT--PSKISGRISVNKVEFTYPTRADVKILKGVSLDAQPGQTVALVGSSGCGKSTIIQLLQRFYNPDAGQILIDDIPIEDFNIKYLRQLVGVVSQEPNLFNTSIEQNIRYGRSD--VSDEDIARALKEANAADFIKTFPEGLNTLVGDRGVQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESESIVQSALENASRGRTTIVIAHRLSTVRNADKIIVMKAGQVMEVGTHETLIEQKGLYHELVHAQ 620          

HSP 4 Score: 341.658 bits (875), Expect = 7.339e-96
Identity = 200/506 (39.53%), Postives = 297/506 (58.70%), Query Frame = 1
Query:  658 TFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTI--VSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGD-MLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRM--DVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKN 2154
            + F + ++     IR+  +R V+RQ+  +FD    + G +T +L  D   + + I  ++G +    A   GG+ +AF  GW++  + ++I P + +   ++ K         ++    AG  A E + +IRT+  ++ + + Y +  +  +LD      I K+I+ G   G    + F +YA  F +G  LI + N  +  + +L V F+   +   IG A  +   + +A  AA  IF +++  P ID M   G       G++    V F YP R   PIL GL++ ++PGQT+ALVG SGCGKS++I L++R YD  EG V +D+ +++ +N   LR+ I +VSQEP+LF  SI+ENI YG    + T E+I+ A   AN   FI+ LP+  +T VG++GTQLSGGQKQRIAIARAL+RNPKILLLDEATSALD+ESEK VQ ALD   + RT I+VAHRLST+ NA  I  +K+G+V EQGTH EL+A  G Y  L  +Q +
Sbjct:  769 SLFGVAAERLTMRIRSKVYRNVLRQDATYFDMPKHSPGRITTRLATDAPNIKSAIDYRLGSIFNAIASVGGGLGIAFYYGWQMAFLVMAIFPFMAVGQALMMKYHGGSATSDAKEMENAGKTAMEAIENIRTVQALTLQTKLYNI--FCSHLDAPHGGNISKAIIRGLTYGFANSIQFFTYAAAFRFGLFLIFDKNVLMEPENVLRVLFAISFSFGTIGFAASYFPEYIKATFAAGLIFNMLEEEPRIDGMTSSG-TYPQLSGEVKLNKVFFRYPERPAVPILQGLNVHVKPGQTLALVGPSGCGKSTVISLLERLYDPLEGAVTVDNNDLRQMNPKHLRKHIALVSQEPILFDTSIRENIVYGLQPGEYTHEQIETACSKANIHKFIDELPDGYETRVGEKGTQLSGGQKQRIAIARALIRNPKILLLDEATSALDTESEKQVQVALDAAAKDRTCIVVAHRLSTIVNAGCIMVVKNGQVVEQGTHNELIAKRGAYFALTQKQSS 1271          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Match: pgp-1 (Multidrug resistance protein pgp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34712])

HSP 1 Score: 491.115 bits (1263), Expect = 2.693e-145
Identity = 265/617 (42.95%), Postives = 381/617 (61.75%), Query Frame = 1
Query:  304 VGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSL-TQFL-TSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            + +L+ Y T  + +++    ++++  G   PL+ ++ G  +      Q  +N+  + FL T QN   T      D E  V N  +++                  A + + M+    ++VT ++  ++   + +R  F ++++RQ I WFD  +SG L  KL D++  V  G GDKIG   Q+ + FI G I+AF   W+LTLV L+++P+  +C   ++K+M     + +  Y KAG + EE + SIRT+VS  G +YE+ RY+  ++EA K G+ K +  G   G +    F S+AL F+ G   + +G+    GDML  F S +M +  +G A P +     A+ AA+ I+E++DR P ID  ++ G K    +G IT + V FTYP+R D PIL G++L +  GQTVALVG+SGCGKS++I L+ R+YD  +G++ ID  +++D+N+ +LR+ + VVSQEP LF C+I+ENI  G+  +T EE+  A  MANA+ FI  LPN  +TLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDK  +GRTTII+AHRLST+RNA +I   K+G+V E G H  LMA  GLY DLV  Q
Sbjct:   62 IPQLYRYTTTLEKLLLFIGTLVAVITGAGLPLMSILQGKVSQAFINEQIVINNNGSTFLPTGQNYTKT------DFEHDVMNVVWSY------------------AAMTVGMWAAGQITVTCYLYVAEQMNNRLRREFVKSILRQEISWFDTNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTLVMLAVTPIQALCGFAIAKSMSTFAIRETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFLGISFGAMQASNFISFALAFYIGVGWVHDGS-LNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAASGIYEVLDRKPVIDSSSKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCKNGQVVEVGDHRALMAQQGLYYDLVTAQ 653          

HSP 2 Score: 411.764 bits (1057), Expect = 9.201e-119
Identity = 235/586 (40.10%), Postives = 345/586 (58.87%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA-NPNIEQQSADIRT----YVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKM--TNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
             F+++    P    +F+G  +A   G + P++S+ F   +   A NP      AD  +    + +    +A    + S L     G + E LT+  R+  F  +L Q I +FD P N  G ++TRL+ +   +R         VIT + SM A + ++F + WQ++L+++A +PI+  G  L+ R   G +        +SGKIA+E IEN+RTV  L RE TF +++ E +     E  K+A  QG  YG   + ++      + +   L++ +   M    V     A+      LG + +  P + K   A   +F +L ++  I+S S  G   + + + G +  +NV+F+YP RP I IL  +SF++   QT+ALVGPSGCGKST++ LL+RFYDTL G I ID ++IK +N ++ R   +IVSQEPTLF  SI ENI YG      T  Q+  AA+ +NIH+FI  LP+ +ET+VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESEK+VQ+ALD+A+EGRTC+VIAHRL+T+ NAD I V  +G I E GTH +L+S+ G Y ++   Q
Sbjct:  740 LFEILYHARPHALSLFIGMSTATIGGFIYPTYSVFFTSFMNVFAGNP------ADFLSQGHFWALMFLVLAAAQGICSFLMTFFMGIASESLTRDLRNKLFRNVLSQHIGFFDSPQNASGKISTRLATDVPNLRTAIDFRFSTVITTLVSMVAGIGLAFFYGWQMALLIIAILPIVAFGQYLRGRRFTGKNVKSASEFADSGKIAIEAIENVRTVQALAREDTFYENFCEKLDIPHKEAIKEAFIQGLSYGCASSVLYLLNTCAYRMGLALIITDPPTMQPMRVLRVMYAITISTSTLGFATSYFPEYAKATFAGGIIFGMLRKISKIDSLSLAG---EKKKLYGKVIFKNVRFAYPERPEIEILKGLSFSVEPGQTLALVGPSGCGKSTVVALLERFYDTLGGEIFIDGSEIKTLNPEHTRSQIAIVSQEPTLFDCSIAENIIYGLDPSSVTMAQVEEAARLANIHNFIAELPEGFETRVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEKVVQEALDRAREGRTCIVIAHRLNTVMNADCIAVVSNGTIIEKGTHTQLMSEKGAYYKLTQKQ 1316          

HSP 3 Score: 370.163 bits (949), Expect = 4.737e-105
Identity = 216/537 (40.22%), Postives = 316/537 (58.85%), Query Frame = 1
Query:  562 LSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDA-QN-SGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLD----EACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            LS  + + LM      F  +A A  I S++   F  I S+     +RN  FR V+ Q+IG+FD+ QN SG ++ +L  D+  +   I  +   ++      + GI LAF  GW++ L+ ++I P++     +  +       K++  +  +G IA E + ++RT+ +   E      + E LD    EA K    + +  G    ++  L   +Y +G    A +I +        +L V ++  ++T+ +G AT +   + +A  A   IF ++ ++ +ID ++  G+K     GK+ FK V+F YP R +  IL GLS S++PGQT+ALVG SGCGKS+++ L++RFYD+  GE+ ID + IK LN    R QI +VSQEP LF CSI ENI YG     VT  ++++A  +AN   FI  LP   +T VGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESEK+VQ+ALD+  EGRT I++AHRL+TV NA  I  + +G + E+GTH +LM+  G Y  L  +Q
Sbjct:  790 LSQGHFWALM------FLVLAAAQGICSFLMTFFMGIASESLTRDLRNKLFRNVLSQHIGFFDSPQNASGKISTRLATDVPNLRTAIDFRFSTVITTLVSMVAGIGLAFFYGWQMALLIIAILPIVAFGQYLRGRRFTGKNVKSASEFADSGKIAIEAIENVRTVQALAREDTFYENFCEKLDIPHKEAIKEAFIQGLSYGCASSVLYLLNTCAYRMGL---ALIITDPPTMQPMRVLRVMYAITISTSTLGFATSYFPEYAKATFAGGIIFGMLRKISKIDSLSLAGEK-KKLYGKVIFKNVRFAYPERPEIEILKGLSFSVEPGQTLALVGPSGCGKSTVVALLERFYDTLGGEIFIDGSEIKTLNPEHTRSQIAIVSQEPTLFDCSIAENIIYGLDPSSVTMAQVEEAARLANIHNFIAELPEGFETRVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEKVVQEALDRAREGRTCIVIAHRLNTVMNADCIAVVSNGTIIEKGTHTQLMSEKGAYYKLTQKQ 1316          

HSP 4 Score: 359.762 bits (922), Expect = 1.539e-101
Identity = 223/601 (37.10%), Postives = 341/601 (56.74%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG------------------FLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK*IVQ*FKEGTY 4084
            EK  +F+G + A+  GA  P  SIL G                    LP   N        D+   V + A + V  + +  +    +    EQ+  R R    +++L+Q+I+WFD  +N+ G L T+L D   +++  +G+ +G     +        ++F   WQ++LV+LA  PI  + G    + M  F+  +     ++GK+  E I +IRTV +L      ++ Y  A+++       K    G  +G  QA+ F ++A  F +    +        ++  +F +++ G+M LG +       G  + AA+ ++E+LDR P I+S S  G   D++ + GDI +ENV F+YP RP++ IL  ++  +N+ QT+ALVG SGCGKSTII LL R+YD L G I ID   ++DIN++ LR+  ++VSQEP LF+ +I ENI+ G      T ++++AA K +N   FI  LP+ Y T VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ ALDKA +GRT ++IAHRLSTI+NAD I+  K+G++ E G H  L+++ G+Y  +++ Q+    V    EG +
Sbjct:   73 EKLLLFIGTLVAVITGAGLPLMSILQGKVSQAFINEQIVINNNGSTFLPTGQNYTKTDFEHDVMNVVWSYAAMTVGMWAAGQITVTCYLYVAEQMNNRLRREFVKSILRQEISWFD--TNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTLVMLAVTPIQALCGFAIAKSMSTFAIRETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFLGISFGAMQASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAASGIYEVLDRKPVIDSSSKAGRK-DMK-IKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEG--ITREEMVAACKMANAEKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCKNGQVVEVGDHRALMAQQGLYYDLVTAQTFTDAVDSAAEGKF 667          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 470.7 bits (1210), Expect = 5.944e-139
Identity = 257/610 (42.13%), Postives = 367/610 (60.16%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIV--RNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            +F Y    D++++I   + ++  G  +PL+ +V G  T             T FL +QN          + E +V     ++N  +    I+ L+ G         + MF  SYV +  F   ++  +  +R  + +A++RQ I WFD Q +G LT +L DD+  V  G+GDK   ++Q +A F+ G  + F   W +TLV +  +PLI++    +SK+M   T+   E Y  AG IAEE   SIRT+ S  G K E+ R+   L+   + GI K    G  +G     M+ SYAL FWYG++LI     F  G +  VFF+ L  +T +G A PH+ SF  AR AA+ +  +I+  P+ID  + EG  +++ +G I+FK V F YP+R D  +L G+SL ++ G  +ALVG+SGCGKS+++ L+QRFYD  +G VLID  +++++NV  LREQIG+VSQEPVLF  +I ENI+ G    T +++ +A  MANA  FI  LP+   T VG++G QLSGGQKQRIAIARALV+NPKILLLDEATSALD+E+E+ VQ ALD+   GRTTIIVAHRLST+RN   IF  K G + E G+H ELM+  G++ D+
Sbjct:   38 IFYYTQGVDLLLLITGTVAAVIHGAGFPLLAIVLGGMT-------------TVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLG---------VLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDKQQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNALEVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVDNMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 625          

HSP 2 Score: 422.165 bits (1084), Expect = 1.544e-122
Identity = 237/578 (41.00%), Postives = 358/578 (61.94%), Query Frame = 2
Query: 2309 FKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FK+   N  +  +   G   A   G+V P F++++  +    + P  +Q  A++  +      + +  FV         G  GE LT + R   F+ +L+QDIA++D+  +  G L TR + +A  +R V    L  V+ +I ++  A+ I F + WQ++L+++  VP++ +GG  ++++  G    D   LEE+GK+A + +E+IRTV +L R+  F   Y E +++      K AH  G ++  +Q+ IF  YAA F L    +     +  +V+  F A+ F    +G + +  P+  K ++AA+ +F L++   PI+S S  G+V   + ++G+I I NV F+YP R +  +L   + +I + +T+ALVG SGCGKSTI+GLL+RFY+   G I+ID + I+++NI +LR+   IVSQEPTLF  +I ENI YG +  + T  +I+ AAK +NIH+FI+ LPD Y+T VGEKG+  SGGQKQRIAIARAL+R+P +LLLDEATSALDTESEKIVQ+ALD A++GRTC+VIAHRLSTIQN+D I +  +GKI E GTH EL+ K+ IY +    Q
Sbjct:  688 FKIFKFNGDKVGWFIGGIFGAFIFGSVTPVFALVYAEIFNVYSLPA-DQMQANVYFWCGMFVLMGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRYVF-TRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFTYCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQQAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSGIV---KPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNV-TYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQ 1259          

HSP 3 Score: 369.392 bits (947), Expect = 4.720e-105
Identity = 217/584 (37.16%), Postives = 336/584 (57.53%), Query Frame = 2
Query: 2357 GCVSAIFNGAVQPSFSILFGFLLPAM--------------ANP------NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLY-----GLTQAAIFCAYAATFMLAGYLLLYNMS-KMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQM 4030
            G V+A+ +GA  P  +I+ G +                   NP      ++++ ++++  Y I    + V+ F +S +Q   F +  E+L  + R    +A+L+Q I WFD+     G LT RL+D+  ++R   G+    ++    +  A   + F + W ++LV++ F P+I + G    + M   +  ++     +G IA E   +IRTV +L      +  +  A+     EV ++     + Y     G +   ++ +YA  F     L++ + +     +F  F A++ G+ +LG ++    +FG  + AA+ +  +++  P I+ +S +G+++D  NM GDI  ++V F YP R +I +L  +S  + +   IALVG SGCGKSTI+ LLQRFYD   G +LID   ++++N+ +LR+   IVSQEP LF  +I ENI  G+     T DQ++ A K +N +DFI  LPD Y T+VGEKG   SGGQKQRIAIARAL++NP+ILLLDEATSALDTE+E+ VQ ALD+AQ GRT +++AHRLSTI+N D+I VFK G I ESG+H EL+SK GI+  M
Sbjct:   53 GTVAAVIHGAGFPLLAIVLGGMTTVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLGVLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDK--QQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNAL-----EVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVD--NMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHA--THDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 625          

HSP 4 Score: 332.413 bits (851), Expect = 6.408e-93
Identity = 200/540 (37.04%), Postives = 314/540 (58.15%), Query Frame = 1
Query:  574 NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFV--ITSQHQIS--------AIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG-RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 2151
            N+++L +   Q        MF++  + +TFFV   TS + +          +R   F+ ++RQ+I ++D     +G L  +   D   V   +  ++  ++       G + + F  GW+L L+ + + PL+++      +       + ++   +AG +A + +  IRT+ S  R E++    Y E L E     ++ +   G +      L+F  YA  F+ G+  + +       D+  VFF+       IG  T  +    +AR AA+ +F +I+    ID +++ G  +    G I+ + V F YPTR D  +L G +L I+ G+TVALVG SGCGKS+++ L++RFY+ ++G ++ID  NI++LN+  LREQ+ +VSQEP LF C+I ENI YG   +VT +EI +A  MAN   FI  LP+  DT VG++GTQLSGGQKQRIAIARALVR+P +LLLDEATSALD+ESEKIVQ+ALD   +GRT +++AHRLST++N+ VI  + +GK+ E+GTH EL+  + +Y+   + Q+
Sbjct:  727 NVYSLPADQMQANVYFWCGMFVL--MGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRY-VFTRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFT-YCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQ-QAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSG-IVKPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1260          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 471.085 bits (1211), Expect = 6.656e-139
Identity = 257/610 (42.13%), Postives = 367/610 (60.16%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIV--RNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            +F Y    D++++I   + ++  G  +PL+ +V G  T             T FL +QN          + E +V     ++N  +    I+ L+ G         + MF  SYV +  F   ++  +  +R  + +A++RQ I WFD Q +G LT +L DD+  V  G+GDK   ++Q +A F+ G  + F   W +TLV +  +PLI++    +SK+M   T+   E Y  AG IAEE   SIRT+ S  G K E+ R+   L+   + GI K    G  +G     M+ SYAL FWYG++LI     F  G +  VFF+ L  +T +G A PH+ SF  AR AA+ +  +I+  P+ID  + EG  +++ +G I+FK V F YP+R D  +L G+SL ++ G  +ALVG+SGCGKS+++ L+QRFYD  +G VLID  +++++NV  LREQIG+VSQEPVLF  +I ENI+ G    T +++ +A  MANA  FI  LP+   T VG++G QLSGGQKQRIAIARALV+NPKILLLDEATSALD+E+E+ VQ ALD+   GRTTIIVAHRLST+RN   IF  K G + E G+H ELM+  G++ D+
Sbjct:   45 IFYYTQGVDLLLLITGTVAAVIHGAGFPLLAIVLGGMT-------------TVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLG---------VLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDKQQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNALEVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVDNMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 632          

HSP 2 Score: 421.779 bits (1083), Expect = 2.007e-122
Identity = 237/578 (41.00%), Postives = 358/578 (61.94%), Query Frame = 2
Query: 2309 FKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FK+   N  +  +   G   A   G+V P F++++  +    + P  +Q  A++  +      + +  FV         G  GE LT + R   F+ +L+QDIA++D+  +  G L TR + +A  +R V    L  V+ +I ++  A+ I F + WQ++L+++  VP++ +GG  ++++  G    D   LEE+GK+A + +E+IRTV +L R+  F   Y E +++      K AH  G ++  +Q+ IF  YAA F L    +     +  +V+  F A+ F    +G + +  P+  K ++AA+ +F L++   PI+S S  G+V   + ++G+I I NV F+YP R +  +L   + +I + +T+ALVG SGCGKSTI+GLL+RFY+   G I+ID + I+++NI +LR+   IVSQEPTLF  +I ENI YG +  + T  +I+ AAK +NIH+FI+ LPD Y+T VGEKG+  SGGQKQRIAIARAL+R+P +LLLDEATSALDTESEKIVQ+ALD A++GRTC+VIAHRLSTIQN+D I +  +GKI E GTH EL+ K+ IY +    Q
Sbjct:  695 FKIFKFNGDKVGWFIGGIFGAFIFGSVTPVFALVYAEIFNVYSLPA-DQMQANVYFWCGMFVLMGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRYVF-TRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFTYCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQQAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSGIV---KPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNV-TYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQ 1266          

HSP 3 Score: 369.007 bits (946), Expect = 5.771e-105
Identity = 217/584 (37.16%), Postives = 336/584 (57.53%), Query Frame = 2
Query: 2357 GCVSAIFNGAVQPSFSILFGFLLPAM--------------ANP------NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLY-----GLTQAAIFCAYAATFMLAGYLLLYNMS-KMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQM 4030
            G V+A+ +GA  P  +I+ G +                   NP      ++++ ++++  Y I    + V+ F +S +Q   F +  E+L  + R    +A+L+Q I WFD+     G LT RL+D+  ++R   G+    ++    +  A   + F + W ++LV++ F P+I + G    + M   +  ++     +G IA E   +IRTV +L      +  +  A+     EV ++     + Y     G +   ++ +YA  F     L++ + +     +F  F A++ G+ +LG ++    +FG  + AA+ +  +++  P I+ +S +G+++D  NM GDI  ++V F YP R +I +L  +S  + +   IALVG SGCGKSTI+ LLQRFYD   G +LID   ++++N+ +LR+   IVSQEP LF  +I ENI  G+     T DQ++ A K +N +DFI  LPD Y T+VGEKG   SGGQKQRIAIARAL++NP+ILLLDEATSALDTE+E+ VQ ALD+AQ GRT +++AHRLSTI+N D+I VFK G I ESG+H EL+SK GI+  M
Sbjct:   60 GTVAAVIHGAGFPLLAIVLGGMTTVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLGVLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDK--QQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNAL-----EVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVD--NMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHA--THDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 632          

HSP 4 Score: 332.028 bits (850), Expect = 7.748e-93
Identity = 200/540 (37.04%), Postives = 314/540 (58.15%), Query Frame = 1
Query:  574 NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFV--ITSQHQIS--------AIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG-RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 2151
            N+++L +   Q        MF++  + +TFFV   TS + +          +R   F+ ++RQ+I ++D     +G L  +   D   V   +  ++  ++       G + + F  GW+L L+ + + PL+++      +       + ++   +AG +A + +  IRT+ S  R E++    Y E L E     ++ +   G +      L+F  YA  F+ G+  + +       D+  VFF+       IG  T  +    +AR AA+ +F +I+    ID +++ G  +    G I+ + V F YPTR D  +L G +L I+ G+TVALVG SGCGKS+++ L++RFY+ ++G ++ID  NI++LN+  LREQ+ +VSQEP LF C+I ENI YG   +VT +EI +A  MAN   FI  LP+  DT VG++GTQLSGGQKQRIAIARALVR+P +LLLDEATSALD+ESEKIVQ+ALD   +GRT +++AHRLST++N+ VI  + +GK+ E+GTH EL+  + +Y+   + Q+
Sbjct:  734 NVYSLPADQMQANVYFWCGMFVL--MGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRY-VFTRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFT-YCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQ-QAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSG-IVKPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1267          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 471.085 bits (1211), Expect = 8.121e-139
Identity = 257/610 (42.13%), Postives = 367/610 (60.16%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIV--RNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            +F Y    D++++I   + ++  G  +PL+ +V G  T             T FL +QN          + E +V     ++N  +    I+ L+ G         + MF  SYV +  F   ++  +  +R  + +A++RQ I WFD Q +G LT +L DD+  V  G+GDK   ++Q +A F+ G  + F   W +TLV +  +PLI++    +SK+M   T+   E Y  AG IAEE   SIRT+ S  G K E+ R+   L+   + GI K    G  +G     M+ SYAL FWYG++LI     F  G +  VFF+ L  +T +G A PH+ SF  AR AA+ +  +I+  P+ID  + EG  +++ +G I+FK V F YP+R D  +L G+SL ++ G  +ALVG+SGCGKS+++ L+QRFYD  +G VLID  +++++NV  LREQIG+VSQEPVLF  +I ENI+ G    T +++ +A  MANA  FI  LP+   T VG++G QLSGGQKQRIAIARALV+NPKILLLDEATSALD+E+E+ VQ ALD+   GRTTIIVAHRLST+RN   IF  K G + E G+H ELM+  G++ D+
Sbjct:   38 IFYYTQGVDLLLLITGTVAAVIHGAGFPLLAIVLGGMT-------------TVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLG---------VLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDKQQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNALEVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVDNMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 625          

HSP 2 Score: 421.394 bits (1082), Expect = 3.245e-122
Identity = 237/578 (41.00%), Postives = 358/578 (61.94%), Query Frame = 2
Query: 2309 FKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FK+   N  +  +   G   A   G+V P F++++  +    + P  +Q  A++  +      + +  FV         G  GE LT + R   F+ +L+QDIA++D+  +  G L TR + +A  +R V    L  V+ +I ++  A+ I F + WQ++L+++  VP++ +GG  ++++  G    D   LEE+GK+A + +E+IRTV +L R+  F   Y E +++      K AH  G ++  +Q+ IF  YAA F L    +     +  +V+  F A+ F    +G + +  P+  K ++AA+ +F L++   PI+S S  G+V   + ++G+I I NV F+YP R +  +L   + +I + +T+ALVG SGCGKSTI+GLL+RFY+   G I+ID + I+++NI +LR+   IVSQEPTLF  +I ENI YG +  + T  +I+ AAK +NIH+FI+ LPD Y+T VGEKG+  SGGQKQRIAIARAL+R+P +LLLDEATSALDTESEKIVQ+ALD A++GRTC+VIAHRLSTIQN+D I +  +GKI E GTH EL+ K+ IY +    Q
Sbjct:  712 FKIFKFNGDKVGWFIGGIFGAFIFGSVTPVFALVYAEIFNVYSLPA-DQMQANVYFWCGMFVLMGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRYVF-TRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFTYCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQQAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSGIV---KPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNV-TYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQ 1283          

HSP 3 Score: 368.622 bits (945), Expect = 9.731e-105
Identity = 217/584 (37.16%), Postives = 336/584 (57.53%), Query Frame = 2
Query: 2357 GCVSAIFNGAVQPSFSILFGFLLPAM--------------ANP------NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLY-----GLTQAAIFCAYAATFMLAGYLLLYNMS-KMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQM 4030
            G V+A+ +GA  P  +I+ G +                   NP      ++++ ++++  Y I    + V+ F +S +Q   F +  E+L  + R    +A+L+Q I WFD+     G LT RL+D+  ++R   G+    ++    +  A   + F + W ++LV++ F P+I + G    + M   +  ++     +G IA E   +IRTV +L      +  +  A+     EV ++     + Y     G +   ++ +YA  F     L++ + +     +F  F A++ G+ +LG ++    +FG  + AA+ +  +++  P I+ +S +G+++D  NM GDI  ++V F YP R +I +L  +S  + +   IALVG SGCGKSTI+ LLQRFYD   G +LID   ++++N+ +LR+   IVSQEP LF  +I ENI  G+     T DQ++ A K +N +DFI  LPD Y T+VGEKG   SGGQKQRIAIARAL++NP+ILLLDEATSALDTE+E+ VQ ALD+AQ GRT +++AHRLSTI+N D+I VFK G I ESG+H EL+SK GI+  M
Sbjct:   53 GTVAAVIHGAGFPLLAIVLGGMTTVFLRAQNSDFVVGVDNVNPEGLVPISLDEFNSEVVKYCIYYLVLGVLMFFTSYVQIACFESYAERLVHKLRQNYLKAILRQQIQWFDK--QQTGNLTARLTDDLERVREGLGDKFALLVQMFAAFLAGYGVGFFYSWSMTLVMMGFAPLIVLSGAKMSKSMATRTRVEQETYAVAGAIAEETFSSIRTVHSLNGHKRELDRFYNAL-----EVGRQTGIVKYCYMGIGVGFSNLCMYSSYALAFWYGSTLIINDPTFDRGLIFTVFFAVLSGSTSLGGALPHLASFGTARGAASTVLRVINSHPKIDPYSLEGILVD--NMKGDISFKDVHFRYPSRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHA--THDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFYDM 625          

HSP 4 Score: 332.413 bits (851), Expect = 8.440e-93
Identity = 200/540 (37.04%), Postives = 314/540 (58.15%), Query Frame = 1
Query:  574 NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFV--ITSQHQIS--------AIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG-RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 2151
            N+++L +   Q        MF++  + +TFFV   TS + +          +R   F+ ++RQ+I ++D     +G L  +   D   V   +  ++  ++       G + + F  GW+L L+ + + PL+++      +       + ++   +AG +A + +  IRT+ S  R E++    Y E L E     ++ +   G +      L+F  YA  F+ G+  + +       D+  VFF+       IG  T  +    +AR AA+ +F +I+    ID +++ G  +    G I+ + V F YPTR D  +L G +L I+ G+TVALVG SGCGKS+++ L++RFY+ ++G ++ID  NI++LN+  LREQ+ +VSQEP LF C+I ENI YG   +VT +EI +A  MAN   FI  LP+  DT VG++GTQLSGGQKQRIAIARALVR+P +LLLDEATSALD+ESEKIVQ+ALD   +GRT +++AHRLST++N+ VI  + +GK+ E+GTH EL+  + +Y+   + Q+
Sbjct:  751 NVYSLPADQMQANVYFWCGMFVL--MGITFFVGFFTSANCLGRCGESLTMKLRFEAFKNLLRQDIAFYDDLRHGTGKLCTRFATDAPNVRY-VFTRLPVVLASIVTICGALGIGFYYGWQLALILVVMVPLLVMGGYFEMQMRFGKQIRDTQLLEEAGKVASQAVEHIRTVHSLNRQEQFHFT-YCEYLREPFNTNLKHAHTYGAVFAFSQSLIFFMYAAAFYLGSIFVNQ-QAMQPIDVYRVFFAISFCGQMIGNTTSFIPDVVKARLAASLLFYLIEHPTPIDSLSDSG-IVKPITGNISIRNVFFNYPTRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1284          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Match: Mdr50 (gene:FBgn0010241 transcript:FBtr0087537)

HSP 1 Score: 477.633 bits (1228), Expect = 9.672e-141
Identity = 256/584 (43.84%), Postives = 372/584 (63.70%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKK-AHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
              +VM +N PE   I +GC+S++  G   P F++LFG +L  ++   N    +++++  +    +AGI V   +++ LQ   FG +GE+LT+R R + FEAML+Q++AWFD+ +N  G+L  RLS +A  ++G +G+ +G ++ +I ++   +A+S  + W + LV LAF P I +   +Q  +M   +      +E   K+AVE + NIRTV++L RE  F Q+Y   +     E+SK+  H +G +YGL ++ +F AYAA      + +++      +VF    ALI G  ++  ++A APN  KG  AA  +F  L R P I      GV  D  +  G ++ + VKFSYP R  I +L  +   ++  Q IALVGPSGCGKST I L+QRFYD   G  LID   ++++++ NLR    IVSQEP LF  +IRENI+YGD+A+  TD +II+A K SNIH+FI NLP  Y+T++GEKG+  SGGQKQRIAIARAL+RNP+I+LLDEATSALD ESEK+VQDALD A EGRT + IAHRLST+ ++D I VF++G + E+G H +LL+  G+Y  +  LQS
Sbjct:  732 MLEVMKMNKPEWLQIAVGCISSVIMGCAMPIFAVLFGSILQILSVKDNDQYVRENSNQYSLYFLIAGIVV--GIATFLQIYFFGIAGERLTERLRGLMFEAMLRQEVAWFDDKANGTGSLCARLSGDAAAVQGATGQRIGTIVQSISTLALGIALSMYYEWSLGLVALAFTPFILIAFYMQRTLMAKENMGSAKTMENCTKLAVEVVSNIRTVASLGREEMFHQNYIGMLIPA-VEISKRNTHFRGLVYGLARSLMFFAYAACMYYGTWCVIHRGILFGDVFKVSQALIMGTASIANALAFAPNMQKGVSAAKTIFTFLRRQPSI--VDRPGVSRDPWHSEGYVRFDKVKFSYPTRSEIQVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQRFYDVDEGATLIDECDVRNVSMTNLRNQLGIVSQEPILFDRTIRENISYGDNARNVTDQEIISACKKSNIHEFIANLPLGYDTRMGEKGAQLSGGQKQRIAIARALIRNPKIMLLDEATSALDAESEKVVQDALDAASEGRTTISIAHRLSTVVHSDVIFVFENGLVCEAGDHKQLLANRGLYYTLYKLQS 1310          

HSP 2 Score: 474.167 bits (1219), Expect = 1.325e-139
Identity = 270/619 (43.62%), Postives = 382/619 (61.71%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREG------NGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +LF YAT  D  + +  ++ ++  G+T P   L+FGN  + M      + S   +    ++ I++         ++ +K   F+L ++               I + M + SY+S+T F   +  QI  IR+ FFR+++ Q++ W+D   SG + +++ +D++ +  G+ +K+   + +   F+G ++LAFV+GW+L+LV L+  PL  I M +++    +L +K    Y  A  +AE  L  IRT+ +F GE  EVA Y E +  A  + I++++ +G   GL+   ++ SYAL FWYG  L+ +G        +  G M+ VFFS +M +  IG A P++ +F  A+ A A++F II+++PEI+ ++ EG KLN+    I FK V+F YPTR +  IL  L+L I  GQTVALVG SGCGKS+ IQL+QRFYD   G +L + TN+KDL++ WLR +IGVV QEP+LF  SI ENIRYGR D T EEI+ A   ANA  FI  LP   DTLVG+RG QLSGGQKQRIAIARAL+R+P+ILLLDEATSALD+ SE  VQ AL+KV  GRTTIIVAHRLSTVR A  I  I  G+V E GTH ELM L   Y +LV  Q
Sbjct:   75 QLFRYATKKDRALYVIGLLSAVATGLTTPANSLIFGNLANDMIDLGGLLESGKSY--RADDAIST---------LLLDKVRQFSLQNTY--------------IGIIMLVCSYLSITCFNYAAHSQILTIRSKFFRSILHQDMKWYDFNQSGEVASRMNEDLSKMEDGLAEKVVMFVHYLVAFVGSLVLAFVKGWQLSLVCLTSLPLTFIAMGLVAVATSRLAKKEVTMYAGAAVVAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKILNIKRNMFSGIGFGLLWFFIYASYALAFWYGVGLVIKGYHEPAYENYDAGTMITVFFSVMMGSMNIGMAAPYIEAFGIAKGACAKVFHIIEQIPEINPIDGEGKKLNEPLTTIEFKEVEFQYPTRPEVSILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQRFYDPQAGNLLFNGTNLKDLDINWLRSRIGVVGQEPILFATSIYENIRYGREDATREEIEAAAAAANAAIFIKKLPKGYDTLVGERGAQLSGGQKQRIAIARALIRDPEILLLDEATSALDTASEAKVQAALEKVSAGRTTIIVAHRLSTVRRADRIVVINKGEVVESGTHQELMELKDHYFNLVTTQ 668          

HSP 3 Score: 364.385 bits (934), Expect = 5.316e-103
Identity = 236/600 (39.33%), Postives = 334/600 (55.67%), Query Frame = 1
Query:  364 IMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEI-DKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            I S+ MG   P+  ++FG              S+ Q L           S+ D ++ VR     ++L     + L++G+     GIA      +++ + FF I  +     +R   F A++RQ + WFD  A  +G+L  +L  D   V    G +IG ++Q  +    GI L+    W L LV L+ +P I+I   M    M K    +++       +A EV+ +IRT+ S   E+     Y   L  A +I  R +   G + GL   LMF +YA   +YG   +    G L GD+  V  + +M T  I  A     +  +  SAA  IF  + R P I D+     D  +  +G + F  VKF+YPTR++  +L GL L++  GQ +ALVG SGCGKS+ IQL+QRFYD +EG  LID+ +++++++  LR Q+G+VSQEP+LF  +I+ENI YG    +VTD+EI  A   +N   FI  LP   DT +G++G QLSGGQKQRIAIARAL+RNPKI+LLDEATSALD+ESEK+VQDALD   EGRTTI +AHRLSTV ++ VIF  ++G V E G H +L+A  GLY  L   Q
Sbjct:  751 ISSVIMGCAMPIFAVLFG--------------SILQIL-----------SVKDNDQYVRENSNQYSL-----YFLIAGI---VVGIA------TFLQIYFFGIAGERLTERLRGLMFEAMLRQEVAWFDDKANGTGSLCARLSGDAAAVQGATGQRIGTIVQSISTLALGIALSMYYEWSLGLVALAFTPFILIAFYMQRTLMAKENMGSAKTMENCTKLAVEVVSNIRTVASLGREEMFHQNYIGMLIPAVEISKRNTHFRGLVYGLARSLMFFAYAACMYYGTWCVIH-RGILFGDVFKVSQALIMGTASIANALAFAPNMQKGVSAAKTIFTFLRRQPSIVDRPGVSRDPWHS-EGYVRFDKVKFSYPTRSEIQVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQRFYDVDEGATLIDECDVRNVSMTNLRNQLGIVSQEPILFDRTIRENISYGDNARNVTDQEIISACKKSNIHEFIANLPLGYDTRMGEKGAQLSGGQKQRIAIARALIRNPKIMLLDEATSALDAESEKVVQDALDAASEGRTTISIAHRLSTVVHSDVIFVFENGLVCEAGDHKQLLANRGLYYTLYKLQ 1309          

HSP 4 Score: 300.827 bits (769), Expect = 1.683e-82
Identity = 209/594 (35.19%), Postives = 316/594 (53.20%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAM--------------ANPNIEQQSAD-IRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL----------YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            ++    +G +SA+  G   P+ S++FG L   M              A+  I     D +R + +    I ++  V S L    F  +        RS  F ++L QD+ W+D   N  G + +R++++ +++     E +   +  + +   ++ ++F   WQ+SLV L  +P+ F+   L        +  +      +  +A   +  IRTV     E   +  YKE +        K+    G  +GL    I+ +YA  F     L++          Y+   M  VF S   ++ G+MN+G +      FG  K A A +F +++++P IN    +G  L+ E ++  I+ + V+F YP RP + ILN ++  I+  QT+ALVGPSGCGKST I L+QRFYD   GN+L +   +KD++I  LR    +V QEP LF+ SI ENI YG      T ++I AAA A+N   FI  LP  Y+T VGE+G+  SGGQKQRIAIARAL+R+P ILLLDEATSALDT SE  VQ AL+K   GRT +++AHRLST++ AD+I+V   G++ ESGTH EL+     Y  +++ Q
Sbjct:   84 DRALYVIGLLSAVATGLTTPANSLIFGNLANDMIDLGGLLESGKSYRADDAISTLLLDKVRQFSLQNTYIGIIMLVCSYLSITCFNYAAHSQILTIRSKFFRSILHQDMKWYD--FNQSGEVASRMNEDLSKMEDGLAEKVVMFVHYLVAFVGSLVLAFVKGWQLSLVCLTSLPLTFIAMGLVAVATSRLAKKEVTMYAGAAVVAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKILNIKRNMFSGIGFGLLWFFIYASYALAFWYGVGLVIKGYHEPAYENYDAGTMITVFFS---VMMGSMNIGMAAPYIEAFGIAKGACAKVFHIIEQIPEINPIDGEGKKLN-EPLT-TIEFKEVEFQYPTRPEVSILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQRFYDPQAGNLLFNGTNLKDLDINWLRSRIGVVGQEPILFATSIYENIRYGREDA--TREEIEAAAAAANAAIFIKKLPKGYDTLVGERGAQLSGGQKQRIAIARALIRDPEILLLDEATSALDTASEAKVQAALEKVSAGRTTIIVAHRLSTVRRADRIVVINKGEVVESGTHQELMELKDHYFNLVTTQ 668          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Match: Mdr65 (gene:FBgn0004513 transcript:FBtr0077011)

HSP 1 Score: 449.129 bits (1154), Expect = 3.579e-131
Identity = 242/584 (41.44%), Postives = 363/584 (62.16%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALA--GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINS--FSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXX-XXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F +++ L   E CY+ LG +SA+  G + P+F+++FG    A+A  + E   A  RT V++ A  G+A +  +   LQ   F  +G  LT R R++TF AM+ Q++ WFD+ +N++GAL+ RLS EA  I+G  G  L  +I A+ +  ++V+++  + W+++L+ LA  PII    IL+ ++M      +K  +EE+ +IA E I NIRTV+ L RE   I+ Y E I++++  + +K   +G L    QA+ F AYA      G L+        ++      L++G+M L +S+A  P F    IA   +F++LDR P I S   +    +    N+   ++   ++F YP RP+  ILN +   +   QT+ALVG SGCGKST + LLQR+YD       +  ++   D+ +  +R    IVSQEPTLF  SI ENIAYGD+ +  +  +IIAAAK++N H FI++LP+ Y+T++G +G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD +SE++VQ ALD A  GRTC+VIAHRLST+QNAD I V ++G++ E G H +L+S+ GIY+++   Q
Sbjct:  718 FSRILQLAKQEWCYLILGTISAVAVGFLYPAFAVIFGEFYAALAEKDPE--DALRRTAVLSWACLGLAFLTGLVCFLQTYLFNYAGIWLTTRMRAMTFNAMVNQEVGWFDDENNSVGALSARLSGEAVDIQGAIGYPLSGMIQALSNFISSVSVAMYYNWKLALLCLANCPIIVGSVILEAKMMSNAVVREKQVIEEACRIATESITNIRTVAGLRREADVIREYTEEIQRVEVLIRQKLRWRGVLNSTMQASAFFAYAVALCYGGVLVSEGQLPFQDIIKVSETLLYGSMMLAQSLAFTPAFSAALIAGHRLFQILDRKPKIQSPMGTIKNTLAKQLNLFEGVRYRGIQFRYPTRPDAKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDGVRTKLGIVSQEPTLFERSIAENIAYGDNRRSVSMVEIIAAAKSANAHSFIISLPNGYDTRMGARGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDTACSGRTCIVIAHRLSTVQNADVICVIQNGQVVEQGNHMQLISQGGIYAKLHKTQ 1299          

HSP 2 Score: 432.565 bits (1111), Expect = 1.127e-125
Identity = 252/626 (40.26%), Postives = 365/626 (58.31%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQN----------EPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLI-----REGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLN-DFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            KLF ++T  +I  +    IM     +T P +++++   TS +      ++   QF TS N          + +T+++   + E +     Y+ ++S   + T+ S          + MFI    SV  F + +  Q++ +R   F +V+RQ+IGW D  +    T  +VDD+  +  GI +K+G  +     FI  + ++F  GWKLTL   S  PL+I+    ++K   KLT +  E+Y  AG +AEE+L SIRT+VSF GEK EV RY   L  A K    K   +G    ++  +++ S A  FWYG +LI      E   +    ++I FF  ++    I +  P + SF  AR  A  +F++ID   +ID ++ +G  LN   +G + F+ V F YP+R +  +  GL++ I+ GQTVALVG+SGCGKS+ +QL+QRFYD   G VL+DD +I+  N+ WLR  I VV QEPVLF  +I +NI YG+   T +EI+ A   A A  FI  LP    +++G+RG+QLSGGQKQRIAIARAL++NPKILLLDEATSALD +SEK VQ ALD   +GRTTI+V+HRLS +R A  I  I DGKV E+G+H +LMAL G Y ++V
Sbjct:   35 KLFRFSTYGEIGWLFFGFIMCCIKALTLPAVVIIYSEFTSML------VDRAMQFGTSSNVHALPLFGGGKTLTNASREENNEAL-----YDDSISYGILLTIAS----------VVMFISGIFSVDVFNMVALRQVTRMRIKLFSSVIRQDIGWHDLASKQNFTQSMVDDVEKIRDGISEKVGHFVYLVVGFIITVAISFSYGWKLTLAVSSYIPLVILLNYYVAKFQGKLTAREQESYAGAGNLAEEILSSIRTVVSFGGEKSEVQRYENFLVPARKASQWKGAFSGLSDAVLKSMLYLSCAGAFWYGVNLIIDDRNVENKEYTPAILMIAFFGIIVGADNIARTAPFLESFATARGCATNLFKVIDLTSKIDPLSTDGKLLNYGLRGDVEFQDVFFRYPSRPEVIVHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVLLDDLDIRKYNIQWLRSNIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHEFITNLPESYRSMIGERGSQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSHRLSAIRGADKIVFIHDGKVLEEGSHDDLMALEGAYYNMV 639          

HSP 3 Score: 352.058 bits (902), Expect = 4.425e-99
Identity = 215/525 (40.95%), Postives = 312/525 (59.43%), Query Frame = 1
Query:  616 GIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIX-XXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDK-----MNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIK-DLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
            G+A    ++ ++    F        + +R   F A++ Q +GWFD +N+  GAL+ +L  +   +   IG  +  M+Q  + FI  + +A    WKL L+ L+  P+I+  +++ +K M     +  +   +A  IA E + +IRT+   R E   +  YTE + +  ++ IR+ +   G L   +    F +YA+   YG  L+ EG      D++ V  + L  +  + Q+     +F+ A  A   +F+I+DR P+I        N    +LN F+G + ++ ++F YPTR D  IL GL L +  GQTVALVG SGCGKS+ +QL+QR+YD +EG + ID  +I+ DL +  +R ++G+VSQEP LF  SI ENI YG  R  V+  EI  A   ANA +FI +LPN  DT +G RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD +SE++VQ ALD    GRT I++AHRLSTV+NA VI  I++G+V EQG H +L++  G+Y  L   QK+ 
Sbjct:  781 GLAFLTGLVCFLQTYLFNYAGIWLTTRMRAMTFNAMVNQEVGWFDDENNSVGALSARLSGEAVDIQGAIGYPLSGMIQALSNFISSVSVAMYYNWKLALLCLANCPIIVGSVILEAKMMSNAVVREKQVIEEACRIATESITNIRTVAGLRREADVIREYTEEI-QRVEVLIRQKLRWRGVLNSTMQASAFFAYAVALCYGGVLVSEGQ-LPFQDIIKVSETLLYGSMMLAQSLAFTPAFSAALIAGHRLFQILDRKPKIQSPMGTIKNTLAKQLNLFEG-VRYRGIQFRYPTRPDAKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDGVRTKLGIVSQEPTLFERSIAENIAYGDNRRSVSMVEIIAAAKSANAHSFIISLPNGYDTRMGARGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDTACSGRTCIVIAHRLSTVQNADVICVIQNGQVVEQGNHMQLISQGGIYAKLHKTQKDH 1302          

HSP 4 Score: 322.783 bits (826), Expect = 1.539e-89
Identity = 199/552 (36.05%), Postives = 309/552 (55.98%), Query Frame = 2
Query: 2408 LFG---FLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTN-------VFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMI 4033
            LFG    L  A    N E    D  +Y I L   +VV F+S +     F     +   R R   F ++++QDI W D  S      T  + D+  +IR    E +G  +  +      VAISF + W+++L V +++P++ +      +     +  ++ +   +G +A E + +IRTV +   E + +Q Y+  +         K    G    + ++ ++ + A  F   G  L+ +   + N       + I+F  +I GA N+ ++     +F   +  A ++F+++D    I+  STDG +L+   + GD++ ++V F YP RP +I+   ++  I + QT+ALVG SGCGKST + LLQRFYD + G++L+D+  I+  NIQ LR   ++V QEP LF  +I +NI+YG      T  +I AAA  +  H+FI NLP+ Y + +GE+GS  SGGQKQRIAIARAL++NP+ILLLDEATSALD +SEK VQ ALD A +GRT +V++HRLS I+ ADKI+   DGK+ E G+H +L++  G Y  M+
Sbjct:   94 LFGGGKTLTNASREENNEALYDDSISYGILLTIASVVMFISGIFSVDVFNMVALRQVTRMRIKLFSSVIRQDIGWHDLASKQ--NFTQSMVDDVEKIRDGISEKVGHFVYLVVGFIITVAISFSYGWKLTLAVSSYIPLVILLNYYVAKFQGKLTAREQESYAGAGNLAEEILSSIRTVVSFGGEKSEVQRYENFLVPARKASQWKGAFSGLSDAVLKSMLYLSCAGAFWY-GVNLIIDDRNVENKEYTPAILMIAFFGIIVGADNIARTAPFLESFATARGCATNLFKVIDLTSKIDPLSTDGKLLNY-GLRGDVEFQDVFFRYPSRPEVIVHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVLLDDLDIRKYNIQWLRSNIAVVGQEPVLFLGTIAQNISYGKPGA--TQKEIEAAATQAGAHEFITNLPESYRSMIGERGSQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSHRLSAIRGADKIVFIHDGKVLEEGSHDDLMALEGAYYNMV 639          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Match: Mdr49 (gene:FBgn0004512 transcript:FBtr0087801)

HSP 1 Score: 436.032 bits (1120), Expect = 7.284e-127
Identity = 247/633 (39.02%), Postives = 371/633 (58.61%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNS------LTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNG-----FLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRE 2178
            LF Y+T  +  +++ +++++       P  ++++G  TS +      + +      L  F   Q   +T+++   + + I+ +       ++  I +L+          ++AMF++  +++      + +QI  IR  F  A++RQ+I W+D  +     +K+ +D++ +  GIG+KI  ++     F+ GI+ AFV GWKLTLV LS  P II    ++++    L +K  ++Y  A  + EEV   IRT+ +F G++ E  R+ + L  A   G +K + +G    L   +++   AL  WYG +LI +        +    ++IV F+ +M    +G A+PH+ +   A +A   +F IIDR  ++D M+E+G++  +  G I F+ ++F YP R D  IL GL++ + PGQTVA VGASGCGKS+LIQLMQRFYD   G V +D  +++ LNV WLR QIGVV QEPVLF  +I ENIRYGR   T  +I++A   AN   FI  LP   DT VG++G Q+SGGQKQRIAIARALVR P++LLLDEATSALD  SEK VQ AL+   +G TT++VAHRLST+ NA  I  +KDG V EQGTH ELM   GLY +LV   + +  T+  E
Sbjct:   34 LFRYSTRCERFLLVVSLLVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGGQQ--LTNASKEENNQAIIDDA------TAFGIGSLVG---------SVAMFLLITLAIDLANRIALNQIDRIRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAGHIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADE 649          

HSP 2 Score: 407.912 bits (1047), Expect = 1.676e-117
Identity = 231/592 (39.02%), Postives = 356/592 (60.14%), Query Frame = 2
Query: 2294 SSAGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRV-----PPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDD----QIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            S   F ++M LN+PE  +I +G ++++ +GA  P + + FG     +++ + +   A++    +   GI ++A + ++LQ   F  +G ++T R R   F  ++ QDIA+FD+  N++GAL +RL+ + + ++G +G  +G ++ A+ ++   + + F F WQ +L+ L  +P++ +   L+ R +   +   K ++EE+ ++AVE I NIRTV+ L  E   +  Y + I ++D    +K   +G ++ L QAA F AY  +    G L+        ++     ALIFG+  LG+++A APN     ++A  + +L  R      PP + ++T      VE   GDI  ENV F YP R    IL  ++  I  + T+ALVGPSG GKST + LL R+YD ++G++ +      +  +  LR    +VSQEP LF  +I ENIAYG++   F DD    +II AAK SNIH+FI  LP  Y+T++G K S  SGGQKQRIAIARAL+RNP+IL+LDEATSALD ESEK+VQ ALD+A+ GRTC+ IAHRL+T++NAD I V K G + E GTH EL++ N IY+ +  +Q
Sbjct:  717 SKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFPLWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRVDIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPYNT------VEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNN---FRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLG-KTSQLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQ 1298          

HSP 3 Score: 318.161 bits (814), Expect = 4.870e-88
Identity = 185/499 (37.07%), Postives = 279/499 (55.91%), Query Frame = 2
Query: 2573 RCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVF------ISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            R R +  EAML+QDIAW+D  S +     ++++++  +++   GE +  V+  I +    +  +F + W+++LVVL+ VP I     +  R+    +  +  +  ++  +  E    IRTV   + +    + + + +   +    KK    G    L+   I+   A        L+L        V+      I   A+I GA NLG +            A   +F ++DR   ++     G     EN +G I+ E ++F YP RP++ IL  ++ ++   QT+A VG SGCGKST+I L+QRFYD   G++ +D   ++ +N+  LR    +V QEP LF+ +I ENI YG  +    D  I  AA+A+N HDFI  LP  Y+T+VGEKG+  SGGQKQRIAIARAL+R P++LLLDEATSALD  SEK VQ AL+ A +G T +V+AHRLSTI NADKI+  KDG +AE GTH EL+ + G+Y +++S+   K
Sbjct:  150 RIRKLFLEAMLRQDIAWYDTSSGS--NFASKMTEDLDKLKEGIGEKIVIVVFLIMTFVIGIVSAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGN--RPENTAGHIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQAD--IEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRK 642          

HSP 4 Score: 295.819 bits (756), Expect = 6.659e-81
Identity = 202/522 (38.70%), Postives = 301/522 (57.66%), Query Frame = 1
Query:  598 MSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDE---ACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVP-EIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG---RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            +S  F GI L   + + +    F        + +R   F  ++ Q+I +FD + +  GAL ++L  D + V    G ++G M+Q  A  + G+++ FV  W+ TL+TL   PL+ + + +  + +MK  QKA  +  +A  +A E + +IRT+     E+  + +Y + +D    AC+   RK    G +  L     F +Y +  +YG  L+ E       D++ V  + +  +  +GQA  +  + N+A  +A  + ++  R   + +      + +   +G I ++ V F YPTR   PIL GL+L+I+   TVALVG SG GKS+ +QL+ R+YD   G V +      +  +  LR ++G+VSQEPVLF  +I ENI YG   R DV+ +EI +A   +N   FI+ALP   DT +G + +QLSGGQKQRIAIARALVRNPKIL+LDEATSALD ESEK+VQ ALD+   GRT + +AHRL+TVRNA +I  +K G V E GTH ELMALN +Y +L
Sbjct:  778 ISMIFVGIGLMAGLGNMLQTYMFTTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQGATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGRFIMKSAQKAKASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRVDIACR---RKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEER-MNYEDIIKVAEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLG-KTSQLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANL 1294          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Match: CG10226 (gene:FBgn0035695 transcript:FBtr0332068)

HSP 1 Score: 429.483 bits (1103), Expect = 2.331e-125
Identity = 231/591 (39.09%), Postives = 352/591 (59.56%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQ---QSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFST-------DGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXX-XXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            FF+++G   PE  ++ +G + A   G   P FS++   L  ++A P  E+   QSA +   +I+L  I + A V   +Q   F  +G  LT R RS TF  ++ Q++ WFD   N+IGAL+ RLS +A  ++G  G  L  +I A  +   ++AI+F + W+++L+ L+  P +    + + R  +  +  +K  LEE+ +IA E I  IRTV+ L RE   I+ Y + +++   ++  +   +G +  L ++ +F  YA T    G++      K   +      +++G   L +S+A  P F    ++A  M+E++DR P I S  +       +G       +   +    + FSYP RP+I +L + + +IN  QT+ALVG SG GKST + LL R+YD      ++   +   D++++ LR+   IVSQEP+LF  SI +NI YGD+++     QII AAK +N H+FI++LP QY+T +G KG+  SGGQKQRIAIARA++RNP+ILLLDEATSALD +SE++VQ ALD A  GRTC+VIAHRLSTIQNA+ I V + GKI E G+H +LL+KNGIYS++   Q+
Sbjct:  616 FFRILGWARPEWSFLIIGAICAGLYGVTMPVFSVVLAELYGSLAKPTDEEVLEQSASMA--IISLV-IGIAAGVVCYIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFFGYAVTLTYGGHMCADGKIKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSANRMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQQGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRRRLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQLSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKLYRCQT 1203          

HSP 2 Score: 396.356 bits (1017), Expect = 2.631e-114
Identity = 211/491 (42.97%), Postives = 305/491 (62.12%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIR---------EGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLN-DFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            +R  FF+A +RQ IGW D         ++ D++  + +GI + +G  ++     I  ++L+F+ GWKL L  +   PL ++    ++    KLT +   +Y +A  + EEV+G+IRT+V+F GE+ E  RY   L  A K G  K   +G    ++  ++F + A  FWYGA+LI          +   +    ++IV    +++   I + +P + +F  AR +A+ I ++IDR   ID +++ G  LN   +G + F+ V F YP R D  +L GL++ ++ GQTVALVG SGCGKS+ IQL+QRFYD   G+VL+D  +++  N+ WLR  I VV QEPVLF  SI ENIR+G+ + T +E++ A   ANA  FI AL    DT + ++G QLSGGQ+QRIAIARAL++ PKILLLDEATSALD  SEK+VQ ALDK  +GRTT++V+HRLS +R+AH I  I++GK  EQGTH ELM L G Y  +V
Sbjct:   44 MRREFFKATLRQEIGWHDMAKDQNFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKAGKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETFAMARGSASAILDVIDRTSLIDPLSKAGKILNYGLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRSNIAVVGQEPVLFQGSIGENIRHGKPEATQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQLSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMV 534          

HSP 3 Score: 347.051 bits (889), Expect = 5.620e-98
Identity = 208/528 (39.39%), Postives = 309/528 (58.52%), Query Frame = 1
Query:  619 IALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEK-------YEVARYTENLDEACKI-GIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEID-----KMNEEGD----KLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIK-DLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            I +A  ++ Y+   FF +      + +R+  FR +M Q +GWFD  +NS GAL+ +L  D  +V   IG  +  ++Q +  FI  I +AF   W+L L+ LS SP ++  ++  ++   K   K  E   +   IA E +  IRT+   R E+        EV RY   +    K  G+  S+    +           YA+   YG  +  +G       ++ +  + L     + Q+     +FN A  +A  ++EIIDR P+I      ++ + G+    K N  Q  ++++ + F+YP+R    +L   +L I  GQTVALVGASG GKS+ +QL+ R+YD +EG++LID  +I  D+++  LR ++G+VSQEP LF  SI +NI YG     V  ++I +A  MANA  FI +LP + DT++G +GTQLSGGQKQRIAIARA+VRNPKILLLDEATSALD +SE++VQ ALD    GRT I++AHRLST++NA+VI  I+ GK+ EQG+H++L+A NG+Y  L
Sbjct:  680 IGIAAGVVCYIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFF--------GYAVTLTYGGHMCADGK-IKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSANRMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQQGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRRRLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQLSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKL 1198          

HSP 4 Score: 300.056 bits (767), Expect = 1.238e-82
Identity = 181/506 (35.77%), Postives = 280/506 (55.34%), Query Frame = 2
Query: 2561 QLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLY--------NMSKMTN--VFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            +LT R R   F+A L+Q+I W D   +       R++D   +IR    E+LG  +  +C +  +V +SF + W+++L ++ ++P+  V            +  ++ +   +  +  E I  IRTV     E +    Y   +K        K    G    + +A +F   A +F     L+LY        +  + T   V I    +I  A  + ++      F   + +A+ + +++DR   I+  S  G +L+   + G ++  +V F YP R ++I+L  ++  +   QT+ALVGPSGCGKST I LLQRFYD + G +L+D   ++  NI+ LR   ++V QEP LF  SI ENI +G      T  ++  AAKA+N HDFI+ L   Y+T + EKG   SGGQ+QRIAIARAL++ P+ILLLDEATSALD  SEK+VQ ALDKA +GRT +V++HRLS I++A +I+  ++GK  E GTH EL+   G Y +M+++ S+
Sbjct:   39 KLTVRMRREFFKATLRQEIGWHDMAKDQ--NFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKAGKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETFAMARGSASAILDVIDRTSLIDPLSKAGKILNY-GLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRSNIAVVGQEPVLFQGSIGENIRHGKPEA--TQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQLSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMVTVHSY 539          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Match: CG10226 (gene:FBgn0035695 transcript:FBtr0077012)

HSP 1 Score: 429.483 bits (1103), Expect = 1.702e-124
Identity = 231/591 (39.09%), Postives = 352/591 (59.56%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQ---QSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFST-------DGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXX-XXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            FF+++G   PE  ++ +G + A   G   P FS++   L  ++A P  E+   QSA +   +I+L  I + A V   +Q   F  +G  LT R RS TF  ++ Q++ WFD   N+IGAL+ RLS +A  ++G  G  L  +I A  +   ++AI+F + W+++L+ L+  P +    + + R  +  +  +K  LEE+ +IA E I  IRTV+ L RE   I+ Y + +++   ++  +   +G +  L ++ +F  YA T    G++      K   +      +++G   L +S+A  P F    ++A  M+E++DR P I S  +       +G       +   +    + FSYP RP+I +L + + +IN  QT+ALVG SG GKST + LL R+YD      ++   +   D++++ LR+   IVSQEP+LF  SI +NI YGD+++     QII AAK +N H+FI++LP QY+T +G KG+  SGGQKQRIAIARA++RNP+ILLLDEATSALD +SE++VQ ALD A  GRTC+VIAHRLSTIQNA+ I V + GKI E G+H +LL+KNGIYS++   Q+
Sbjct:  730 FFRILGWARPEWSFLIIGAICAGLYGVTMPVFSVVLAELYGSLAKPTDEEVLEQSASMA--IISLV-IGIAAGVVCYIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFFGYAVTLTYGGHMCADGKIKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSANRMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQQGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRRRLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQLSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKLYRCQT 1317          

HSP 2 Score: 396.356 bits (1017), Expect = 1.476e-113
Identity = 211/491 (42.97%), Postives = 305/491 (62.12%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIR---------EGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLN-DFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            +R  FF+A +RQ IGW D         ++ D++  + +GI + +G  ++     I  ++L+F+ GWKL L  +   PL ++    ++    KLT +   +Y +A  + EEV+G+IRT+V+F GE+ E  RY   L  A K G  K   +G    ++  ++F + A  FWYGA+LI          +   +    ++IV    +++   I + +P + +F  AR +A+ I ++IDR   ID +++ G  LN   +G + F+ V F YP R D  +L GL++ ++ GQTVALVG SGCGKS+ IQL+QRFYD   G+VL+D  +++  N+ WLR  I VV QEPVLF  SI ENIR+G+ + T +E++ A   ANA  FI AL    DT + ++G QLSGGQ+QRIAIARAL++ PKILLLDEATSALD  SEK+VQ ALDK  +GRTT++V+HRLS +R+AH I  I++GK  EQGTH ELM L G Y  +V
Sbjct:  158 MRREFFKATLRQEIGWHDMAKDQNFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKAGKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETFAMARGSASAILDVIDRTSLIDPLSKAGKILNYGLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRSNIAVVGQEPVLFQGSIGENIRHGKPEATQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQLSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMV 648          

HSP 3 Score: 347.051 bits (889), Expect = 2.426e-97
Identity = 208/528 (39.39%), Postives = 309/528 (58.52%), Query Frame = 1
Query:  619 IALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEK-------YEVARYTENLDEACKI-GIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEID-----KMNEEGD----KLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIK-DLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDL 2136
            I +A  ++ Y+   FF +      + +R+  FR +M Q +GWFD  +NS GAL+ +L  D  +V   IG  +  ++Q +  FI  I +AF   W+L L+ LS SP ++  ++  ++   K   K  E   +   IA E +  IRT+   R E+        EV RY   +    K  G+  S+    +           YA+   YG  +  +G       ++ +  + L     + Q+     +FN A  +A  ++EIIDR P+I      ++ + G+    K N  Q  ++++ + F+YP+R    +L   +L I  GQTVALVGASG GKS+ +QL+ R+YD +EG++LID  +I  D+++  LR ++G+VSQEP LF  SI +NI YG     V  ++I +A  MANA  FI +LP + DT++G +GTQLSGGQKQRIAIARA+VRNPKILLLDEATSALD +SE++VQ ALD    GRT I++AHRLST++NA+VI  I+ GK+ EQG+H++L+A NG+Y  L
Sbjct:  794 IGIAAGVVCYIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFF--------GYAVTLTYGGHMCADGK-IKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSANRMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQQGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRRRLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQLSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKL 1312          

HSP 4 Score: 301.212 bits (770), Expect = 1.378e-82
Identity = 192/560 (34.29%), Postives = 299/560 (53.39%), Query Frame = 2
Query: 2408 LFG---FLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLY--------NMSKMTN--VFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            LFG    L  A    N+++   D  ++ I +    ++   S V     F     +LT R R   F+A L+Q+I W D   +       R++D   +IR    E+LG  +  +C +  +V +SF + W+++L ++ ++P+  V            +  ++ +   +  +  E I  IRTV     E +    Y   +K        K    G    + +A +F   A +F     L+LY        +  + T   V I    +I  A  + ++      F   + +A+ + +++DR   I+  S  G +L+   + G ++  +V F YP R ++I+L  ++  +   QT+ALVGPSGCGKST I LLQRFYD + G +L+D   ++  NI+ LR   ++V QEP LF  SI ENI +G      T  ++  AAKA+N HDFI+ L   Y+T + EKG   SGGQ+QRIAIARAL++ P+ILLLDEATSALD  SEK+VQ ALDKA +GRT +V++HRLS I++A +I+  ++GK  E GTH EL+   G Y +M+++ S+
Sbjct:   99 LFGGGKILTNASYEENMQELRKDSVSFGILMTLNTLLMLFSGVYYVDAFNRLALKLTVRMRREFFKATLRQEIGWHDMAKDQ--NFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKAGKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETFAMARGSASAILDVIDRTSLIDPLSKAGKILNY-GLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRSNIAVVGQEPVLFQGSIGENIRHGKPEA--TQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQLSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMVTVHSY 653          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Match: abcb4 (ATP-binding cassette, sub-family B (MDR/TAP), member 4 [Source:ZFIN;Acc:ZDB-GENE-080204-52])

HSP 1 Score: 580.482 bits (1495), Expect = 2.355e-176
Identity = 298/616 (48.38%), Postives = 410/616 (66.56%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQ---FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +LF YA   DI++M+  +IMS+  G   PL+++VFG+ T                     +     T + +++ I      NFT   ++  TL   M+     ++ +   + + +Y+ V F+ + +  Q+  +R  FF ++M+Q IGWFD   +G L  +L DD+  ++ GIGDK+G ++Q    FI GII+ F +GWKLTLV L++SPL+ I   ++ K M   T K   AY KAG +AEEVL SIRT+ +F G+K E+ RY +NL++A  +G+RK+I     +G    +++ SYAL FWYG++LI  G  + +G +L +FF+ L+   G+GQ +P++ +F+ AR AA ++F+IID  P+I+  +EEG KL+  +G I FK + F YP+R D  +L G++L +  GQT+ALVG+SGCGKS+ IQL+QRFYD  EG V ID  +I+ LNV  LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI+QA   ANA  FI  LP+K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTI+VAHRLST+RNA VI G ++G++ E GTH ELM   G+Y  LV+ Q
Sbjct:   43 ELFRYADSIDILLMMLGLIMSMANGAVLPLMVIVFGDMT---------------------DSFVDDTLLDNLKNITLPP--NFTFPETSNITLGEKMTTHAIYYSIMGFVVLVAAYMQVAFWTLAAGRQVKKLRKIFFHSIMKQEIGWFDVNETGQLNTRLTDDVYKINEGIGDKLGMLIQNLTTFIVGIIIGFAKGWKLTLVILAVSPLLGISAAVIGKVMTTFTSKEQTAYAKAGAVAEEVLSSIRTVFAFGGQKKEIKRYHKNLEDAKNVGVRKAITVNIAMGFTFFMIYMSYALAFWYGSTLILGGE-YTIGMLLTIFFAVLIGAFGLGQTSPNIQTFSSARGAAHKVFQIIDHEPKINSFSEEGYKLDVVKGNIEFKNIHFRYPSRDDVKVLNGMNLKVMSGQTIALVGSSGCGKSTTIQLLQRFYDPQEGSVSIDGHDIRSLNVRGLRELIGVVSQEPVLFATTIAENIRYGRQDVTQDEIEQAAREANAYNFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQAALDKVRLGRTTIVVAHRLSTIRNADVIAGFQNGEIVELGTHDELMERKGIYHSLVNMQ 634          

HSP 2 Score: 537.339 bits (1383), Expect = 2.269e-161
Identity = 271/584 (46.40%), Postives = 392/584 (67.12%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ-SH 4048
            F  V+ LN PE  Y+ +G + A  NG +QP+F+++F  ++   A P  N+ +Q  D+  Y +  AGI V++F +  LQ   FG +GE LT R R   F AM++QD+AW+D+  N++GALTTRL+ +  Q++G +G  L  +   + ++G A+ ISF + WQ++L++L+ VPI+ V G +Q++++ G +  DK  LE++GKIA E IEN+RTV +LTRE  F   Y+E +        KKAH  G  +  +QA I+ AYA  F    +L+   +     VF+   A+++GAM +G++ +  PN+ K K++A+H+  L++R P I++ S DG   D     G++  E+V F YP RP++ +L  +   +   QT+ALVG SGCGKST I LL+RFYD   G +++D+N  K +NI  LR    IVSQEP LF  S+ ENIAYGD+++    ++I+ AAKA+NIH FI NLP +Y+T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEKIVQDALDKA +GRTC+++AHRLSTIQNAD I V ++G + E GTH +LLS+ G Y  +++ Q SH
Sbjct:  696 FLTVLKLNYPEWPYMVVGILCATINGGMQPAFAVIFSKIIAVFAEPDQNLVRQRCDL--YSLLFAGIGVLSFFTLFLQGFCFGKAGELLTMRLRFKAFNAMMRQDLAWYDDTKNSVGALTTRLAADTAQVQGATGVRLATLAQNVANLGTAIVISFVYGWQLTLLILSIVPIMAVAGAIQMKLLAGHALKDKKELEQAGKIATEAIENVRTVVSLTRESKFESLYEENLIVPYKNAKKKAHVFGLTFSFSQAMIYFAYAGCFKFGSWLIEQKLMTFEGVFLVISAVVYGAMAVGEANSFTPNYAKAKMSASHVLMLINRAPAIDNSSEDGDKPD--KFEGNVGFEHVYFKYPSRPDVPVLQGLKLRVKKGQTLALVGSSGCGKSTTIQLLERFYDPQQGRVMLDDNDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSREVDQEEIVEAAKAANIHSFIENLPQRYQTQAGDKGTQLSGGQKQRIAIARAILRNPKVLLLDEATSALDTESEKIVQDALDKASKGRTCIIVAHRLSTIQNADCIAVVQNGVVVEQGTHQQLLSQQGAYYTLVTSQMSH 1275          

HSP 3 Score: 414.461 bits (1064), Expect = 1.136e-119
Identity = 228/518 (44.02%), Postives = 326/518 (62.93%), Query Frame = 1
Query:  610 FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            FAGI +  F   ++    F    +     +R   F A+MRQ++ W+D  +NS GALT +L  D   V    G ++  + Q  A     I+++FV GW+LTL+ LSI P++ +   +  K +     K  +   +AG IA E + ++RT+VS  R  K+E + Y ENL    K   +K+ + G        +++ +YA  F +G+ LI +      G + +V  + +     +G+A     ++ +A+ +A+ +  +I+R P ID  +E+GDK + F+G + F++V F YP+R D P+L GL L ++ GQT+ALVG+SGCGKS+ IQL++RFYD  +G V++DD + K LN+ WLR QIG+VSQEPVLF CS+ ENI YG    +V  EEI +A   AN  +FI  LP +  T  GD+GTQLSGGQKQRIAIARA++RNPK+LLLDEATSALD+ESEKIVQDALDK  +GRT IIVAHRLST++NA  I  +++G V EQGTH +L++  G Y  LV  Q
Sbjct:  757 FAGIGVLSFFTLFLQGFCFGKAGELLTMRLRFKAFNAMMRQDLAWYDDTKNSVGALTTRLAADTAQVQGATGVRLATLAQNVANLGTAIVISFVYGWQLTLLILSIVPIMAVAGAIQMKLLAGHALKDKKELEQAGKIATEAIENVRTVVSLTRESKFE-SLYEENLIVPYKNAKKKAHVFGLTFSFSQAMIYFAYAGCFKFGSWLIEQKLMTFEG-VFLVISAVVYGAMAVGEANSFTPNYAKAKMSASHVLMLINRAPAIDNSSEDGDKPDKFEGNVGFEHVYFKYPSRPDVPVLQGLKLRVKKGQTLALVGSSGCGKSTTIQLLERFYDPQQGRVMLDDNDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSREVDQEEIVEAAKAANIHSFIENLPQRYQTQAGDKGTQLSGGQKQRIAIARAILRNPKVLLLDEATSALDTESEKIVQDALDKASKGRTCIIVAHRLSTIQNADCIAVVQNGVVVEQGTHQQLLSQQGAYYTLVTSQ 1272          

HSP 4 Score: 391.349 bits (1004), Expect = 4.528e-112
Identity = 228/591 (38.58%), Postives = 349/591 (59.05%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFG-----------------------FLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            + LG + ++ NGAV P   I+FG                       F  P  +N  + ++   + T+ I  + +  V  V++ +Q   +  +  +  K+ R I F +++KQ+I WFD   N  G L TRL+D+  +I    G+ LG +I  + +    + I F   W+++LV+LA  P++ +   +  ++M  F++ ++ A  ++G +A E + +IRTV     +   I+ Y + ++       +KA       G T   I+ +YA  F     L+L     +  +   F A++ GA  LG++      F   + AA  +F+++D  P INSFS +G  LDV  + G+I+ +N+ F YP R ++ +LN ++  + S QTIALVG SGCGKST I LLQRFYD   G++ ID + I+ +N++ LR+L  +VSQEP LF+ +I ENI YG   +  T D+I  AA+ +N ++FI+ LPD++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ ALDK + GRT +V+AHRLSTI+NAD I  F++G+I E GTH EL+ + GIY  ++++Q  K
Sbjct:   56 MMLGLIMSMANGAVLPLMVIVFGDMTDSFVDDTLLDNLKNITLPPNFTFPETSNITLGEK---MTTHAIYYSIMGFVVLVAAYMQVAFWTLAAGRQVKKLRKIFFHSIMKQEIGWFD--VNETGQLNTRLTDDVYKINEGIGDKLGMLIQNLTTFIVGIIIGFAKGWKLTLVILAVSPLLGISAAVIGKVMTTFTSKEQTAYAKAGAVAEEVLSSIRTVFAFGGQKKEIKRYHKNLEDAKNVGVRKAITVNIAMGFTFFMIYMSYALAFWYGSTLILGGEYTIGMLLTIFFAVLIGAFGLGQTSPNIQTFSSARGAAHKVFQIIDHEPKINSFSEEGYKLDV--VKGNIEFKNIHFRYPSRDDVKVLNGMNLKVMSGQTIALVGSSGCGKSTTIQLLQRFYDPQEGSVSIDGHDIRSLNVRGLRELIGVVSQEPVLFATTIAENIRYG--RQDVTQDEIEQAAREANAYNFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQAALDKVRLGRTTIVVAHRLSTIRNADVIAGFQNGEIVELGTHDELMERKGIYHSLVNMQMFK 637          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 560.451 bits (1443), Expect = 1.053e-168
Identity = 297/629 (47.22%), Postives = 409/629 (65.02%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSG---------MSQQ---FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL-IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +LF YATC ++ +M+  ++ +   GV  PL+ +VFG  T       +  +  T  LT  N   TS                NFT + +N  T ++G         M++Q   F GI  A+ ++    V  F++T+  Q   IR  +F A++ Q + WFD    G L  +L DDINT++ G+GDKI   +Q++  FI G+++ FV GWKLTLV L++SPL+     + SK +  LT K   AY KAG +AEE+L +IRT+V+F G+K  V +Y +NL EA   G++K+I T   +GL   ++F +YAL FWYG  L + E   + +G +L VFFS ++ T  +GQ  P++ +  +AR AA E+++ ID    ID  ++EG K +  +G I FK + F YP+R D  IL G+SL +  G+T+ALVGASGCGKS+ IQL+QRFYD + GEV +D  +I+ LNV WLRE +G+VSQEPVLFG +I ENIRYGR D TD +I+QA+  ANA  FI+ LP+KL+T+VG+RG QLSGGQKQRIAIARALV+NPKILLLDEATSALD++SE IVQ ALDK   GRTTI++AHRLST+R+A +I G  +G+V EQG+H ELMA  G+Y  LV +Q
Sbjct:   68 GFFQLFRYATCPEVFLMLIGLLCAAAHGVALPLMCVVFGQMTDS-----FVQSGQTYNLTGFNGNFTS----------------NFTFTLNNTSTCLAGSPEIGIEPKMTKQAYFFIGIGGAVLVLGTFQVMLFLLTAAKQTKRIRQKYFHAILHQQMSWFDTHPIGELNIRLTDDINTINDGLGDKIAVFVQFFCSFISGLVIGFVFGWKLTLVILAVSPLLAGSAAVWSKILASLTSKELTAYAKAGAVAEEILVAIRTVVAFNGQKKAVEKYEKNLVEAKDFGVKKAISTNVSMGLTQFIVFATYALAFWYGTKLSVDEPENYTIGRVLTVFFSVMIGTFSLGQGAPNLEAIAKARGAAYEVYKTIDMPRPIDSSSKEGHKPDRVRGDIEFKNINFNYPSRKDVTILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDSGEVTLDGHDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDADIEQAIKEANAYDFISKLPDKLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSESIVQAALDKARAGRTTIVIAHRLSTIRSADIIAGFSEGRVVEQGSHRELMAKKGVYYSLVTQQ 675          

HSP 2 Score: 504.597 bits (1298), Expect = 1.874e-149
Identity = 257/579 (44.39%), Postives = 377/579 (65.11%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F K++ LN P+  Y+ +G  +++  GAV P  +ILF  ++   A P+ E +      + +    I VVAF++   Q   FG SGE LT R RS  F+A+++Q+I WFD+ +N +G LTT+L+ +A+ ++G +G  LG     IC++  AV ++F FCWQ++L++LA VP +     +Q+R   G ++ D+ ALE SGKI+ E +EN +TV  LTRE  F   + +++         KA   G  + L QA  +   AA F    +L+ +  ++  NVF+ F  ++F AMN+G+S + AP+F K K AA  + +LL++ P I+ +   G        SG+I  ++V+FSYP RPN+ +L  ++ ++   QT+ALVG SGCGKST I LL+RFYD   G +L+D    K +N+  LR    +VSQEP LF  +I ENI YGD+++  T ++I  AAK +NIH+FI+ LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P++LLLDEATSALDTESEKIVQ ALD+A+ GRTC+VIAHRL+TIQNAD I+V ++GK+ E GTH +L++K   Y  +++ Q
Sbjct:  758 FTKILALNKPDWPYLVVGTFASLVGGAVYPCVAILFAKIIGVFAEPDPEVKRQKTMMFSLLYLLIGVVAFLTYFFQGFMFGKSGELLTMRLRSQAFKAIVRQEIGWFDDNNNAVGILTTKLATDASLVKGAAGSRLGLATNTICALLIAVIVAFVFCWQLTLLILACVPFLTGANFIQLRATAGHTSKDQSALEMSGKISTETVENFKTVVALTREDVFFHKFIDSLSTPYKASLCKAPIYGITFALAQAIPYLVNAAIFRFGAWLIAHCYTEYENVFLVFSVIVFAAMNIGQSSSFAPDFAKAKAAAGRIIQLLEKKPEIDIYDESGE--RPSTFSGNIDFKDVQFSYPTRPNVKVLQGLNVSVRQGQTLALVGSSGCGKSTTIQLLERFYDPAGGQVLVDGRDSKSVNLAWLRTQMGLVSQEPILFDCTISENIQYGDNSRTVTQEEIEEAAKKANIHNFILTLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKLLLLDEATSALDTESEKIVQAALDEARLGRTCIVIAHRLTTIQNADIIVVVQNGKVVEQGTHAQLMAKQEAYFALVNAQ 1334          

HSP 3 Score: 390.963 bits (1003), Expect = 1.609e-111
Identity = 215/488 (44.06%), Postives = 310/488 (63.52%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ IGWFD  N+  G LT KL  D + V    G ++G         +  +I+AFV  W+LTL+ L+  P +     +  +     T K   A   +G I+ E + + +T+V+   E     ++ ++L    K  + K+ + G    L   + +   A  F +GA LI         ++ +VF   + A   IGQ++     F +A++AA  I +++++ PEID  +E G++ + F G I FK V+F+YPTR +  +L GL++S++ GQT+ALVG+SGCGKS+ IQL++RFYD   G+VL+D  + K +N+ WLR Q+G+VSQEP+LF C+I ENI+YG     VT EEI++A   AN   FI  LP+K +T VGD+GTQLSGGQKQRIAIARALVR PK+LLLDEATSALD+ESEKIVQ ALD+   GRT I++AHRL+T++NA +I  +++GKV EQGTHA+LMA    Y  LV+ Q
Sbjct:  848 LRSQAFKAIVRQEIGWFDDNNNAVGILTTKLATDASLVKGAAGSRLGLATNTICALLIAVIVAFVFCWQLTLLILACVPFLTGANFIQLRATAGHTSKDQSALEMSGKISTETVENFKTVVALTREDVFFHKFIDSLSTPYKASLCKAPIYGITFALAQAIPYLVNAAIFRFGAWLIAHCYT-EYENVFLVFSVIVFAAMNIGQSSSFAPDFAKAKAAAGRIIQLLEKKPEIDIYDESGERPSTFSGNIDFKDVQFSYPTRPNVKVLQGLNVSVRQGQTLALVGSSGCGKSTTIQLLERFYDPAGGQVLVDGRDSKSVNLAWLRTQMGLVSQEPILFDCTISENIQYGDNSRTVTQEEIEEAAKKANIHNFILTLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKLLLLDEATSALDTESEKIVQAALDEARLGRTCIVIAHRLTTIQNADIIVVVQNGKVVEQGTHAQLMAKQEAYFALVNAQ 1334          

HSP 4 Score: 351.288 bits (900), Expect = 1.833e-98
Identity = 211/525 (40.19%), Postives = 310/525 (59.05%), Query Frame = 2
Query: 2495 GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNF---GKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            GI     V    Q + F  +  + TKR R   F A+L Q ++WFD  ++ IG L  RL+D+   I    G+ +   +   CS  + + I F F W+++LV+LA  P++     +  +I+   ++ +  A  ++G +A E +  IRTV     +   ++ Y++ + +      KKA +     GLTQ  +F  YA  F     L +     Y + ++  VF S   ++ G  +LG+    APN     K + AA  +++ +D   PI+S S +G   D   + GDI+ +N+ F+YP R ++ IL  +S  +   +TIALVG SGCGKST I LLQRFYD  +G + +D + I+ +N++ LR+   IVSQEP LF  +I ENI YG      TD  I  A K +N +DFI  LPD+  T VGE+G+  SGGQKQRIAIARAL++NP+ILLLDEATSALDT+SE IVQ ALDKA+ GRT +VIAHRLSTI++AD I  F +G++ E G+H EL++K G+Y  +++ Q+
Sbjct:  164 GIGGAVLVLGTFQVMLFLLTAAKQTKRIRQKYFHAILHQQMSWFD--THPIGELNIRLTDDINTINDGLGDKIAVFVQFFCSFISGLVIGFVFGWKLTLVILAVSPLLAGSAAVWSKILASLTSKELTAYAKAGAVAEEILVAIRTVVAFNGQKKAVEKYEKNLVEAKDFGVKKAISTNVSMGLTQFIVFATYALAFWYGTKLSVDEPENYTIGRVLTVFFS---VMIGTFSLGQG---APNLEAIAKARGAAYEVYKTIDMPRPIDSSSKEGHKPD--RVRGDIEFKNINFNYPSRKDVTILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDSGEVTLDGHDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDA--TDADIEQAIKEANAYDFISKLPDKLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSESIVQAALDKARAGRTTIVIAHRLSTIRSADIIAGFSEGRVVEQGSHRELMAKKGVYYSLVTQQT 676          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 560.451 bits (1443), Expect = 1.292e-168
Identity = 297/629 (47.22%), Postives = 409/629 (65.02%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSG---------MSQQ---FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL-IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +LF YATC ++ +M+  ++ +   GV  PL+ +VFG  T       +  +  T  LT  N   TS                NFT + +N  T ++G         M++Q   F GI  A+ ++    V  F++T+  Q   IR  +F A++ Q + WFD    G L  +L DDINT++ G+GDKI   +Q++  FI G+++ FV GWKLTLV L++SPL+     + SK +  LT K   AY KAG +AEE+L +IRT+V+F G+K  V +Y +NL EA   G++K+I T   +GL   ++F +YAL FWYG  L + E   + +G +L VFFS ++ T  +GQ  P++ +  +AR AA E+++ ID    ID  ++EG K +  +G I FK + F YP+R D  IL G+SL +  G+T+ALVGASGCGKS+ IQL+QRFYD + GEV +D  +I+ LNV WLRE +G+VSQEPVLFG +I ENIRYGR D TD +I+QA+  ANA  FI+ LP+KL+T+VG+RG QLSGGQKQRIAIARALV+NPKILLLDEATSALD++SE IVQ ALDK   GRTTI++AHRLST+R+A +I G  +G+V EQG+H ELMA  G+Y  LV +Q
Sbjct:   80 GFFQLFRYATCPEVFLMLIGLLCAAAHGVALPLMCVVFGQMTDS-----FVQSGQTYNLTGFNGNFTS----------------NFTFTLNNTSTCLAGSPEIGIEPKMTKQAYFFIGIGGAVLVLGTFQVMLFLLTAAKQTKRIRQKYFHAILHQQMSWFDTHPIGELNIRLTDDINTINDGLGDKIAVFVQFFCSFISGLVIGFVFGWKLTLVILAVSPLLAGSAAVWSKILASLTSKELTAYAKAGAVAEEILVAIRTVVAFNGQKKAVEKYEKNLVEAKDFGVKKAISTNVSMGLTQFIVFATYALAFWYGTKLSVDEPENYTIGRVLTVFFSVMIGTFSLGQGAPNLEAIAKARGAAYEVYKTIDMPRPIDSSSKEGHKPDRVRGDIEFKNINFNYPSRKDVTILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDSGEVTLDGHDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDADIEQAIKEANAYDFISKLPDKLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSESIVQAALDKARAGRTTIVIAHRLSTIRSADIIAGFSEGRVVEQGSHRELMAKKGVYYSLVTQQ 687          

HSP 2 Score: 504.597 bits (1298), Expect = 2.371e-149
Identity = 257/579 (44.39%), Postives = 377/579 (65.11%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F K++ LN P+  Y+ +G  +++  GAV P  +ILF  ++   A P+ E +      + +    I VVAF++   Q   FG SGE LT R RS  F+A+++Q+I WFD+ +N +G LTT+L+ +A+ ++G +G  LG     IC++  AV ++F FCWQ++L++LA VP +     +Q+R   G ++ D+ ALE SGKI+ E +EN +TV  LTRE  F   + +++         KA   G  + L QA  +   AA F    +L+ +  ++  NVF+ F  ++F AMN+G+S + AP+F K K AA  + +LL++ P I+ +   G        SG+I  ++V+FSYP RPN+ +L  ++ ++   QT+ALVG SGCGKST I LL+RFYD   G +L+D    K +N+  LR    +VSQEP LF  +I ENI YGD+++  T ++I  AAK +NIH+FI+ LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P++LLLDEATSALDTESEKIVQ ALD+A+ GRTC+VIAHRL+TIQNAD I+V ++GK+ E GTH +L++K   Y  +++ Q
Sbjct:  770 FTKILALNKPDWPYLVVGTFASLVGGAVYPCVAILFAKIIGVFAEPDPEVKRQKTMMFSLLYLLIGVVAFLTYFFQGFMFGKSGELLTMRLRSQAFKAIVRQEIGWFDDNNNAVGILTTKLATDASLVKGAAGSRLGLATNTICALLIAVIVAFVFCWQLTLLILACVPFLTGANFIQLRATAGHTSKDQSALEMSGKISTETVENFKTVVALTREDVFFHKFIDSLSTPYKASLCKAPIYGITFALAQAIPYLVNAAIFRFGAWLIAHCYTEYENVFLVFSVIVFAAMNIGQSSSFAPDFAKAKAAAGRIIQLLEKKPEIDIYDESGE--RPSTFSGNIDFKDVQFSYPTRPNVKVLQGLNVSVRQGQTLALVGSSGCGKSTTIQLLERFYDPAGGQVLVDGRDSKSVNLAWLRTQMGLVSQEPILFDCTISENIQYGDNSRTVTQEEIEEAAKKANIHNFILTLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKLLLLDEATSALDTESEKIVQAALDEARLGRTCIVIAHRLTTIQNADIIVVVQNGKVVEQGTHAQLMAKQEAYFALVNAQ 1346          

HSP 3 Score: 391.349 bits (1004), Expect = 1.326e-111
Identity = 215/488 (44.06%), Postives = 310/488 (63.52%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ IGWFD  N+  G LT KL  D + V    G ++G         +  +I+AFV  W+LTL+ L+  P +     +  +     T K   A   +G I+ E + + +T+V+   E     ++ ++L    K  + K+ + G    L   + +   A  F +GA LI         ++ +VF   + A   IGQ++     F +A++AA  I +++++ PEID  +E G++ + F G I FK V+F+YPTR +  +L GL++S++ GQT+ALVG+SGCGKS+ IQL++RFYD   G+VL+D  + K +N+ WLR Q+G+VSQEP+LF C+I ENI+YG     VT EEI++A   AN   FI  LP+K +T VGD+GTQLSGGQKQRIAIARALVR PK+LLLDEATSALD+ESEKIVQ ALD+   GRT I++AHRL+T++NA +I  +++GKV EQGTHA+LMA    Y  LV+ Q
Sbjct:  860 LRSQAFKAIVRQEIGWFDDNNNAVGILTTKLATDASLVKGAAGSRLGLATNTICALLIAVIVAFVFCWQLTLLILACVPFLTGANFIQLRATAGHTSKDQSALEMSGKISTETVENFKTVVALTREDVFFHKFIDSLSTPYKASLCKAPIYGITFALAQAIPYLVNAAIFRFGAWLIAHCYT-EYENVFLVFSVIVFAAMNIGQSSSFAPDFAKAKAAAGRIIQLLEKKPEIDIYDESGERPSTFSGNIDFKDVQFSYPTRPNVKVLQGLNVSVRQGQTLALVGSSGCGKSTTIQLLERFYDPAGGQVLVDGRDSKSVNLAWLRTQMGLVSQEPILFDCTISENIQYGDNSRTVTQEEIEEAAKKANIHNFILTLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKLLLLDEATSALDTESEKIVQAALDEARLGRTCIVIAHRLTTIQNADIIVVVQNGKVVEQGTHAQLMAKQEAYFALVNAQ 1346          

HSP 4 Score: 350.903 bits (899), Expect = 2.519e-98
Identity = 211/525 (40.19%), Postives = 310/525 (59.05%), Query Frame = 2
Query: 2495 GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNF---GKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            GI     V    Q + F  +  + TKR R   F A+L Q ++WFD  ++ IG L  RL+D+   I    G+ +   +   CS  + + I F F W+++LV+LA  P++     +  +I+   ++ +  A  ++G +A E +  IRTV     +   ++ Y++ + +      KKA +     GLTQ  +F  YA  F     L +     Y + ++  VF S   ++ G  +LG+    APN     K + AA  +++ +D   PI+S S +G   D   + GDI+ +N+ F+YP R ++ IL  +S  +   +TIALVG SGCGKST I LLQRFYD  +G + +D + I+ +N++ LR+   IVSQEP LF  +I ENI YG      TD  I  A K +N +DFI  LPD+  T VGE+G+  SGGQKQRIAIARAL++NP+ILLLDEATSALDT+SE IVQ ALDKA+ GRT +VIAHRLSTI++AD I  F +G++ E G+H EL++K G+Y  +++ Q+
Sbjct:  176 GIGGAVLVLGTFQVMLFLLTAAKQTKRIRQKYFHAILHQQMSWFD--THPIGELNIRLTDDINTINDGLGDKIAVFVQFFCSFISGLVIGFVFGWKLTLVILAVSPLLAGSAAVWSKILASLTSKELTAYAKAGAVAEEILVAIRTVVAFNGQKKAVEKYEKNLVEAKDFGVKKAISTNVSMGLTQFIVFATYALAFWYGTKLSVDEPENYTIGRVLTVFFS---VMIGTFSLGQG---APNLEAIAKARGAAYEVYKTIDMPRPIDSSSKEGHKPD--RVRGDIEFKNINFNYPSRKDVTILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDSGEVTLDGHDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDA--TDADIEQAIKEANAYDFISKLPDKLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSESIVQAALDKARAGRTTIVIAHRLSTIRSADIIAGFSEGRVVEQGSHRELMAKKGVYYSLVTQQT 688          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Match: abcb11a (ATP-binding cassette, sub-family B (MDR/TAP), member 11a [Source:ZFIN;Acc:ZDB-GENE-050517-13])

HSP 1 Score: 506.523 bits (1303), Expect = 9.854e-151
Identity = 254/575 (44.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            +++  N PE  Y+ LG + A  NG++ P +++LF  +L   + P+ + Q   I    I    I VV+F S  LQ   F  SGE LT+R R   F+AMLKQ+I WFD+P N+ GALTTRL+  A+ ++G +G  +G ++ ++ ++GA+  I++ F W++SLVV  F+P+I + G+ Q +++ G +N DK ALE +G+++ E + NIRT++ L +E  F+  +++ ++       KKA+  G  +   +  IF AYAA+F   GYL+ +   +   VF    AL+  A  LG++ +  P++ K KI+AA +F+LLDRVP IN   T+G   +  +  G ++ +  +F+YP RP++ +L  +  +++  QT+A VG SGCGKST + LL+RFYD   G +LID      I++  LR    IVSQEP LF  SI ENI YGD+++  + ++II AAK + +HDF++ LPD+YET+VG +GS  S GQKQRIAIARA++RNP+ILLLDEATSALDTESEK VQ ALD+A++GRTC+VIAHRLSTIQ+AD I V   G++ E GTH EL++K   Y ++++
Sbjct:  699 RILKYNRPEWPYMLLGSIGAAINGSLNPMYALLFSQILGTFSIPDPDDQRRQINGICILFVVIGVVSFFSQFLQGYSFAKSGELLTRRLRKFGFQAMLKQEIGWFDDPMNSPGALTTRLATNASMVQGATGSQIGMIVNSLTNIGASFIIAYYFSWKLSLVVTCFLPLIGLSGVFQSKMLTGLANEDKTALEAAGQVSSEAMSNIRTIAGLAKEKHFVAQFEKQLQAPYKAAKKKAYVYGICFAFARCVIFMAYAASFRYGGYLVSHEGLQYMMVFRVISALVTSATALGRASSFTPDYAKAKISAAQLFQLLDRVPKINVSKTEGQSWN--DFKGKVEFKGCRFTYPSRPDVQVLRGLVVSVHPGQTLAFVGSSGCGKSTSVQLLERFYDPDEGQVLIDGRPSDSISVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSRTVSMEEIIDAAKKAYLHDFVMTLPDKYETQVGAQGSQLSRGQKQRIAIARAIVRNPKILLLDEATSALDTESEKTVQAALDEARQGRTCIVIAHRLSTIQSADIIAVMSQGEVIEKGTHDELMAKKAAYYKLVT 1271          

HSP 2 Score: 474.167 bits (1219), Expect = 9.193e-140
Identity = 268/612 (43.79%), Postives = 387/612 (63.24%), Query Frame = 1
Query:  316 FSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSS-NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F ++T  +++MM+     S+  G   PL++LV+G  T+    Y+  +  LT      N+   ++T I  M      +  N T+    +I   M+  +  + GI + + I+S+  +TF+V  +  QI  IR  +FR +M   IGWFD  + G L  ++ DDIN ++  I D++   ++  + FI G ++ F+ GWKLTLV +++SPL+ +   +++  + +LT +  +AY KAG +A+EVL SIRT+ +F GE  E  RY  NL +A + GI+K ++ G   G +  ++F  YAL FW+G+ L+ E      G ++ VFF  L+    +GQA+P + +F   R+AA  IF+ IDR PEID  ++EG  L+  +G I F  V F YP+R +  IL  L++ ++ G+T A VG SG GK++ IQL+QRFYD +EG V +D  +I+ LN+ WLR  IGVV QEPVLF  +I ENIRYGR  VT +EI +A   ANA  FI +LP   DTLVG+ G Q+SGGQKQRIAIARALVRNP+ILLLD ATSALD+ESE +VQ+ALDK  +GRTTI +AHRLST+RNA VI G + G+  E+GTH++L+   G+Y  LV  Q
Sbjct:    1 FRFSTWREVLMMVVGSFCSLVHGAATPLMLLVYGMMTNTFVEYEVEILELT----DPNKTCINNT-ISWMNGSAVQRPDNTTIYCGVDIEAEMTNFALYYIGIGVGVLILSFFQITFWVSAAARQIQRIRKTYFRKIMCMEIGWFDCNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLLGLAAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERYDRNLVQAQEWGIKKGMIIGVFQGYLWCIIFLCYALAFWFGSKLVIETQELTPGGLVQVFFGVLIGAMNLGQASPCLEAFASGRAAAKSIFDTIDREPEIDCFSDEGHTLDKVKGDIEFHSVNFNYPSRPEVKILDDLNIVVKAGETTAFVGPSGSGKTTTIQLIQRFYDPSEGMVSLDGHDIRSLNIQWLRSLIGVVEQEPVLFATTIAENIRYGRAGVTMQEIIEAAKQANAYNFIMSLPQTFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKARQGRTTISIAHRLSTIRNADVIVGFEHGRAVERGTHSQLLDKKGVYFTLVTLQ 607          

HSP 3 Score: 382.874 bits (982), Expect = 3.472e-109
Identity = 234/588 (39.80%), Postives = 343/588 (58.33%), Query Frame = 1
Query:  391 WPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLI-REGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            WP ++L      S  A     +N +   L SQ   I  + SIPD ++  R                ++G+   F  I +  F   ++    F  + +     +R   F+A+++Q IGWFD    + GALT +L  + + V    G +IG ++          I+A+   WKL+LV     PLI +  +  SK +  L  +   A   AG ++ E + +IRTI     EK+ VA++ + L    K   +K+ + G        ++F +YA  F YG  L+  EG  +++  +  V  + + + T +G+A+     + +A+ +AA++F+++DRVP+I+    EG   NDF+GK+ FK  +FTYP+R D  +L GL +S+ PGQT+A VG+SGCGKS+ +QL++RFYD +EG+VLID      ++V +LR QIG+VSQEPVLF CSI ENI+YG     V+ EEI  A   A    F+  LP+K +T VG +G+QLS GQKQRIAIARA+VRNPKILLLDEATSALD+ESEK VQ ALD+  +GRT I++AHRLST+++A +I  +  G+V E+GTH ELMA    Y  LV
Sbjct:  708 WPYMLL-----GSIGAAINGSLNPMYALLFSQ---ILGTFSIPDPDDQRRQ---------------INGICILFVVIGVVSFFSQFLQGYSFAKSGELLTRRLRKFGFQAMLKQEIGWFDDPMNSPGALTTRLATNASMVQGATGSQIGMIVNSLTNIGASFIIAYYFSWKLSLVVTCFLPLIGLSGVFQSKMLTGLANEDKTALEAAGQVSSEAMSNIRTIAGLAKEKHFVAQFEKQLQAPYKAAKKKAYVYGICFAFARCVIFMAYAASFRYGGYLVSHEGLQYMM--VFRVISALVTSATALGRASSFTPDYAKAKISAAQLFQLLDRVPKINVSKTEGQSWNDFKGKVEFKGCRFTYPSRPDVQVLRGLVVSVHPGQTLAFVGSSGCGKSTSVQLLERFYDPDEGQVLIDGRPSDSISVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSRTVSMEEIIDAAKKAYLHDFVMTLPDKYETQVGAQGSQLSRGQKQRIAIARAIVRNPKILLLDEATSALDTESEKTVQAALDEARQGRTCIVIAHRLSTIQSADIIAVMSQGEVIEKGTHDELMAKKAAYYKLV 1270          

HSP 4 Score: 334.339 bits (856), Expect = 2.704e-93
Identity = 212/532 (39.85%), Postives = 311/532 (58.46%), Query Frame = 2
Query: 2462 ADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTN---VFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            A++  + +   GI V   + S  Q   + ++  +  +R R   F  ++  +I WFD   N++G L TR+SD+  +I     + +   I  I +      + F   W+++LVV+A  P++ +   L    +   +  +  A  ++G +A E + +IRTV+    EH   + Y   + +      KK    G   G     IF  YA  F   G  L+    ++T    V + FG LI GAMNLG++      F  G+ AA  +F+ +DR P I+ FS +G  LD   + GDI+  +V F+YP RP + IL+D++  + + +T A VGPSG GK+T I L+QRFYD   G + +D + I+ +NIQ LR L  +V QEP LF+ +I ENI YG +    T  +II AAK +N ++FI++LP  ++T VGE G   SGGQKQRIAIARAL+RNPRILLLD ATSALD ESE +VQ+ALDKA++GRT + IAHRLSTI+NAD I+ F+ G+  E GTH +LL K G+Y  +++LQ+ 
Sbjct:   86 AEMTNFALYYIGIGVGVLILSFFQITFWVSAAARQIQRIRKTYFRKIMCMEIGWFD--CNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLLGLAAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERYDRNLVQAQEWGIKKGMIIGVFQGYLWCIIFLCYALAFWF-GSKLVIETQELTPGGLVQVFFGVLI-GAMNLGQASPCLEAFASGRAAAKSIFDTIDREPEIDCFSDEGHTLD--KVKGDIEFHSVNFNYPSRPEVKILDDLNIVVKAGETTAFVGPSGSGKTTTIQLIQRFYDPSEGMVSLDGHDIRSLNIQWLRSLIGVVEQEPVLFATTIAENIRYGRAG--VTMQEIIEAAKQANAYNFIMSLPQTFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKARQGRTTISIAHRLSTIRNADVIVGFEHGRAVERGTHSQLLDKKGVYFTLVTLQNQ 609          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Match: abcb11a (ATP-binding cassette, sub-family B (MDR/TAP), member 11a [Source:ZFIN;Acc:ZDB-GENE-050517-13])

HSP 1 Score: 506.908 bits (1304), Expect = 1.995e-150
Identity = 254/575 (44.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            +++  N PE  Y+ LG + A  NG++ P +++LF  +L   + P+ + Q   I    I    I VV+F S  LQ   F  SGE LT+R R   F+AMLKQ+I WFD+P N+ GALTTRL+  A+ ++G +G  +G ++ ++ ++GA+  I++ F W++SLVV  F+P+I + G+ Q +++ G +N DK ALE +G+++ E + NIRT++ L +E  F+  +++ ++       KKA+  G  +   +  IF AYAA+F   GYL+ +   +   VF    AL+  A  LG++ +  P++ K KI+AA +F+LLDRVP IN   T+G   +  +  G ++ +  +F+YP RP++ +L  +  +++  QT+A VG SGCGKST + LL+RFYD   G +LID      I++  LR    IVSQEP LF  SI ENI YGD+++  + ++II AAK + +HDF++ LPD+YET+VG +GS  S GQKQRIAIARA++RNP+ILLLDEATSALDTESEK VQ ALD+A++GRTC+VIAHRLSTIQ+AD I V   G++ E GTH EL++K   Y ++++
Sbjct:  742 RILKYNRPEWPYMLLGSIGAAINGSLNPMYALLFSQILGTFSIPDPDDQRRQINGICILFVVIGVVSFFSQFLQGYSFAKSGELLTRRLRKFGFQAMLKQEIGWFDDPMNSPGALTTRLATNASMVQGATGSQIGMIVNSLTNIGASFIIAYYFSWKLSLVVTCFLPLIGLSGVFQSKMLTGLANEDKTALEAAGQVSSEAMSNIRTIAGLAKEKHFVAQFEKQLQAPYKAAKKKAYVYGICFAFARCVIFMAYAASFRYGGYLVSHEGLQYMMVFRVISALVTSATALGRASSFTPDYAKAKISAAQLFQLLDRVPKINVSKTEGQSWN--DFKGKVEFKGCRFTYPSRPDVQVLRGLVVSVHPGQTLAFVGSSGCGKSTSVQLLERFYDPDEGQVLIDGRPSDSISVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSRTVSMEEIIDAAKKAYLHDFVMTLPDKYETQVGAQGSQLSRGQKQRIAIARAIVRNPKILLLDEATSALDTESEKTVQAALDEARQGRTCIVIAHRLSTIQSADIIAVMSQGEVIEKGTHDELMAKKAAYYKLVT 1314          

HSP 2 Score: 477.248 bits (1227), Expect = 2.418e-140
Identity = 270/617 (43.76%), Postives = 390/617 (63.21%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSS-NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +LF ++T  +++MM+     S+  G   PL++LV+G  T+    Y+  +  LT      N+   ++T I  M      +  N T+    +I   M+  +  + GI + + I+S+  +TF+V  +  QI  IR  +FR +M   IGWFD  + G L  ++ DDIN ++  I D++   ++  + FI G ++ F+ GWKLTLV +++SPL+ +   +++  + +LT +  +AY KAG +A+EVL SIRT+ +F GE  E  RY  NL +A + GI+K ++ G   G +  ++F  YAL FW+G+ L+ E      G ++ VFF  L+    +GQA+P + +F   R+AA  IF+ IDR PEID  ++EG  L+  +G I F  V F YP+R +  IL  L++ ++ G+T A VG SG GK++ IQL+QRFYD +EG V +D  +I+ LN+ WLR  IGVV QEPVLF  +I ENIRYGR  VT +EI +A   ANA  FI +LP   DTLVG+ G Q+SGGQKQRIAIARALVRNP+ILLLD ATSALD+ESE +VQ+ALDK  +GRTTI +AHRLST+RNA VI G + G+  E+GTH++L+   G+Y  LV  Q
Sbjct:   39 GFFQLFRFSTWREVLMMVVGSFCSLVHGAATPLMLLVYGMMTNTFVEYEVEILELT----DPNKTCINNT-ISWMNGSAVQRPDNTTIYCGVDIEAEMTNFALYYIGIGVGVLILSFFQITFWVSAAARQIQRIRKTYFRKIMCMEIGWFDCNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLLGLAAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERYDRNLVQAQEWGIKKGMIIGVFQGYLWCIIFLCYALAFWFGSKLVIETQELTPGGLVQVFFGVLIGAMNLGQASPCLEAFASGRAAAKSIFDTIDREPEIDCFSDEGHTLDKVKGDIEFHSVNFNYPSRPEVKILDDLNIVVKAGETTAFVGPSGSGKTTTIQLIQRFYDPSEGMVSLDGHDIRSLNIQWLRSLIGVVEQEPVLFATTIAENIRYGRAGVTMQEIIEAAKQANAYNFIMSLPQTFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKARQGRTTISIAHRLSTIRNADVIVGFEHGRAVERGTHSQLLDKKGVYFTLVTLQ 650          

HSP 3 Score: 382.874 bits (982), Expect = 5.481e-109
Identity = 234/588 (39.80%), Postives = 343/588 (58.33%), Query Frame = 1
Query:  391 WPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLI-REGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            WP ++L      S  A     +N +   L SQ   I  + SIPD ++  R                ++G+   F  I +  F   ++    F  + +     +R   F+A+++Q IGWFD    + GALT +L  + + V    G +IG ++          I+A+   WKL+LV     PLI +  +  SK +  L  +   A   AG ++ E + +IRTI     EK+ VA++ + L    K   +K+ + G        ++F +YA  F YG  L+  EG  +++  +  V  + + + T +G+A+     + +A+ +AA++F+++DRVP+I+    EG   NDF+GK+ FK  +FTYP+R D  +L GL +S+ PGQT+A VG+SGCGKS+ +QL++RFYD +EG+VLID      ++V +LR QIG+VSQEPVLF CSI ENI+YG     V+ EEI  A   A    F+  LP+K +T VG +G+QLS GQKQRIAIARA+VRNPKILLLDEATSALD+ESEK VQ ALD+  +GRT I++AHRLST+++A +I  +  G+V E+GTH ELMA    Y  LV
Sbjct:  751 WPYMLL-----GSIGAAINGSLNPMYALLFSQ---ILGTFSIPDPDDQRRQ---------------INGICILFVVIGVVSFFSQFLQGYSFAKSGELLTRRLRKFGFQAMLKQEIGWFDDPMNSPGALTTRLATNASMVQGATGSQIGMIVNSLTNIGASFIIAYYFSWKLSLVVTCFLPLIGLSGVFQSKMLTGLANEDKTALEAAGQVSSEAMSNIRTIAGLAKEKHFVAQFEKQLQAPYKAAKKKAYVYGICFAFARCVIFMAYAASFRYGGYLVSHEGLQYMM--VFRVISALVTSATALGRASSFTPDYAKAKISAAQLFQLLDRVPKINVSKTEGQSWNDFKGKVEFKGCRFTYPSRPDVQVLRGLVVSVHPGQTLAFVGSSGCGKSTSVQLLERFYDPDEGQVLIDGRPSDSISVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSRTVSMEEIIDAAKKAYLHDFVMTLPDKYETQVGAQGSQLSRGQKQRIAIARAIVRNPKILLLDEATSALDTESEKTVQAALDEARQGRTCIVIAHRLSTIQSADIIAVMSQGEVIEKGTHDELMAKKAAYYKLV 1313          

HSP 4 Score: 334.724 bits (857), Expect = 3.523e-93
Identity = 212/532 (39.85%), Postives = 311/532 (58.46%), Query Frame = 2
Query: 2462 ADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTN---VFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            A++  + +   GI V   + S  Q   + ++  +  +R R   F  ++  +I WFD   N++G L TR+SD+  +I     + +   I  I +      + F   W+++LVV+A  P++ +   L    +   +  +  A  ++G +A E + +IRTV+    EH   + Y   + +      KK    G   G     IF  YA  F   G  L+    ++T    V + FG LI GAMNLG++      F  G+ AA  +F+ +DR P I+ FS +G  LD   + GDI+  +V F+YP RP + IL+D++  + + +T A VGPSG GK+T I L+QRFYD   G + +D + I+ +NIQ LR L  +V QEP LF+ +I ENI YG +    T  +II AAK +N ++FI++LP  ++T VGE G   SGGQKQRIAIARAL+RNPRILLLD ATSALD ESE +VQ+ALDKA++GRT + IAHRLSTI+NAD I+ F+ G+  E GTH +LL K G+Y  +++LQ+ 
Sbjct:  129 AEMTNFALYYIGIGVGVLILSFFQITFWVSAAARQIQRIRKTYFRKIMCMEIGWFD--CNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLLGLAAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERYDRNLVQAQEWGIKKGMIIGVFQGYLWCIIFLCYALAFWF-GSKLVIETQELTPGGLVQVFFGVLI-GAMNLGQASPCLEAFASGRAAAKSIFDTIDREPEIDCFSDEGHTLD--KVKGDIEFHSVNFNYPSRPEVKILDDLNIVVKAGETTAFVGPSGSGKTTTIQLIQRFYDPSEGMVSLDGHDIRSLNIQWLRSLIGVVEQEPVLFATTIAENIRYGRAG--VTMQEIIEAAKQANAYNFIMSLPQTFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKARQGRTTISIAHRLSTIRNADVIVGFEHGRAVERGTHSQLLDKKGVYFTLVTLQNQ 652          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000003954.1 (bile salt export pump [Source:NCBI gene;Acc:100489744])

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 260/575 (45.22%), Postives = 380/575 (66.09%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            +V+  N  E  Y+ +G + A  NG V P ++ILF  +L   + P++ +Q  +I    I    IAVV+FV+   Q   F  SGE+LT+R R + F+AML Q+I WFD+ +N+ GALTTRL+ +A+Q++G +G  +G V+ ++ ++GA++ I+F F W++SLVVL F+P++ + G+ Q +++ GF+N DK ALE +GK++ E I NIRTV+ L +E  F++ Y++ ++       KK+H  G  +G  Q  IF AYAA+F   G+L+  +      VF    A++     LG++ +  P++ K KIAA   F+LLDRVP  + FS+ G     E   GDI+  N KF+YP RP  ++L  +S ++ S QT+A VG SGCGKST + LL+RFYD   G +L+D +   ++NI  LR    IVSQEP LF  SI +NI YGD+++    +++I AAK +++H+F++ LPDQYET VG +GS  S GQKQRIAIARA++R+P+ILLLDEATSALDTESEK VQ ALD+A++GRTC+ IAHRLSTIQ  D I V   G I E G+H  L++  G Y ++++
Sbjct:  635 RVLKYNTKEWPYLLVGSIGAAINGVVTPLYAILFSQILGTFSLPDLNEQRREINGICILFVIIAVVSFVTQFFQGYAFAKSGERLTRRLRRVGFQAMLGQEIGWFDDNNNSPGALTTRLATDASQVQGATGSQIGMVVNSLTNIGASLIIAFYFSWKLSLVVLCFLPLLALAGVFQAKMLTGFANQDKNALEMAGKVSSEAIGNIRTVAGLGKETMFVEVYEKQLELPYKAAVKKSHVYGACFGFAQCVIFMAYAASFRFGGFLVNTDGIHYAVVFRVISAIVTSGTALGRASSFTPDYAKAKIAAEQFFKLLDRVPKTSVFSSSGD--KWEEFKGDIEFVNCKFTYPSRPVTMVLRGLSISVRSGQTLAFVGSSGCGKSTSVQLLERFYDPDEGKVLVDGHATANVNISFLRSKIGIVSQEPVLFEGSIADNIKYGDNSRDIPMEEVIEAAKKAHLHEFVMTLPDQYETNVGIQGSQLSRGQKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQAALDEARKGRTCIAIAHRLSTIQTCDIIAVMSQGAIVEKGSHEALMALKGAYYKLVT 1207          

HSP 2 Score: 463.381 bits (1191), Expect = 0.000e+0
Identity = 275/633 (43.44%), Postives = 387/633 (61.14%), Query Frame = 1
Query:  343 VMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERRDLC*C**RNYQRKSYKKTL 2241
            VMM+   + ++  G   PL++L++G  T    TY    +  TQ L   N+   + T       I       + + +S +           A I +  F   ++S+  +V+ +  QI  +R  +FR +MR +IGWFD+ + G L  ++ DDIN ++  I D++   ++  + FI G ++ FV  WKLTLV +++SPLI +   +++  + +LT +  +AY KAG +A+EVL +IRT+ +F GEK E  RY +NL+EA   GIRK  + G   G +  ++F  Y+L FWYG+ L+ E      G +L VFF  L+A   +GQA+P + +F   R+AA  I+E ID  P ID M+EEG KL+  +G I F  V F YP+R D   L+ LS+SI+PG+T A VG SG GKSS +QL+QRFYD  +G+V +D  +++ LN  WLR  IG+V QEPVLF  +I ENI YGR  VT  +I++A   ANA  FI  LP K DTLVG+ G Q+SGGQKQRIAIARAL+RNPKILLLD ATSALD+ESE IVQ+AL+KV  GRTTI +AHRLSTVR A +I G   G+  E+G H ELM L G+Y  LV  Q     +++    D+     + + R SY+ +L
Sbjct:    3 VMMVIGALCALIHGAAQPLMLLIYGMMTDTFITY----DRETQELQDINKECINDT-------IWWKNGTEYIVDNSTV-----------ASIDIKWFQGGFISL--WVVAAARQIQIVRKEYFRKIMRLDIGWFDSNSVGELNTRISDDINKINNAIADQVAIFIERISTFIFGFLIGFVGNWKLTLVIVAVSPLIGLGAGLMAVAVARLTGRELKAYAKAGSVADEVLSAIRTVAAFGGEKKEAERYDDNLEEAQTWGIRKGTIIGFFQGYMWCIIFLCYSLAFWYGSRLVIETRELSPGSLLQVFFGVLVAAMNLGQASPCLEAFASGRAAATIIYETIDLNPVIDCMSEEGHKLDQVKGDIEFHNVNFCYPSRPDIKSLSDLSISIKPGETTAFVGPSGSGKSSAVQLIQRFYDPTDGKVTLDGHDLRTLNTKWLRSLIGIVEQEPVLFATTIAENISYGRDGVTMNDIEKAAKDANAYNFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALIRNPKILLLDMATSALDNESEAIVQEALNKVQSGRTTISIAHRLSTVRTADIIVGFDGGRAVEKGNHEELMKLKGVYFTLVTLQNQNNSSEKTATEDVAAEKEKPFIRGSYRSSL 611          

HSP 3 Score: 369.777 bits (948), Expect = 4.091e-105
Identity = 222/587 (37.82%), Postives = 335/587 (57.07%), Query Frame = 1
Query:  391 WPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            WP +++      S  A     +  L   L SQ   I  + S+PD+ E  R                ++G+   F  IA+  F+  +     F  + +     +R   F+A++ Q IGWFD  N+  GALT +L  D + V    G +IG ++         +I+AF   WKL+LV L   PL+ +  +  +K +     +   A   AG ++ E +G+IRT+     E   V  Y + L+   K  ++KS + G   G    ++F +YA  F +G  L+   +G     +  V  + + + T +G+A+     + +A+ AA + F+++DRVP+    +  GDK  +F+G I F   KFTYP+R    +L GLS+S++ GQT+A VG+SGCGKS+ +QL++RFYD +EG+VL+D     ++N+ +LR +IG+VSQEPVLF  SI +NI+YG    D+  EE+ +A   A+   F+  LP++ +T VG +G+QLS GQKQRIAIARA+VR+PKILLLDEATSALD+ESEK VQ ALD+  +GRT I +AHRLST++   +I  +  G + E+G+H  LMAL G Y  LV
Sbjct:  644 WPYLLV-----GSIGAAINGVVTPLYAILFSQ---ILGTFSLPDLNEQRRE---------------INGICILFVIIAVVSFVTQFFQGYAFAKSGERLTRRLRRVGFQAMLGQEIGWFDDNNNSPGALTTRLATDASQVQGATGSQIGMVVNSLTNIGASLIIAFYFSWKLSLVVLCFLPLLALAGVFQAKMLTGFANQDKNALEMAGKVSSEAIGNIRTVAGLGKETMFVEVYEKQLELPYKAAVKKSHVYGACFGFAQCVIFMAYAASFRFGGFLVNT-DGIHYAVVFRVISAIVTSGTALGRASSFTPDYAKAKIAAEQFFKLLDRVPKTSVFSSSGDKWEEFKGDIEFVNCKFTYPSRPVTMVLRGLSISVRSGQTLAFVGSSGCGKSTSVQLLERFYDPDEGKVLVDGHATANVNISFLRSKIGIVSQEPVLFEGSIADNIKYGDNSRDIPMEEVIEAAKKAHLHEFVMTLPDQYETNVGIQGSQLSRGQKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQAALDEARKGRTCIAIAHRLSTIQTCDIIAVMSQGAIVEKGSHEALMALKGAYYKLV 1206          

HSP 4 Score: 309.301 bits (791), Expect = 2.521e-85
Identity = 211/585 (36.07%), Postives = 321/585 (54.87%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIE-QQSADIRTYVI-----------ALAGIAVVAFVSSVLQNVGFGN----SGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL--YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            + +G + A+ +GA QP   +++G +       + E Q+  DI    I            +   + VA +       GF +    +  +  +  R   F  +++ DI WFD  SN++G L TR+SD+  +I     + +   I  I +      I F   W+++LV++A  P+I +G  L    +   +  +  A  ++G +A E +  IRTV+    E    + Y + +++      +K    GF  G     IF  Y+  F     L++    +S  + + + FG L+  AMNLG++      F  G+ AA  ++E +D  P I+  S +G  LD   + GDI+  NV F YP RP+I  L+D+S +I   +T A VGPSG GKS+ + L+QRFYD  +G + +D + ++ +N + LR L  IV QEP LF+ +I ENI+YG       D  I  AAK +N ++FI++LP +++T VGE G   SGGQKQRIAIARAL+RNP+ILLLD ATSALD ESE IVQ+AL+K Q GRT + IAHRLST++ AD I+ F  G+  E G H EL+   G+Y  +++LQ+ 
Sbjct:    5 MVIGALCALIHGAAQPLMLLIYGMMTDTFITYDRETQELQDINKECINDTIWWKNGTEYIVDNSTVASIDIKWFQGGFISLWVVAAARQIQIVRKEYFRKIMRLDIGWFD--SNSVGELNTRISDDINKINNAIADQVAIFIERISTFIFGFLIGFVGNWKLTLVIVAVSPLIGLGAGLMAVAVARLTGRELKAYAKAGSVADEVLSAIRTVAAFGGEKKEAERYDDNLEEAQTWGIRKGTIIGFFQGYMWCIIFLCYSLAFWYGSRLVIETRELSPGSLLQVFFGVLV-AAMNLGQASPCLEAFASGRAAATIIYETIDLNPVIDCMSEEGHKLD--QVKGDIEFHNVNFCYPSRPDIKSLSDLSISIKPGETTAFVGPSGSGKSSAVQLIQRFYDPTDGKVTLDGHDLRTLNTKWLRSLIGIVEQEPVLFATTIAENISYGRDGVTMND--IEKAAKDANAYNFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALIRNPKILLLDMATSALDNESEAIVQEALNKVQSGRTTISIAHRLSTVRTADIIVGFDGGRAVEKGNHEELMKLKGVYFTLVTLQNQ 582          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Match: mia2 (MIA SH3 domain ER export factor 2 [Source:Xenbase;Acc:XB-GENE-993630])

HSP 1 Score: 577.4 bits (1487), Expect = 2.767e-175
Identity = 297/620 (47.90%), Postives = 411/620 (66.29%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRP 2160
            GV  +F Y++ SD ++M+   I SI  G   PL+++VFG+ T          N                     +E ++         +S N+   M+  +  ++G+   + + +YV ++F+ +++  QI  IR+ FF AV+RQ IGWFD  ++G L  +L DD++ ++ GIGDKI  ++Q    F+ G I+ FV+GWKLTLV L+ISP++     + +K +   T K  +AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL+EA +IGI+K+I     +G    +++ +YAL FWYG +LI  G G+ +G +L VFF+ ++    +GQ +P++ +F  AR AA  IF IID  P+ID  ++EG K +  +G I FK VKFTYP+RTD  +L GL+L+I  G+TVALVG+SGCGKS+ +QL+QRFYD  EG + +D  +I+ LN+ +LRE IGVVSQEP+LF  +I +NIRYGR DVT EEI++A   ANA  FI  LP+K +TLVG+RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI+VAHRLST+RNA VI G  +G + EQG H ELM   G+Y +LV  Q  +P
Sbjct:   49 GVFTMFRYSSTSDRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGNF-------------------SLEALIN--------ASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTLSAGKQIKRIRSNFFHAVLRQEIGWFDVNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIING-GYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEGLKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGREDVTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQVGKP 640          

HSP 2 Score: 505.368 bits (1300), Expect = 2.415e-150
Identity = 269/582 (46.22%), Postives = 385/582 (66.15%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVS---KKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F KVM LN  E  Y  +G + A+ NGA QP+F+I+F  ++   A P  E + A    Y +    +  ++F++  LQ V FG+    L              ++I WFD+  N+ GALTTRL+ +A+Q++G +G  L  +   I ++G AV ISF + W+++L++LA VPII    ++Q+++  G +  DK  LE++GKI+ + + NIRTV +LTRE  F   Y+   K L+G      KKAH  G  Y L+QA ++ AYA  F    YL+   +    +VF+ F A++FGAM LG++ + AP++ K  I+AAH+F LL+RVP I+S+S +G     +N  G+++ + V+F+YP RP+I +L  +  ++   +T+ALVG SGCGKST + LL+RFYD   G +L+D + ++D+NIQ +R    IVSQEP LF  SI ENIAYGD+++  T  +I  AAK +NIH FI  L D+Y T+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+ GRTC+VIAHRLSTIQNADKI V ++GK+ E GTH +LL   G+Y  ++++Q
Sbjct:  697 FLKVMRLNKTEWPYFVVGIICAMINGATQPAFAIIFSKIIGVFAGPASEMR-AKSTMYSLLFLALGGISFITFFLQ-VRFGHVYFTL--------------KEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYE---KNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAELLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGE--KPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1257          

HSP 3 Score: 402.519 bits (1033), Expect = 1.117e-115
Identity = 219/479 (45.72%), Postives = 314/479 (65.55%), Query Frame = 1
Query:  730 QNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLV--GDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            + IGWFD    ++GALT +L  D + V    G ++  + Q  A     +I++F+ GW+LTL+ L+I P+I    L+  K      +K  +   KAG I+ + + +IRT+VS   E+   A Y +NL+   +  I+K+ L G    L   +M+ +YA  F +GA L+ E    L+   D+ +VF + +     +GQ +     + +A  +AA IF +++RVP ID  ++EG+K  +  G + F+ V+F YPTR D  +L GL +S++ G+T+ALVG+SGCGKS+ + L++RFYD   GEVL+D  +++DLN+ W+R Q+G+VSQEP+LF CSI ENI YG    +VT  EI+ A   AN  +FI+ L +K +T VGD+GTQ+SGGQKQRIAIARALVR PKILLLDEATSALD+ESEK+VQ+ALDK   GRT I++AHRLST++NA  I  I++GKV EQGTH +L+ L G+Y  LV  Q
Sbjct:  782 KEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYEKNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAE---LLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGEKPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1257          

HSP 4 Score: 385.185 bits (988), Expect = 5.855e-110
Identity = 230/589 (39.05%), Postives = 349/589 (59.25%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG--------------FLLPAMANP--NIEQQSADIRTYVIALA-GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            ++  +  G +++I +GA  P   I+FG              F L A+ N   N+++Q      Y   L  G+ + A+V      +   ++G+Q+ KR RS  F A+L+Q+I WFD   N+ G L TRL+D+ ++I    G+ +  ++ ++ +      I F   W+++LV+LA  P++     +  +++  F+N +  A  ++G +A E + +IRTV     +   I+ Y++ +++      KKA       G     I+ AYA  F     L++     + +V   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G  L  + + GDI+ +NVKF+YP R +I +L  ++ NI S +T+ALVG SGCGKST + L+QRFYD   G I +D   I+ +NI+ LR++  +VSQEP LF  +I +NI YG      T ++I  A K +N ++FI+ LPD++ET VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +V+AHRLSTI+NAD I  F +G I E G H EL+ K G+Y  +++LQ  K
Sbjct:   61 DRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGNFSLEALINASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTL---SAGKQI-KRIRSNFFHAVLRQEIGWFD--VNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIINGGYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEG--LKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGRED--VTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQVGK 639          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Match: mia2 (MIA SH3 domain ER export factor 2 [Source:Xenbase;Acc:XB-GENE-993630])

HSP 1 Score: 574.704 bits (1480), Expect = 3.893e-174
Identity = 296/616 (48.05%), Postives = 409/616 (66.40%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  +F Y++ SD ++M+   I SI  G   PL+++VFG+ T          N                     +E ++         +S N+   M+  +  ++G+   + + +YV ++F+ +++  QI  IR+ FF AV+RQ IGWFD  ++G L  +L DD++ ++ GIGDKI  ++Q    F+ G I+ FV+GWKLTLV L+ISP++     + +K +   T K  +AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL+EA +IGI+K+I     +G    +++ +YAL FWYG +LI  G G+ +G +L VFF+ ++    +GQ +P++ +F  AR AA  IF IID  P+ID  ++EG K +  +G I FK VKFTYP+RTD  +L GL+L+I  G+TVALVG+SGCGKS+ +QL+QRFYD  EG + +D  +I+ LN+ +LRE IGVVSQEP+LF  +I +NIRYGR DVT EEI++A   ANA  FI  LP+K +TLVG+RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI+VAHRLST+RNA VI G  +G + EQG H ELM   G+Y +LV  Q
Sbjct:   49 GVFTMFRYSSTSDRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGNF-------------------SLEALIN--------ASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTLSAGKQIKRIRSNFFHAVLRQEIGWFDVNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIING-GYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEGLKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGREDVTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQ 636          

HSP 2 Score: 541.576 bits (1394), Expect = 1.230e-162
Identity = 278/582 (47.77%), Postives = 397/582 (68.21%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVS---KKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F KVM LN  E  Y  +G + A+ NGA QP+F+I+F  ++   A P  E + A    Y +    +  ++F++  LQ   FG +GE LTKR R  +F++ML+Q+I WFD+  N+ GALTTRL+ +A+Q++G +G  L  +   I ++G AV ISF + W+++L++LA VPII    ++Q+++  G +  DK  LE++GKI+ + + NIRTV +LTRE  F   Y+   K L+G      KKAH  G  Y L+QA ++ AYA  F    YL+   +    +VF+ F A++FGAM LG++ + AP++ K  I+AAH+F LL+RVP I+S+S +G     +N  G+++ + V+F+YP RP+I +L  +  ++   +T+ALVG SGCGKST + LL+RFYD   G +L+D + ++D+NIQ +R    IVSQEP LF  SI ENIAYGD+++  T  +I  AAK +NIH FI  L D+Y T+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+ GRTC+VIAHRLSTIQNADKI V ++GK+ E GTH +LL   G+Y  ++++Q
Sbjct:  695 FLKVMRLNKTEWPYFVVGIICAMINGATQPAFAIIFSKIIGVFAGPASEMR-AKSTMYSLLFLALGGISFITFFLQGFTFGKAGEILTKRLRLWSFKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYE---KNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAELLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGE--KPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1270          

HSP 3 Score: 411.764 bits (1057), Expect = 1.323e-118
Identity = 222/485 (45.77%), Postives = 320/485 (65.98%), Query Frame = 1
Query:  712 FRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLV--GDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F++++RQ IGWFD    ++GALT +L  D + V    G ++  + Q  A     +I++F+ GW+LTL+ L+I P+I    L+  K      +K  +   KAG I+ + + +IRT+VS   E+   A Y +NL+   +  I+K+ L G    L   +M+ +YA  F +GA L+ E    L+   D+ +VF + +     +GQ +     + +A  +AA IF +++RVP ID  ++EG+K  +  G + F+ V+F YPTR D  +L GL +S++ G+T+ALVG+SGCGKS+ + L++RFYD   GEVL+D  +++DLN+ W+R Q+G+VSQEP+LF CSI ENI YG    +VT  EI+ A   AN  +FI+ L +K +T VGD+GTQ+SGGQKQRIAIARALVR PKILLLDEATSALD+ESEK+VQ+ALDK   GRT I++AHRLST++NA  I  I++GKV EQGTH +L+ L G+Y  LV  Q
Sbjct:  789 FKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYEKNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAE---LLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGEKPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1270          

HSP 4 Score: 385.185 bits (988), Expect = 7.158e-110
Identity = 229/587 (39.01%), Postives = 349/587 (59.45%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG--------------FLLPAMANP--NIEQQSADIRTYVIALA-GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++  +  G +++I +GA  P   I+FG              F L A+ N   N+++Q      Y   L  G+ + A+V      +   ++G+Q+ KR RS  F A+L+Q+I WFD   N+ G L TRL+D+ ++I    G+ +  ++ ++ +      I F   W+++LV+LA  P++     +  +++  F+N +  A  ++G +A E + +IRTV     +   I+ Y++ +++      KKA       G     I+ AYA  F     L++     + +V   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G  L  + + GDI+ +NVKF+YP R +I +L  ++ NI S +T+ALVG SGCGKST + L+QRFYD   G I +D   I+ +NI+ LR++  +VSQEP LF  +I +NI YG      T ++I  A K +N ++FI+ LPD++ET VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +V+AHRLSTI+NAD I  F +G I E G H EL+ K G+Y  +++LQ+
Sbjct:   61 DRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGNFSLEALINASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTL---SAGKQI-KRIRSNFFHAVLRQEIGWFD--VNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIINGGYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEG--LKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGRED--VTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQT 637          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Match: mia2 (MIA SH3 domain ER export factor 2 [Source:Xenbase;Acc:XB-GENE-993630])

HSP 1 Score: 574.318 bits (1479), Expect = 6.048e-174
Identity = 296/622 (47.59%), Postives = 411/622 (66.08%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTS------QMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  +F Y++ SD ++M+   I SI  G   PL+++VFG+ T       Q+ +  + + +L                                 +S N+   M+  +  ++G+   + + +YV ++F+ +++  QI  IR+ FF AV+RQ IGWFD  ++G L  +L DD++ ++ GIGDKI  ++Q    F+ G I+ FV+GWKLTLV L+ISP++     + +K +   T K  +AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL+EA +IGI+K+I     +G    +++ +YAL FWYG +LI  G G+ +G +L VFF+ ++    +GQ +P++ +F  AR AA  IF IID  P+ID  ++EG K +  +G I FK VKFTYP+RTD  +L GL+L+I  G+TVALVG+SGCGKS+ +QL+QRFYD  EG + +D  +I+ LN+ +LRE IGVVSQEP+LF  +I +NIRYGR DVT EEI++A   ANA  FI  LP+K +TLVG+RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI+VAHRLST+RNA VI G  +G + EQG H ELM   G+Y +LV  Q
Sbjct:   49 GVFTMFRYSSTSDRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGSGNFSLEALIN-------------------------------ASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTLSAGKQIKRIRSNFFHAVLRQEIGWFDVNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIING-GYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEGLKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGREDVTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQ 638          

HSP 2 Score: 541.962 bits (1395), Expect = 1.287e-162
Identity = 278/582 (47.77%), Postives = 397/582 (68.21%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVS---KKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F KVM LN  E  Y  +G + A+ NGA QP+F+I+F  ++   A P  E + A    Y +    +  ++F++  LQ   FG +GE LTKR R  +F++ML+Q+I WFD+  N+ GALTTRL+ +A+Q++G +G  L  +   I ++G AV ISF + W+++L++LA VPII    ++Q+++  G +  DK  LE++GKI+ + + NIRTV +LTRE  F   Y+   K L+G      KKAH  G  Y L+QA ++ AYA  F    YL+   +    +VF+ F A++FGAM LG++ + AP++ K  I+AAH+F LL+RVP I+S+S +G     +N  G+++ + V+F+YP RP+I +L  +  ++   +T+ALVG SGCGKST + LL+RFYD   G +L+D + ++D+NIQ +R    IVSQEP LF  SI ENIAYGD+++  T  +I  AAK +NIH FI  L D+Y T+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+ GRTC+VIAHRLSTIQNADKI V ++GK+ E GTH +LL   G+Y  ++++Q
Sbjct:  705 FLKVMRLNKTEWPYFVVGIICAMINGATQPAFAIIFSKIIGVFAGPASEMR-AKSTMYSLLFLALGGISFITFFLQGFTFGKAGEILTKRLRLWSFKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYE---KNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAELLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGE--KPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1280          

HSP 3 Score: 411.764 bits (1057), Expect = 1.321e-118
Identity = 222/485 (45.77%), Postives = 320/485 (65.98%), Query Frame = 1
Query:  712 FRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLV--GDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F++++RQ IGWFD    ++GALT +L  D + V    G ++  + Q  A     +I++F+ GW+LTL+ L+I P+I    L+  K      +K  +   KAG I+ + + +IRT+VS   E+   A Y +NL+   +  I+K+ L G    L   +M+ +YA  F +GA L+ E    L+   D+ +VF + +     +GQ +     + +A  +AA IF +++RVP ID  ++EG+K  +  G + F+ V+F YPTR D  +L GL +S++ G+T+ALVG+SGCGKS+ + L++RFYD   GEVL+D  +++DLN+ W+R Q+G+VSQEP+LF CSI ENI YG    +VT  EI+ A   AN  +FI+ L +K +T VGD+GTQ+SGGQKQRIAIARALVR PKILLLDEATSALD+ESEK+VQ+ALDK   GRT I++AHRLST++NA  I  I++GKV EQGTH +L+ L G+Y  LV  Q
Sbjct:  799 FKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYEKNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAE---LLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERVPLIDSYSKEGEKPQNCGGNVQFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1280          

HSP 4 Score: 384.8 bits (987), Expect = 1.236e-109
Identity = 229/589 (38.88%), Postives = 349/589 (59.25%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG----------------FLLPAMANP--NIEQQSADIRTYVIALA-GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++  +  G +++I +GA  P   I+FG                F L A+ N   N+++Q      Y   L  G+ + A+V      +   ++G+Q+ KR RS  F A+L+Q+I WFD   N+ G L TRL+D+ ++I    G+ +  ++ ++ +      I F   W+++LV+LA  P++     +  +++  F+N +  A  ++G +A E + +IRTV     +   I+ Y++ +++      KKA       G     I+ AYA  F     L++     + +V   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G  L  + + GDI+ +NVKF+YP R +I +L  ++ NI S +T+ALVG SGCGKST + L+QRFYD   G I +D   I+ +NI+ LR++  +VSQEP LF  +I +NI YG      T ++I  A K +N ++FI+ LPD++ET VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +V+AHRLSTI+NAD I  F +G I E G H EL+ K G+Y  +++LQ+
Sbjct:   61 DRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVGSGNFSLEALINASRNLQEQMTTYAYYYSGLGFGVLLFAYVQISFWTL---SAGKQI-KRIRSNFFHAVLRQEIGWFD--VNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIINGGYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEG--LKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGRED--VTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQT 639          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Match: mia2 (MIA SH3 domain ER export factor 2 [Source:Xenbase;Acc:XB-GENE-993630])

HSP 1 Score: 572.778 bits (1475), Expect = 1.038e-173
Identity = 295/616 (47.89%), Postives = 409/616 (66.40%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  +F Y++ SD ++M+   I SI  G   PL+++VFG+              +T    +  +    ST+     +  R K+  +              +  ++G+   + + +YV ++F+ +++  QI  IR+ FF AV+RQ IGWFD  ++G L  +L DD++ ++ GIGDKI  ++Q    F+ G I+ FV+GWKLTLV L+ISP++     + +K +   T K  +AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL+EA +IGI+K+I     +G    +++ +YAL FWYG +LI  G G+ +G +L VFF+ ++    +GQ +P++ +F  AR AA  IF IID  P+ID  ++EG K +  +G I FK VKFTYP+RTD  +L GL+L+I  G+TVALVG+SGCGKS+ +QL+QRFYD  EG + +D  +I+ LN+ +LRE IGVVSQEP+LF  +I +NIRYGR DVT EEI++A   ANA  FI  LP+K +TLVG+RGTQLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI+VAHRLST+RNA VI G  +G + EQG H ELM   G+Y +LV  Q
Sbjct:   49 GVFTMFRYSSTSDRILMLFGTIASISHGAALPLMMIVFGD--------------MTDSFVNVGQVAFHSTAHARANDTGRRKRCRY--------------AYYYSGLGFGVLLFAYVQISFWTLSAGKQIKRIRSNFFHAVLRQEIGWFDVNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIING-GYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEGLKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGREDVTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQ 635          

HSP 2 Score: 520.39 bits (1339), Expect = 1.612e-155
Identity = 272/582 (46.74%), Postives = 385/582 (66.15%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVS---KKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F KVM LN  E  Y  +G + A+ NGA QP+F+I+F  ++   A P  E + A    Y +    +  ++F++  LQ   FG +GE LTKR R  +F++ML+Q+I WFD+  N+ GALTTRL+ +A+Q++G +G  L  +   I ++G AV ISF + W+++L++LA VPII    ++Q+++  G +  DK  LE++GKI+ + + NIRTV +LTRE  F   Y+   K L+G      KKAH  G  Y L+QA ++ AYA  F    YL+   +    +VF+ F A++FGAM LG++ + AP++ K  I+AAH+F LL+R                  + G I  + V+F+YP RP+I +L  +  ++   +T+ALVG SGCGKST + LL+RFYD   G +L+D + ++D+NIQ +R    IVSQEP LF  SI ENIAYGD+++  T  +I  AAK +NIH FI  L D+Y T+VG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEK+VQ+ALDKA+ GRTC+VIAHRLSTIQNADKI V ++GK+ E GTH +LL   G+Y  ++++Q
Sbjct:  694 FLKVMRLNKTEWPYFVVGIICAMINGATQPAFAIIFSKIIGVFAGPASEMR-AKSTMYSLLFLALGGISFITFFLQGFTFGKAGEILTKRLRLWSFKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYE---KNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAELLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLER------------------LGGYITFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1253          

HSP 3 Score: 390.578 bits (1002), Expect = 9.226e-112
Identity = 217/485 (44.74%), Postives = 311/485 (64.12%), Query Frame = 1
Query:  712 FRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLV--GDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F++++RQ IGWFD    ++GALT +L  D + V    G ++  + Q  A     +I++F+ GW+LTL+ L+I P+I    L+  K      +K  +   KAG I+ + + +IRT+VS   E+   A Y +NL+   +  I+K+ L G    L   +M+ +YA  F +GA L+ E    L+   D+ +VF + +     +GQ +     + +A  +AA IF +++R+                 G ITF+ V+F YPTR D  +L GL +S++ G+T+ALVG+SGCGKS+ + L++RFYD   GEVL+D  +++DLN+ W+R Q+G+VSQEP+LF CSI ENI YG    +VT  EI+ A   AN  +FI+ L +K +T VGD+GTQ+SGGQKQRIAIARALVR PKILLLDEATSALD+ESEK+VQ+ALDK   GRT I++AHRLST++NA  I  I++GKV EQGTH +L+ L G+Y  LV  Q
Sbjct:  788 FKSMLRQEIGWFDDTKNSTGALTTRLATDASQVQGATGSRLALLAQNIANLGTAVIISFIYGWRLTLLILAIVPIIAASALVQLKMFAGHAKKDKKELEKAGKISTDAVLNIRTVVSLTRERKFEAMYEKNLEGPYRNSIKKAHLHGLTYALSQAIMYFAYAGCFRFGAYLVAE---LLMTPDDVFLVFSAIVFGAMALGQTSSFAPDYTKAMISAAHIFSLLERLG----------------GYITFQGVQFNYPTRPDITVLQGLDISVKQGETLALVGSSGCGKSTTVSLLERFYDPFGGEVLVDGHSVRDLNIQWVRAQMGIVSQEPILFDCSIGENIAYGDNSREVTQAEIETAAKEANIHSFIDTLTDKYNTRVGDKGTQMSGGQKQRIAIARALVRKPKILLLDEATSALDTESEKVVQEALDKARTGRTCIVIAHRLSTIQNADKIAVIQNGKVVEQGTHQQLLQLKGVYYTLVTIQ 1253          

HSP 4 Score: 379.407 bits (973), Expect = 4.970e-108
Identity = 226/586 (38.57%), Postives = 345/586 (58.87%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFLLP---------------AMANPNIEQQSADIRTYVIALA-GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++  +  G +++I +GA  P   I+FG +                 A AN    ++      Y   L  G+ + A+V      +   ++G+Q+ KR RS  F A+L+Q+I WFD   N+ G L TRL+D+ ++I    G+ +  ++ ++ +      I F   W+++LV+LA  P++     +  +++  F+N +  A  ++G +A E + +IRTV     +   I+ Y++ +++      KKA       G     I+ AYA  F     L++     + +V   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G  L  + + GDI+ +NVKF+YP R +I +L  ++ NI S +T+ALVG SGCGKST + L+QRFYD   G I +D   I+ +NI+ LR++  +VSQEP LF  +I +NI YG      T ++I  A K +N ++FI+ LPD++ET VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +V+AHRLSTI+NAD I  F +G I E G H EL+ K G+Y  +++LQ+
Sbjct:   61 DRILMLFGTIASISHGAALPLMMIVFGDMTDSFVNVGQVAFHSTAHARANDTGRRKRCRYAYYYSGLGFGVLLFAYVQISFWTL---SAGKQI-KRIRSNFFHAVLRQEIGWFD--VNDAGELNTRLTDDVSKINEGIGDKIAMLLQSLTTFVTGFIIGFVKGWKLTLVILAISPVMGFSAAIWAKVLSAFTNKELKAYAKAGAVAEEVLSSIRTVFAFGGQDKEIKRYEKNLEEAKRIGIKKAITANVSIGFAFLMIYAAYALAFWYGTTLIINGGYTIGSVLTVFFAVIIGAFAVGQTSPNVEAFANARGAAYTIFNIIDNQPKIDSFSKEG--LKPDKIKGDIEFKNVKFTYPSRTDIQVLKGLNLNIPSGKTVALVGSSGCGKSTTVQLIQRFYDPEEGVITLDGQDIRSLNIRYLREIIGVVSQEPILFDTTIADNIRYGRED--VTMEEIERATKEANAYNFIMKLPDKFETLVGERGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESESVVQAALDKAREGRTTIVVAHRLSTIRNADVIAGFDNGVIVEQGGHKELMDKGGVYFNLVTLQT 636          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Match: Abcb1a (ATP-binding cassette, sub-family B (MDR/TAP), member 1A [Source:MGI Symbol;Acc:MGI:97570])

HSP 1 Score: 563.148 bits (1450), Expect = 2.755e-170
Identity = 297/612 (48.53%), Postives = 400/612 (65.36%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +F YA   D + M+   + +I  GV  PL++L+FG+ T   A+    + ++++  T+ +E          +EE +    Y +T                  GI   + I++Y+ V+F+ + +  QI  IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F GG I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY  NL+EA ++GI+K+I     +G    L++ SYAL FWYG SL+     + +G +L VFFS L+    +GQA+P++ +F  AR AA E+F+IID  P ID  ++ G K ++ QG + FK + F+YP+R +  IL GL+L ++ GQTVALVG SGCGKS+ +QLMQR YD  +G V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI++A+  ANA  FI  LP++ DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA VI G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   38 MFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFAS----VGNVSKNSTNMSEA-DKRAMFAKLEEEMTTYAYYYT------------------GIGAGVLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE-YSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQ 625          

HSP 2 Score: 556.984 bits (1434), Expect = 3.795e-168
Identity = 273/585 (46.67%), Postives = 408/585 (69.74%), Query Frame = 2
Query: 2300 AGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMAN---PNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            A F++++ LN+ E  Y  +G   AI NG +QP+FS++F  ++    N   P  ++Q++++ + +  + GI  ++F++  LQ   FG +GE LTKR R + F++ML+QD++WFD+P N  GALTTRL+++A Q++G +G  L  +   I ++G  + IS  + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+   +    NV + F A++FGAM +G+  + AP++ K  ++A+H+  ++++ P I+S+ST G  L    + G+++   V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G++ +D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+S+Q+
Sbjct:  691 ASFWRILKLNSTEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSLLFLILGI--ISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQG--LKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQA 1271          

HSP 3 Score: 409.068 bits (1050), Expect = 7.222e-118
Identity = 228/532 (42.86%), Postives = 332/532 (62.41%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +SN+F+L+      F  + +  FI  ++    F    +     +R   F++++RQ++ WFD     +GALT +L +D   V    G ++  + Q  A    GII++ + GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+ +       ++L+VF + +     +GQ +     + +A  +A+ I  II++ PEID  + +G K N  +G + F  V F YPTR   P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   IK LNV WLR Q+G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI++LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V  Q
Sbjct:  747 NSNLFSLL------FLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETM-YAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQ-QLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQ 1270          

HSP 4 Score: 365.54 bits (937), Expect = 1.777e-103
Identity = 223/589 (37.86%), Postives = 341/589 (57.89%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMAN-PNIEQQS-----ADIR-----------TYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++ Y+ +G ++AI +G   P   ++FG +  + A+  N+ + S     AD R           TY     GI     + + +Q V F    +G Q+ K  R   F A++ Q+I WFD   +++G L TRL+D+ ++I    G+ +G    A+ +      I F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y   +++      KKA       G     I+ +YA  F     L++     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  N+ G+++ +N+ FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD L+G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP Q++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++  Q+
Sbjct:   46 DRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASVGNVSKNSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAGVLIVAYIQ-VSFWCLAAGRQIHK-IRQKFFHAIMNQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPD--NIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRED--VTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQT 626          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Match: Abcb1b (ATP-binding cassette, sub-family B (MDR/TAP), member 1B [Source:MGI Symbol;Acc:MGI:97568])

HSP 1 Score: 563.148 bits (1450), Expect = 3.311e-170
Identity = 303/616 (49.19%), Postives = 404/616 (65.58%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  +F YA   D + MI   + +I  G   PL++LVFGN T      +    S+   +T+Q+ P  +ST I               +S+S++   M+  +  + GI   + I++Y+ V+ + + +  QI  IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q    F+ G I+ F+ GWKLTLV L++SPLI +   + +K +   T K  +AY KAG +AEEVL +IRT+++F G++ E+ RY +NL+EA  +GI+K+I     +G+   L++ SYAL FWYG SL+   N + +G++L VFFS L+ T  IG   P++ +F  AR AA EIF+IID  P ID  + +G K +   G + FK V F YP+R++  IL GL+L ++ GQTVALVG SGCGKS+ +QLMQR YD  EG V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI++A+  ANA  FI  LP++ DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA VI G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   34 GVFGMFRYADWLDKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAE---ASILPSITNQSGP--NSTLI---------------ISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLS-NEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQ 628          

HSP 2 Score: 540.421 bits (1391), Expect = 2.396e-162
Identity = 263/577 (45.58%), Postives = 397/577 (68.80%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA-NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMI 4033
            F++++ LN  E  Y+ +G + A+ NG +QP F+I+F  ++   + + + E +  +   + +    + +++FV+   Q   FG +GE LTKR R + F++ML+QDI+WFD+  N+ G+LTTRL+ +A+ ++G  G  L  V   + ++G  V +S  + WQ++L+++  +P+I +GGI++++++ G +  DK  LE SGKIA E IEN RT+ +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+   +    NV + F A++FGAM  G + + AP++ K K++A+H+  ++++ P I+S+ST+G  L    + G++K   V+F+YP RPNI +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G++ +D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD+++  + ++I+ AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+
Sbjct:  695 FWRILNLNLSEWPYLLVGVLCAVINGCIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEG--LKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMV 1269          

HSP 3 Score: 405.601 bits (1041), Expect = 1.105e-116
Identity = 226/525 (43.05%), Postives = 331/525 (63.05%), Query Frame = 1
Query:  610 FAGIALAMFIMSYVSVTF--FVITSQHQI--SAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
            F+   L M ++S+V+  F  F      +I    +R   F++++RQ+I WFD    ++G+LT +L  D ++V   +G ++  + Q  A    G+IL+ V GW+LTL+ + I PLI++  ++  K +     K  +    +G IA E + + RTIVS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+ +       ++++VF + +      G  +     + +A+ +A+ I  II++ PEID  + EG K    +G + F  V+F YPTR + P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI++LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V     R
Sbjct:  753 FSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETM-YAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQ-QLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVQAGAKR 1275          

HSP 4 Score: 376.711 bits (966), Expect = 4.036e-107
Identity = 230/598 (38.46%), Postives = 350/598 (58.53%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFL-----------LPAMAN---PN---------IEQQSADIRTYVIAL-AGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPN---FGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            +K  + LG ++AI +G + P   ++FG +           LP++ N   PN         +E++ A    Y   + AG+ +VA++   L  +    +G Q+ K  R   F A++ Q+I WFD   +++G L TRL+D+ ++I    G+ +G    +I +  A   I F   W+++LV+LA  P+I +   L  +++  F+N +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G+    ++ +YA  F     L+L N   +  V   F +++ G  ++G    +APN   F   + AA  +F+++D  P I+SFST G   D  ++ G+++ +NV F+YP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD L G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP Q++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++  Q+ 
Sbjct:   46 DKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLA---AGRQIHK-IRQKFFHAIMNQEIGWFD--VHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGH---LAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPD--SIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRED--VTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTR 630          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Match: Abcb4 (ATP-binding cassette, sub-family B (MDR/TAP), member 4 [Source:MGI Symbol;Acc:MGI:97569])

HSP 1 Score: 533.872 bits (1374), Expect = 1.647e-164
Identity = 286/616 (46.43%), Postives = 403/616 (65.42%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G+  LF Y+   D + M    +M+I  G   PL+++VFG  T +      ++++   F    + P+  S S+ +   I+  +              M+  +  ++G+   + + +Y+ V+F+ + +  QI  IR  FF A++RQ +GWFD + +  L  +L DD++ +  GIGDK+G   Q  A F  G I+ F+RGWKLTLV ++ISP++ +   + +K +   + K   AY KAG +AEE LG+IRT+++F G+  E+ RY ++L+ A KIGI+K+I     +G+   L++ SYAL FWYG++L+     + +G+ + VFFS L+    +GQA P + +F  AR AA  IF+IID  P+ID  +E G K ++ +G + F  V F+YP+R +  IL GL+L ++ GQTVALVG SGCGKS+ +QL+QR YD  EG++ ID  +I++ NV  LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP K DTLVGDRG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE  VQ ALDK  EGRTTI++AHRLST+RNA VI G +DG + EQG+H+ELM   G+Y  LV+ Q
Sbjct:   38 GLLTLFRYSDWQDKLFMFLGTLMAIAHGSGLPLMMIVFGEMTDK------FVDNTGNF----SLPVNFSLSMLNPGRILEEE--------------MTRYAYYYSGLGGGVLVAAYIQVSFWTLAAGRQIKKIRQKFFHAILRQEMGWFDIKGTTELNTRLTDDVSKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAISPILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKE-YTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDNIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQDIRNFNVRCLREIIGVVSQEPVLFSTTIAENIRYGRGNVTMDEIEKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTIRNADVIAGFEDGVIVEQGSHSELMKKEGIYFRLVNMQ 628          

HSP 2 Score: 366.696 bits (940), Expect = 5.399e-107
Identity = 230/590 (38.98%), Postives = 346/590 (58.64%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG------------FLLP-----AMANPN--IEQQSADIRTYVIALAG-IAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            +K ++FLG + AI +G+  P   I+FG            F LP     +M NP   +E++      Y   L G + V A++      +    +G Q+ K+ R   F A+L+Q++ WFD        L TRL+D+ ++I    G+ +G    AI +  A   + F   W+++LV++A  PI+ +   +  +I+  FS+ +  A  ++G +A E +  IRTV     ++  ++ Y++ ++       KKA +     G+    I+ +YA  F     L++     + N    F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  N+ G+++  +V FSYP R NI IL  ++  + S QT+ALVG SGCGKST + LLQR YD   G I ID   I++ N++ LR++  +VSQEP LFS +I ENI YG      T D+I  A K +N +DFI+ LP +++T VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE  VQ ALDKA+EGRT +VIAHRLSTI+NAD I  F+DG I E G+H EL+ K GIY +++++Q+
Sbjct:   50 DKLFMFLGTLMAIAHGSGLPLMMIVFGEMTDKFVDNTGNFSLPVNFSLSMLNPGRILEEEMTRYAYYYSGLGGGVLVAAYIQVSFWTLA---AGRQI-KKIRQKFFHAILRQEMGWFDIKGTT--ELNTRLTDDVSKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAISPILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPD--NIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQDIRNFNVRCLREIIGVVSQEPVLFSTTIAENIRYGRGN--VTMDEIEKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTIRNADVIAGFEDGVIVEQGSHSELMKKEGIYFRLVNMQT 629          

HSP 3 Score: 149.443 bits (376), Expect = 1.580e-35
Identity = 74/192 (38.54%), Postives = 123/192 (64.06%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPN---IEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSD 2872
            F KV+ LN  E  Y  +G V AI NGA+QP+FSI+   ++ A+  P    ++QQ  ++  + +   G+ V++F +  LQ   FG +GE LT R RS+ F+AML+QD++WFD+  N+ GAL+TRL+ +A Q++G +G  L  +     ++G  + ISF + WQ++L++L+ VP I V GI++++++ G +  D
Sbjct:  694 FLKVLKLNKTEWPYFVVGTVCAIANGALQPAFSIILSEMI-AIFGPGDDAVKQQKCNM--FSLVFLGLGVLSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVEMKMLAGNAKRD 882          

HSP 4 Score: 66.2402 bits (160), Expect = 6.321e-10
Identity = 37/125 (29.60%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  574 NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIIC 942
            N+F+L+      F G+ +  F   ++    F    +   + +R+  F+A++RQ++ WFD    ++GAL+ +L  D   V    G ++  + Q  A    GII++F+ GW+LTL+ LS+ P I + 
Sbjct:  749 NMFSLV------FLGLGVLSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVA 867          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Match: Abcb4 (ATP-binding cassette, sub-family B (MDR/TAP), member 4 [Source:MGI Symbol;Acc:MGI:97569])

HSP 1 Score: 536.569 bits (1381), Expect = 5.928e-161
Identity = 271/583 (46.48%), Postives = 398/583 (68.27%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPN---IEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F KV+ LN  E  Y  +G V AI NGA+QP+FSI+   ++ A+  P    ++QQ  ++  + +   G+ V++F +  LQ   FG +GE LT R RS+ F+AML+QD++WFD+  N+ GAL+TRL+ +A Q++G +G  L  +     ++G  + ISF + WQ++L++L+ VP I V GI++++++ G +  DK  +E +GKIA E IENIRTV +LT+E  F   Y E +        +KAH  G  + ++QA ++ +YA  F    YL++    +  +V + F A++ GA+ LG + + AP++ K K++AA++F L +R P I+S+S +G+  D     G +    V F+YP R N+ +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G++L+D  + K +N+Q LR    IVSQEP LF  SI ENIAYGD++++   D+I+ AAK +NIH FI  LP +Y T+VG+KG+  SGGQKQRIAIARAL+R PR+LLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+++Q+
Sbjct:  694 FLKVLKLNKTEWPYFVVGTVCAIANGALQPAFSIILSEMI-AIFGPGDDAVKQQKCNM--FSLVFLGLGVLSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVEMKMLAGNAKRDKKEMEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLHGPYRNSVRKAHIYGITFSISQAFMYFSYAGCFRFGSYLIVNGHMRFKDVILVFSAIVLGAVALGHASSFAPDYAKAKLSAAYLFSLFERQPLIDSYSGEGLWPD--KFEGSVTFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVPHDEIVRAAKEANIHPFIETLPQKYNTRVGDKGTQLSGGQKQRIAIARALIRQPRVLLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVNIQA 1271          

HSP 2 Score: 533.872 bits (1374), Expect = 3.939e-160
Identity = 286/616 (46.43%), Postives = 403/616 (65.42%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G+  LF Y+   D + M    +M+I  G   PL+++VFG  T +      ++++   F    + P+  S S+ +   I+  +              M+  +  ++G+   + + +Y+ V+F+ + +  QI  IR  FF A++RQ +GWFD + +  L  +L DD++ +  GIGDK+G   Q  A F  G I+ F+RGWKLTLV ++ISP++ +   + +K +   + K   AY KAG +AEE LG+IRT+++F G+  E+ RY ++L+ A KIGI+K+I     +G+   L++ SYAL FWYG++L+     + +G+ + VFFS L+    +GQA P + +F  AR AA  IF+IID  P+ID  +E G K ++ +G + F  V F+YP+R +  IL GL+L ++ GQTVALVG SGCGKS+ +QL+QR YD  EG++ ID  +I++ NV  LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP K DTLVGDRG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE  VQ ALDK  EGRTTI++AHRLST+RNA VI G +DG + EQG+H+ELM   G+Y  LV+ Q
Sbjct:   38 GLLTLFRYSDWQDKLFMFLGTLMAIAHGSGLPLMMIVFGEMTDK------FVDNTGNF----SLPVNFSLSMLNPGRILEEE--------------MTRYAYYYSGLGGGVLVAAYIQVSFWTLAAGRQIKKIRQKFFHAILRQEMGWFDIKGTTELNTRLTDDVSKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAISPILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKE-YTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDNIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQDIRNFNVRCLREIIGVVSQEPVLFSTTIAENIRYGRGNVTMDEIEKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTIRNADVIAGFEDGVIVEQGSHSELMKKEGIYFRLVNMQ 628          

HSP 3 Score: 416.387 bits (1069), Expect = 2.526e-120
Identity = 226/529 (42.72%), Postives = 333/529 (62.95%), Query Frame = 1
Query:  574 NIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            N+F+L+      F G+ +  F   ++    F    +   + +R+  F+A++RQ++ WFD    ++GAL+ +L  D   V    G ++  + Q  A    GII++F+ GW+LTL+ LS+ P I +  ++  K +    ++  +    AG IA E + +IRT+VS   E+   + Y E L    +  +RK+ + G    +    M+ SYA  F +G+ LI  G+     D+++VF + ++    +G A+     + +A+ +AA +F + +R P ID  + EG   + F+G +TF  V F YPTR + P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G VL+D    K LNV WLR Q+G+VSQEP+LF CSI ENI YG     V  +EI +A   AN   FI  LP K +T VGD+GTQLSGGQKQRIAIARAL+R P++LLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V+ Q
Sbjct:  749 NMFSLV------FLGLGVLSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVEMKMLAGNAKRDKKEMEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLHGPYRNSVRKAHIYGITFSISQAFMYFSYAGCFRFGSYLIVNGH-MRFKDVILVFSAIVLGAVALGHASSFAPDYAKAKLSAAYLFSLFERQPLIDSYSGEGLWPDKFEGSVTFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVPHDEIVRAAKEANIHPFIETLPQKYNTRVGDKGTQLSGGQKQRIAIARALIRQPRVLLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVNIQ 1270          

HSP 4 Score: 366.311 bits (939), Expect = 9.220e-104
Identity = 230/590 (38.98%), Postives = 346/590 (58.64%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFG------------FLLP-----AMANPN--IEQQSADIRTYVIALAG-IAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            +K ++FLG + AI +G+  P   I+FG            F LP     +M NP   +E++      Y   L G + V A++      +    +G Q+ K+ R   F A+L+Q++ WFD        L TRL+D+ ++I    G+ +G    AI +  A   + F   W+++LV++A  PI+ +   +  +I+  FS+ +  A  ++G +A E +  IRTV     ++  ++ Y++ ++       KKA +     G+    I+ +YA  F     L++     + N    F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  N+ G+++  +V FSYP R NI IL  ++  + S QT+ALVG SGCGKST + LLQR YD   G I ID   I++ N++ LR++  +VSQEP LFS +I ENI YG      T D+I  A K +N +DFI+ LP +++T VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE  VQ ALDKA+EGRT +VIAHRLSTI+NAD I  F+DG I E G+H EL+ K GIY +++++Q+
Sbjct:   50 DKLFMFLGTLMAIAHGSGLPLMMIVFGEMTDKFVDNTGNFSLPVNFSLSMLNPGRILEEEMTRYAYYYSGLGGGVLVAAYIQVSFWTLA---AGRQI-KKIRQKFFHAILRQEMGWFDIKGTT--ELNTRLTDDVSKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAISPILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPD--NIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQDIRNFNVRCLREIIGVVSQEPVLFSTTIAENIRYGRGN--VTMDEIEKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTIRNADVIAGFEDGVIVEQGSHSELMKKEGIYFRLVNMQT 629          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Match: Abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:MGI Symbol;Acc:MGI:1924956])

HSP 1 Score: 502.671 bits (1293), Expect = 1.263e-149
Identity = 260/577 (45.06%), Postives = 370/577 (64.12%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
              K+  L+  E  ++ LG +++  NG+V P FSI+FG L+    + N      D   Y + L  + +VA V+ ++Q + +G + E L  R R   F+AML QD+AW+D+  NN GALTT L+ +  QI+G +   LG V   + +M  ++ ISF + W+++L++L+F P++ V G++Q   M GF+N DK AL+ +GKIA E +ENIRTV +LTRE  F Q Y+E ++       K+AH  G  Y ++ A +  A+AA F    YL+         +FI F A+ +GAM +G+++  AP + K K  A+H+F LL   P INS S  G   D     G+++   V F YP RP + +L ++S +I   +T+A VG SGCGKST + LLQRFYD + G +L+D   +K++N+Q LR   +IVSQEP LF+ SI ENIAYGD++++   ++I   A A+NIH FI  LP +Y T VG +G   SGGQKQR+AIARALLR P+ILLLDEATSALD ESEK+VQ ALDKA+ G+TC+V+AHRLSTIQNAD I+V ++G I E GTH ELL     Y ++++
Sbjct:  679 LLKIFKLSKSEWPFVVLGTLASALNGSVHPVFSIIFGKLVTMFEDKNKATLKQDAELYSMMLVVLGIVALVTYLMQGLFYGRAEENLAMRLRHSAFKAMLYQDMAWYDDKENNTGALTTTLAVDVAQIQGAATSRLGIVTQDVSNMSLSILISFIYGWEMTLLILSFAPVLAVTGMIQTAAMAGFANRDKQALKRAGKIATEAVENIRTVVSLTRERAFEQMYEETLQTQHRNALKRAHITGCCYAVSHAFVHFAHAAGFRFGAYLIQAGRMMPEGMFIVFTAIAYGAMAIGETLVWAPEYSKAKAGASHLFALLKNKPTINSCSQSGEKPD--TCEGNLEFREVSFVYPCRPEVPVLQNMSLSIEKGKTVAFVGSSGCGKSTCVQLLQRFYDPMKGQVLLDGVDVKELNVQWLRSQTAIVSQEPVLFNCSIAENIAYGDNSRMVPLEEIKEVADAANIHSFIEGLPRKYNTLVGLRGVQLSGGQKQRLAIARALLRKPKILLLDEATSALDNESEKVVQQALDKARRGKTCLVVAHRLSTIQNADMIVVLQNGSIKEQGTHQELLRNGDTYFKLVA 1253          

HSP 2 Score: 499.59 bits (1285), Expect = 1.476e-148
Identity = 280/626 (44.73%), Postives = 390/626 (62.30%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGN-GFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERR 2184
            ++F +A   DIV+M   I+ S+  G T PL+ LV G  +  +        + T++   QN    S T     E+I+             + TL       + GI  A  I  YV ++F+VIT+  Q + IR  FF +++ Q+I WFD  +   L  ++  DIN +  GIGDKI  M Q  + F  G++++ ++ WKL+LV LS SPLI+    + S+ ++ LT K  +AY KAG +AEE L SI+T+ +F  ++ E+ RYT++L +A   GI+++  +   LG V   M G+Y L FWYG SLI  G  G+ +G +L VFFS + ++  IG   PH+ +F  AR AA  IF++ID+ P ID  +  G      +G I FK V F+YP+R    +L GL+L I+ G+TVALVG SG GKS+ +QL+QR YD  +G + +D+ +I+  NV   REQIGVV QEPVLFG +I  NI++GR  V ++E++QA   ANA  FI A P K +TLVG++G Q+SGGQKQRIAIARALVRNPKIL+LDEATSALD+ESE +VQ AL+K  +GRTTI+VAHRLST+R A +I  +KDG V E+GTHAELMA  GLY  L   Q  +   ++ E R
Sbjct:   36 EIFRFADNLDIVLMTLGILASMINGATVPLMSLVLGEISDHLINGCLVQTNRTKY---QN---CSQTQEKLNEDII-------------VLTLY------YIGIGAAALIFGYVQISFWVITAARQTTRIRKQFFHSILAQDISWFDGSDICELNTRMTGDINKLCDGIGDKIPLMFQNISGFSIGLVISLIKSWKLSLVVLSTSPLIMASSALCSRMIISLTSKELDAYSKAGAVAEEALSSIQTVTAFGAQEKEIQRYTQHLKDAKDAGIKRATASKLSLGAVYFFMNGAYGLAFWYGTSLIFGGEPGYTIGTILAVFFSVIHSSYCIGSVAPHLETFTVARGAAFNIFQVIDKKPNIDNFSTAGFVPECIEGNIEFKNVSFSYPSRPSAKVLKGLNLKIKAGETVALVGPSGSGKSTTVQLLQRLYDPEDGCITVDENDIRAQNVRHYREQIGVVRQEPVLFGTTIGNNIKFGREGVGEKEMEQAAREANAYDFIMAFPKKFNTLVGEKGAQMSGGQKQRIAIARALVRNPKILILDEATSALDTESESLVQTALEKASKGRTTIVVAHRLSTIRGADLIVTMKDGMVVEKGTHAELMAKQGLYYSLAMAQDIKKVDEQMESR 636          

HSP 3 Score: 390.193 bits (1001), Expect = 7.985e-112
Identity = 210/512 (41.02%), Postives = 321/512 (62.70%), Query Frame = 1
Query:  619 IALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQ--NSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG---RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            +AL  ++M  +   F+    ++    +R++ F+A++ Q++ W+D +  N+GALT  L  D+  +      ++G + Q  +     I+++F+ GW++TL+ LS +P++ +  ++ +  M     +  +A  +AG IA E + +IRT+VS   E+     Y E L    +  ++++ +TG    +    +  ++A GF +GA LI+ G     G M IVF +       IG+       +++A++ A+ +F ++   P I+  ++ G+K +  +G + F+ V F YP R + P+L  +SLSI+ G+TVA VG+SGCGKS+ +QL+QRFYD  +G+VL+D  ++K+LNV WLR Q  +VSQEPVLF CSI ENI YG   RM V  EEI +    AN  +FI  LP K +TLVG RG QLSGGQKQR+AIARAL+R PKILLLDEATSALD+ESEK+VQ ALDK   G+T ++VAHRLST++NA +I  +++G ++EQGTH EL+     Y  LV
Sbjct:  746 VALVTYLMQGL---FYGRAEENLAMRLRHSAFKAMLYQDMAWYDDKENNTGALTTTLAVDVAQIQGAATSRLGIVTQDVSNMSLSILISFIYGWEMTLLILSFAPVLAVTGMIQTAAMAGFANRDKQALKRAGKIATEAVENIRTVVSLTRERAFEQMYEETLQTQHRNALKRAHITGCCYAVSHAFVHFAHAAGFRFGAYLIQAGRMMPEG-MFIVFTAIAYGAMAIGETLVWAPEYSKAKAGASHLFALLKNKPTINSCSQSGEKPDTCEGNLEFREVSFVYPCRPEVPVLQNMSLSIEKGKTVAFVGSSGCGKSTCVQLLQRFYDPMKGQVLLDGVDVKELNVQWLRSQTAIVSQEPVLFNCSIAENIAYGDNSRM-VPLEEIKEVADAANIHSFIEGLPRKYNTLVGLRGVQLSGGQKQRLAIARALLRKPKILLLDEATSALDNESEKVVQQALDKARRGKTCLVVAHRLSTIQNADMIVVLQNGSIKEQGTHQELLRNGDTYFKLV 1252          

HSP 4 Score: 329.331 bits (843), Expect = 1.045e-91
Identity = 209/586 (35.67%), Postives = 323/586 (55.12%), Query Frame = 2
Query: 2354 LGCVSAIFNGAVQPSFSILFGFLLPAMANPNI---------------EQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            LG ++++ NGA  P  S++ G +   + N  +               E+ + DI    +   GI   A +   +Q   +  +  + T R R   F ++L QDI+WFD   ++I  L TR++ +  ++    G+ +  +   I      + IS    W++SLVVL+  P+I     L  R++   ++ +  A  ++G +A E + +I+TV+    +   IQ Y + +K       K+A A     G     +  AY   F     L+      Y +  +  VF S   +I  +  +G        F   + AA ++F+++D+ P I++FST G V   E + G+I+ +NV FSYP RP+  +L  ++  I + +T+ALVGPSG GKST + LLQR YD  +G I +D N I+  N+++ R+   +V QEP LF  +I  NI +G       + ++  AA+ +N +DFI+  P ++ T VGEKG+  SGGQKQRIAIARAL+RNP+IL+LDEATSALDTESE +VQ AL+KA +GRT +V+AHRLSTI+ AD I+  KDG + E GTH EL++K G+Y  +   Q  K
Sbjct:   51 LGILASMINGATVPLMSLVLGEISDHLINGCLVQTNRTKYQNCSQTQEKLNEDIIVLTLYYIGIGAAALIFGYVQISFWVITAARQTTRIRKQFFHSILAQDISWFD--GSDICELNTRMTGDINKLCDGIGDKIPLMFQNISGFSIGLVISLIKSWKLSLVVLSTSPLIMASSALCSRMIISLTSKELDAYSKAGAVAEEALSSIQTVTAFGAQEKEIQRYTQHLKDAKDAGIKRATASKLSLGAVYFFMNGAYGLAFWYGTSLIFGGEPGYTIGTILAVFFS---VIHSSYCIGSVAPHLETFTVARGAAFNIFQVIDKKPNIDNFSTAGFV--PECIEGNIEFKNVSFSYPSRPSAKVLKGLNLKIKAGETVALVGPSGSGKSTTVQLLQRLYDPEDGCITVDENDIRAQNVRHYREQIGVVRQEPVLFGTTIGNNIKFGREG--VGEKEMEQAAREANAYDFIMAFPKKFNTLVGEKGAQMSGGQKQRIAIARALVRNPKILILDEATSALDTESESLVQTALEKASKGRTTIVVAHRLSTIRGADLIVTMKDGMVVEKGTHAELMAKQGLYYSLAMAQDIK 627          
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Match: sp|P21448|MDR1_CRIGR (ATP-dependent translocase ABCB1 OS=Cricetulus griseus OX=10029 GN=ABCB1 PE=1 SV=2)

HSP 1 Score: 568.155 bits (1463), Expect = 3.938e-171
Identity = 299/612 (48.86%), Postives = 399/612 (65.20%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +F YA   D + M+   + +I  GV  PL++LVFG+ T   A+    + ++    T+    + +S     +EE +    Y +T                  GI   + I++Y+ V+F+ + +  QI  IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F GG I+ F RGWKLTLV L+ISP++ +   + +K +   T K  +AY KAG +AEEVL +IRT+++F G+K E+ RY  NL+EA ++GI+K+I     +G    L++ SYAL FWYG SL+     + +G +L VFF+ L+    IGQA+P++ +F  AR AA EIF IID  P ID  ++ G K ++ +G + FK + F+YP+R D  IL GL+L +Q GQTVALVG SGCGKS+ +QL+QR YD  EG V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA +I G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   38 MFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLVFGDMTDSFAS----VGNIPTNATNNATQVNASDIFGKLEEEMTTYAYYYT------------------GIGAGVLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELQAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE-YSIGQVLTVFFAVLIGAFSIGQASPNIEAFANARGAAYEIFNIIDNKPSIDSFSKNGYKPDNIKGNLEFKNIHFSYPSRKDVQILKGLNLKVQSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADIIAGFDGGVIVEQGNHEELMREKGIYFKLVMTQ 626          

HSP 2 Score: 558.14 bits (1437), Expect = 1.125e-167
Identity = 274/581 (47.16%), Postives = 401/581 (69.02%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA-NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F++++ LN+ E  Y  +G   AI NGA+QP+FSI+F  ++     N + E +  D   + +    + V++F++  LQ   FG +GE LTKR R + F++ML+QD++WFD P N  GALTTRL+++A Q++G +G  L  +   I ++G  + IS  + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+   +    NV + F A++FGAM +G+  + AP++ K K++A+H+  ++++VP I+S+ST G  L    + G++K   V F+YP RP+I +L  ++  +   QT+ALVG SGCGKST++ LL+RFYD + G + +D  ++  +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + D+I  AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+S+Q+
Sbjct:  694 FWRILKLNSSEWPYFVVGIFCAIVNGALQPAFSIIFSKVVGVFTRNTDDETKRHDSNLFSLLFLILGVISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDNPKNTTGALTTRLANDAGQVKGATGARLAVITQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFENMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVARELMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSASHIIMIIEKVPSIDSYSTGG--LKPNTLEGNVKFNEVVFNYPTRPDIPVLQGLNLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVFLDGKEVNQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIERAAKEANIHQFIESLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQA 1272          

HSP 3 Score: 405.601 bits (1041), Expect = 6.252e-116
Identity = 229/543 (42.17%), Postives = 334/543 (61.51%), Query Frame = 1
Query:  538 RNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLI-REGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            RN         SN+F+L+      F  + +  FI  ++    F    +     +R   F++++RQ++ WFD     +GALT +L +D   V    G ++  + Q  A    GII++ + GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+ RE   F   ++L+VF + +     +GQ +     + +A+ +A+ I  II++VP ID  +  G K N  +G + F  V F YPTR D P+L GL+L ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   +  LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ +EI++A   AN   FI +LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V  Q
Sbjct:  738 RNTDDETKRHDSNLFSLL------FLILGVISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDNPKNTTGALTTRLANDAGQVKGATGARLAVITQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFE-NMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVARELMTF--ENVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSASHIIMIIEKVPSIDSYSTGGLKPNTLEGNVKFNEVVFNYPTRPDIPVLQGLNLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVFLDGKEVNQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIERAAKEANIHQFIESLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQ 1271          

HSP 4 Score: 369.777 bits (948), Expect = 4.748e-104
Identity = 222/590 (37.63%), Postives = 339/590 (57.46%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFL---------LPAMANPNIEQQSA---------DIRTYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++ Y+ +G ++AI +G   P   ++FG +         +P  A  N  Q +A         ++ TY     GI     + + +Q V F    +G Q+ K  R   F A++ Q+I WFD   +++G L TRL+D+ ++I    G+ +G    A+ +      I F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y   +++      KKA       G     I+ +YA  F     L++     +  V   F A++ GA ++G++      F   + AA  +F ++D  P I+SFS +G   D  N+ G+++ +N+ FSYP R ++ IL  ++  + S QT+ALVG SGCGKST + LLQR YD   G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++  Q+
Sbjct:   46 DRLYMLVGTLAAIIHGVALPLMMLVFGDMTDSFASVGNIPTNATNNATQVNASDIFGKLEEEMTTYAYYYTGIGAGVLIVAYIQ-VSFWCLAAGRQIHK-IRQKFFHAIMNQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELQAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFAVLIGAFSIGQASPNIEAFANARGAAYEIFNIIDNKPSIDSFSKNGYKPD--NIKGNLEFKNIHFSYPSRKDVQILKGLNLKVQSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADIIAGFDGGVIVEQGNHEELMREKGIYFKLVMTQT 627          
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Match: sp|P21447|MDR1A_MOUSE (ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1a PE=1 SV=3)

HSP 1 Score: 563.148 bits (1450), Expect = 1.927e-169
Identity = 297/612 (48.53%), Postives = 400/612 (65.36%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +F YA   D + M+   + +I  GV  PL++L+FG+ T   A+    + ++++  T+ +E          +EE +    Y +T                  GI   + I++Y+ V+F+ + +  QI  IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F GG I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY  NL+EA ++GI+K+I     +G    L++ SYAL FWYG SL+     + +G +L VFFS L+    +GQA+P++ +F  AR AA E+F+IID  P ID  ++ G K ++ QG + FK + F+YP+R +  IL GL+L ++ GQTVALVG SGCGKS+ +QLMQR YD  +G V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI++A+  ANA  FI  LP++ DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA VI G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   38 MFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFAS----VGNVSKNSTNMSEA-DKRAMFAKLEEEMTTYAYYYT------------------GIGAGVLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKE-YSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQ 625          

HSP 2 Score: 556.984 bits (1434), Expect = 2.655e-167
Identity = 273/585 (46.67%), Postives = 408/585 (69.74%), Query Frame = 2
Query: 2300 AGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMAN---PNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            A F++++ LN+ E  Y  +G   AI NG +QP+FS++F  ++    N   P  ++Q++++ + +  + GI  ++F++  LQ   FG +GE LTKR R + F++ML+QD++WFD+P N  GALTTRL+++A Q++G +G  L  +   I ++G  + IS  + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+   +    NV + F A++FGAM +G+  + AP++ K  ++A+H+  ++++ P I+S+ST G  L    + G+++   V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G++ +D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+S+Q+
Sbjct:  691 ASFWRILKLNSTEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSLLFLILGI--ISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQG--LKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQA 1271          

HSP 3 Score: 409.068 bits (1050), Expect = 5.052e-117
Identity = 228/532 (42.86%), Postives = 332/532 (62.41%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +SN+F+L+      F  + +  FI  ++    F    +     +R   F++++RQ++ WFD     +GALT +L +D   V    G ++  + Q  A    GII++ + GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+ +       ++L+VF + +     +GQ +     + +A  +A+ I  II++ PEID  + +G K N  +G + F  V F YPTR   P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   IK LNV WLR Q+G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI++LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V  Q
Sbjct:  747 NSNLFSLL------FLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETM-YAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQ-QLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQ 1270          

HSP 4 Score: 365.54 bits (937), Expect = 1.243e-102
Identity = 223/589 (37.86%), Postives = 341/589 (57.89%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMAN-PNIEQQS-----ADIR-----------TYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ++ Y+ +G ++AI +G   P   ++FG +  + A+  N+ + S     AD R           TY     GI     + + +Q V F    +G Q+ K  R   F A++ Q+I WFD   +++G L TRL+D+ ++I    G+ +G    A+ +      I F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y   +++      KKA       G     I+ +YA  F     L++     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+SFS  G   D  N+ G+++ +N+ FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD L+G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP Q++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++  Q+
Sbjct:   46 DRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASVGNVSKNSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAGVLIVAYIQ-VSFWCLAAGRQIHK-IRQKFFHAIMNQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPD--NIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRED--VTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQT 626          
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Match: sp|P06795|MDR1B_MOUSE (ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1b PE=1 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 2.316e-169
Identity = 303/616 (49.19%), Postives = 404/616 (65.58%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            GV  +F YA   D + MI   + +I  G   PL++LVFGN T      +    S+   +T+Q+ P  +ST I               +S+S++   M+  +  + GI   + I++Y+ V+ + + +  QI  IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q    F+ G I+ F+ GWKLTLV L++SPLI +   + +K +   T K  +AY KAG +AEEVL +IRT+++F G++ E+ RY +NL+EA  +GI+K+I     +G+   L++ SYAL FWYG SL+   N + +G++L VFFS L+ T  IG   P++ +F  AR AA EIF+IID  P ID  + +G K +   G + FK V F YP+R++  IL GL+L ++ GQTVALVG SGCGKS+ +QLMQR YD  EG V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI++A+  ANA  FI  LP++ DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA VI G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   34 GVFGMFRYADWLDKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAE---ASILPSITNQSGP--NSTLI---------------ISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLS-NEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQ 628          

HSP 2 Score: 540.421 bits (1391), Expect = 1.676e-161
Identity = 263/577 (45.58%), Postives = 397/577 (68.80%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA-NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMI 4033
            F++++ LN  E  Y+ +G + A+ NG +QP F+I+F  ++   + + + E +  +   + +    + +++FV+   Q   FG +GE LTKR R + F++ML+QDI+WFD+  N+ G+LTTRL+ +A+ ++G  G  L  V   + ++G  V +S  + WQ++L+++  +P+I +GGI++++++ G +  DK  LE SGKIA E IEN RT+ +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+   +    NV + F A++FGAM  G + + AP++ K K++A+H+  ++++ P I+S+ST+G  L    + G++K   V+F+YP RPNI +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G++ +D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD+++  + ++I+ AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+
Sbjct:  695 FWRILNLNLSEWPYLLVGVLCAVINGCIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEG--LKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMV 1269          

HSP 3 Score: 405.601 bits (1041), Expect = 7.728e-116
Identity = 226/525 (43.05%), Postives = 331/525 (63.05%), Query Frame = 1
Query:  610 FAGIALAMFIMSYVSVTF--FVITSQHQI--SAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
            F+   L M ++S+V+  F  F      +I    +R   F++++RQ+I WFD    ++G+LT +L  D ++V   +G ++  + Q  A    G+IL+ V GW+LTL+ + I PLI++  ++  K +     K  +    +G IA E + + RTIVS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+ +       ++++VF + +      G  +     + +A+ +A+ I  II++ PEID  + EG K    +G + F  V+F YPTR + P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI++LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V     R
Sbjct:  753 FSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETM-YAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQ-QLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVQAGAKR 1275          

HSP 4 Score: 376.711 bits (966), Expect = 2.823e-106
Identity = 230/598 (38.46%), Postives = 350/598 (58.53%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFL-----------LPAMAN---PN---------IEQQSADIRTYVIAL-AGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPN---FGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            +K  + LG ++AI +G + P   ++FG +           LP++ N   PN         +E++ A    Y   + AG+ +VA++   L  +    +G Q+ K  R   F A++ Q+I WFD   +++G L TRL+D+ ++I    G+ +G    +I +  A   I F   W+++LV+LA  P+I +   L  +++  F+N +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G+    ++ +YA  F     L+L N   +  V   F +++ G  ++G    +APN   F   + AA  +F+++D  P I+SFST G   D  ++ G+++ +NV F+YP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD L G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP Q++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++  Q+ 
Sbjct:   46 DKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLA---AGRQIHK-IRQKFFHAIMNQEIGWFD--VHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGH---LAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPD--SIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRED--VTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTR 630          
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Match: sp|P21449|MDR2_CRIGR (Multidrug resistance protein 2 OS=Cricetulus griseus OX=10029 GN=PGY2 PE=2 SV=2)

HSP 1 Score: 563.148 bits (1450), Expect = 2.551e-169
Identity = 302/616 (49.03%), Postives = 401/616 (65.10%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G+  +F YA   D + M+   + ++  G + PL++LVFGN T          +S T+  TS    +T+ + I + E I           S ++   M+  +  + GI   + I++Y+ V+F+ + +  QI+ IR  FF A+M Q IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F+   I+ F+ GWKLTLV L++SPLI +   M +K +   T K  +AY KAG +AEEVL +IRT+++F G+  E+ RY +NL+EA  +GI+K++     +G+   L++ SYAL FWYG SL+   N + VG +L VFFS L  T  IG   P++  F  AR AA EIF+IID  P ID  + +G K +   G + FK V F+YP+R+   IL GL+L +Q GQTVALVG SGCGKS+ +QL+QR YD  EG V ID  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  EGRTTI++AHRLSTVRNA VI G   G + EQG H ELM   G+Y  LV  Q
Sbjct:   35 GIFGMFRYADWLDKLYMVLGTLAAVLHGTSLPLLMLVFGNMT----------DSFTKAETSIWPNMTNQSEINNTEVI-----------SGSLEEDMATYAYYYTGIGAGVLIVAYIQVSFWCLAAGRQINKIRQKFFHAIMNQEIGWFDVHDIGELNTRLTDDVSKINDGIGDKIGMFFQSIATFLAAFIVGFISGWKLTLVILAVSPLIGLSSAMWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQNKELERYNKNLEEAKNVGIKKAVTANISIGIAYLLVYASYALAFWYGTSLVLS-NEYSVGQVLTVFFSILFGTFSIGHIAPNIEVFANARGAAYEIFKIIDNEPSIDSFSTQGHKPDSVMGNLEFKNVHFSYPSRSGIKILKGLNLKVQSGQTVALVGKSGCGKSTTVQLLQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHEELMKEKGIYCRLVMMQ 628          

HSP 2 Score: 534.643 bits (1376), Expect = 1.582e-159
Identity = 264/579 (45.60%), Postives = 392/579 (67.70%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMI 4033
            F+ ++ LN  E  Y+ +G + A+ NG +QP FSI+F  ++       +P  +QQ+ ++ +    + G+  + FV+   Q   FG +GE LTKR R + F++ML+QDI+WFD+  N+ GALTTRL+ +A  ++G     L  +   + ++G  + IS  + WQ++L+++   P+I + G+++++++ G +  DK  LE SGKIA E IEN RTV +LTRE  F   Y ++++       KKAH  G  +  TQA ++ +YAA F    YL+ + +    NV + F A++FGA+  G + + AP++ K K++A+H+  +++++P I+S+ST G  L    + G++K   V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD + G + +D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + D+I  AAK +NIH FI +LPD+Y T+VG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+V ++GK+ E GTH +LL++ GIY  M+
Sbjct:  695 FWGILKLNITEWPYLVVGVLCAVINGCMQPVFSIVFSGIIGVFTRDDDPKTKQQNCNLFSLFFLVMGM--ICFVTYFFQGFTFGKAGEILTKRLRYMVFKSMLRQDISWFDDHRNSTGALTTRLASDAANVKGAMSSRLAGITQNVANLGTGIIISLVYGWQLTLLLVVIAPLIILSGMMEMKVLSGQALKDKKELEVSGKIATEAIENFRTVVSLTREQKFENMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAHQIMTFENVMLVFSAVVFGAIAAGNASSFAPDYAKAKVSASHIIRIMEKIPSIDSYSTRG--LKPNWLEGNVKFNEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIERAAKEANIHQFIESLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMV 1269          

HSP 3 Score: 402.519 bits (1033), Expect = 6.665e-115
Identity = 218/492 (44.31%), Postives = 314/492 (63.82%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQ--NSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
            +R   F++++RQ+I WFD    ++GALT +L  D   V   +  ++  + Q  A    GII++ V GW+LTL+ + I+PLII+  +M  K +     K  +    +G IA E + + RT+VS  R +K+E   Y ++L    +  ++K+ + G        +M+ SYA  F +GA L+         ++++VF + +      G A+     + +A+ +A+ I  I++++P ID  +  G K N  +G + F  V F YPTR D P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G V +D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ +EI++A   AN   FI +LP+K +T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I  I++GKV+E GTH +L+A  G+Y  +V     R
Sbjct:  786 LRYMVFKSMLRQDISWFDDHRNSTGALTTRLASDAANVKGAMSSRLAGITQNVANLGTGIIISLVYGWQLTLLLVVIAPLIILSGMMEMKVLSGQALKDKKELEVSGKIATEAIENFRTVVSLTREQKFE-NMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAH-QIMTFENVMLVFSAVVFGAIAAGNASSFAPDYAKAKVSASHIIRIMEKIPSIDSYSTRGLKPNWLEGNVKFNEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQDEIERAAKEANIHQFIESLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVQAGAKR 1275          

HSP 4 Score: 385.571 bits (989), Expect = 3.346e-109
Identity = 231/595 (38.82%), Postives = 347/595 (58.32%), Query Frame = 2
Query: 2336 EKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMAN------PNIEQQSA-------------DIRTYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPN---FGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            +K Y+ LG ++A+ +G   P   ++FG +  +         PN+  QS              D+ TY     GI     + + +Q V F    +G Q+ K  R   F A++ Q+I WFD   ++IG L TRL+D+ ++I    G+ +G    +I +  AA  + F   W+++LV+LA  P+I +   +  +++  F+N +  A  ++G +A E +  IRTV     ++  ++ Y + +++      KKA       G+    ++ +YA  F     L+L N   +  V   F +++FG  ++G    +APN   F   + AA  +F+++D  P I+SFST G   D  ++ G+++ +NV FSYP R  I IL  ++  + S QT+ALVG SGCGKST + LLQR YD   G + ID   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA+EGRT +VIAHRLST++NAD I  F  G I E G H EL+ + GIY +++ +Q+ 
Sbjct:   47 DKLYMVLGTLAAVLHGTSLPLLMLVFGNMTDSFTKAETSIWPNMTNQSEINNTEVISGSLEEDMATYAYYYTGIGAGVLIVAYIQ-VSFWCLAAGRQINK-IRQKFFHAIMNQEIGWFD--VHDIGELNTRLTDDVSKINDGIGDKIGMFFQSIATFLAAFIVGFISGWKLTLVILAVSPLIGLSSAMWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQNKELERYNKNLEEAKNVGIKKAVTANISIGIAYLLVYASYALAFWYGTSLVLSNEYSVGQVLTVFFSILFGTFSIGH---IAPNIEVFANARGAAYEIFKIIDNEPSIDSFSTQGHKPD--SVMGNLEFKNVHFSYPSRSGIKILKGLNLKVQSGQTVALVGKSGCGKSTTVQLLQRLYDPTEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHEELMKEKGIYCRLVMMQTR 630          
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Match: sp|P08183|MDR1_HUMAN (ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3)

HSP 1 Score: 562.377 bits (1448), Expect = 4.292e-169
Identity = 299/615 (48.62%), Postives = 403/615 (65.53%), Query Frame = 1
Query:  304 VGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            V  +F Y+   D + M+   + +I  G   PL++LVFG  T   A       +L   +++    IT+ + I D           F +   N+   M+  +  ++GI   + + +Y+ V+F+ + +  QI  IR  FF A+MRQ IGWFD  + G L  +L DD++ ++ GIGDKIG   Q  A F  G I+ F RGWKLTLV L+ISP++ +   + +K +   T K   AY KAG +AEEVL +IRT+++F G+K E+ RY +NL+EA +IGI+K+I     +G    L++ SYAL FWYG +L+  G  + +G +L VFFS L+    +GQA+P + +F  AR AA EIF+IID  P ID  ++ G K ++ +G + F+ V F+YP+R +  IL GL+L +Q GQTVALVG SGCGKS+ +QLMQR YD  EG V +D  +I+ +NV +LRE IGVVSQEPVLF  +I ENIRYGR +VT +EI++A+  ANA  FI  LP+K DTLVG+RG QLSGGQKQRIAIARALVRNPKILLLDEATSALD+ESE +VQ ALDK  +GRTTI++AHRLSTVRNA VI G  DG + E+G H ELM   G+Y  LV  Q
Sbjct:   36 VFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFAN----AGNLEDLMSN----ITNRSDINDT---------GFFM---NLEEDMTRYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGE-YSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQ 629          

HSP 2 Score: 553.518 bits (1425), Expect = 6.014e-166
Identity = 271/583 (46.48%), Postives = 408/583 (69.98%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA---NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            F+++M LN  E  Y  +G   AI NG +QP+F+I+F  ++       +P  ++Q++++  + +    + +++F++  LQ   FG +GE LTKR R + F +ML+QD++WFD+P N  GALTTRL+++A Q++G  G  L  +   I ++G  + ISF + WQ++L++LA VPII + G+++++++ G +  DK  LE SGKIA E IEN RTV +LT+E  F   Y ++++       +KAH  G  +  TQA ++ +YA  F    YL+ + +    +V + F A++FGAM +G+  + AP++ K KI+AAH+  ++++ P I+S+ST+G++ +   + G++    V F+YP RP+I +L  +S  +   QT+ALVG SGCGKST++ LL+RFYD L G +L+D  +IK +N+Q LR    IVSQEP LF  SI ENIAYGD++++ + ++I+ AAK +NIH FI +LP++Y TKVG+KG+  SGGQKQRIAIARAL+R P ILLLDEATSALDTESEK+VQ+ALDKA+EGRTC+VIAHRLSTIQNAD I+VF++G++ E GTH +LL++ GIY  M+S+Q+
Sbjct:  697 FWRIMKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNL--FSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPN--TLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQA 1275          

HSP 3 Score: 418.313 bits (1074), Expect = 3.795e-120
Identity = 235/540 (43.52%), Postives = 333/540 (61.67%), Query Frame = 1
Query:  568 SSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRR 2175
            +SN+F+L+      F  + +  FI  ++    F    +     +R   FR+++RQ++ WFD     +GALT +L +D   V   IG ++  + Q  A    GII++F+ GW+LTL+ L+I P+I I  ++  K +     K  +    +G IA E + + RT+VS   E+     Y ++L    +  +RK+ + G        +M+ SYA  F +GA L+         D+L+VF + +     +GQ +     + +A+ +AA I  II++ P ID  + EG   N  +G +TF  V F YPTR D P+L GLSL ++ GQT+ALVG+SGCGKS+++QL++RFYD   G+VL+D   IK LNV WLR  +G+VSQEP+LF CSI ENI YG     V+ EEI +A   AN   FI +LPNK  T VGD+GTQLSGGQKQRIAIARALVR P ILLLDEATSALD+ESEK+VQ+ALDK  EGRT I++AHRLST++NA +I   ++G+V+E GTH +L+A  G+Y  +V  Q     TKR+
Sbjct:  751 NSNLFSLL------FLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAYLVAH-KLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAG---TKRQ 1280          

HSP 4 Score: 371.318 bits (952), Expect = 1.535e-104
Identity = 222/595 (37.31%), Postives = 344/595 (57.82%), Query Frame = 2
Query: 2327 NAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--------NIEQQS------------ADIRTYVIALAGIAVVAFVSSVLQNVGFG--NSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            N  +K Y+ +G ++AI +GA  P   ++FG +    AN         NI  +S             D+  Y    +GI     V++ +Q V F    +G Q+ K  R   F A+++Q+I WFD   +++G L TRL+D+ ++I    G+ +G    ++ +      + F   W+++LV+LA  P++ +   +  +I+  F++ +  A  ++G +A E +  IRTV     +   ++ Y + +++      KKA       G     I+ +YA  F     L+L     +  V   F +++ GA ++G++      F   + AA  +F+++D  P I+S+S  G   D  N+ G+++  NV FSYP R  + IL  ++  + S QT+ALVG SGCGKST + L+QR YD   G + +D   I+ IN++ LR++  +VSQEP LF+ +I ENI YG      T D+I  A K +N +DFI+ LP +++T VGE+G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE +VQ ALDKA++GRT +VIAHRLST++NAD I  F DG I E G H EL+ + GIY +++++Q+
Sbjct:   44 NWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSGIGAGVLVAAYIQ-VSFWCLAAGRQIHK-IRKQFFHAIMRQEIGWFD--VHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPD--NIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLFATTIAENIRYGREN--VTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEKGIYFKLVTMQT 630          
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Match: A0A0H3YJ53 (Slc24a-6 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc24a-6 PE=2 SV=1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 357/364 (98.08%), Postives = 360/364 (98.90%), Query Frame = -1
Query: 6410 KKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVHWYEGXXXXXXXXXXXXXXYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKSLIXXXXXXXXXXXXXXXNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITGE 7501
            KKHK+FLKIILCYFSLIFGSIF LKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLE ICEVLH+RHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDE VHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAK LIDSENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITG+
Sbjct:    1 KKHKNFLKIILCYFSLIFGSIFLLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLERICEVLHMRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDEQVHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKILIDSENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITGD 364          
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Match: A8WG28 (Zgc:172149 protein OS=Danio rerio OX=7955 GN=abcb4 PE=2 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 299/620 (48.23%), Postives = 411/620 (66.29%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQ---FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRP 2160
            +LF YA   DI++M+  +IMS+  G   PL+++VFG+ T                     +     T + +++ I      NFT   ++  TL   M+     ++ +   + + +Y+ V F+ + +  Q+  +R  FF ++M+Q IGWFD   +G L  +L DD+  ++ GIGDK+G ++Q    FI GII+ F +GWKLTLV L++SPL+ I   ++ K M   T K   AY KAG +AEEVL SIRT+ +F G+K E+ RY +NL++A  +G+RK+I     +G    +++ SYAL FWYG++LI  G  + +G +L +FF+ L+   G+GQ +P++ +F+ AR AA ++F+IID  P+I+  +EEG KL+  +G I FK + F YP+R D  +L G++L +  GQT+ALVG+SGCGKS+ IQL+QRFYD  EG V ID  +I+ LNV  LRE IGVVSQEPVLF  +I ENIRYGR DVT +EI+QA   ANA  FI  LP+K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTI+VAHRLST+RNA VI G ++G++ E GTH ELM   G+Y  LV+ Q   P
Sbjct:   43 ELFRYADSIDILLMMLGLIMSMANGAVLPLMVIVFGDMT---------------------DSFVDDTLLDNLKNITLPP--NFTFPETSNITLGEKMTTHAIYYSIMGFVVLVAAYMQVAFWTLAAGRQVKKLRKIFFHSIMKQEIGWFDVNETGQLNTRLTDDVYKINEGIGDKLGMLIQNLTTFIVGIIIGFAKGWKLTLVILAVSPLLGISAAVIGKVMTTFTSKEQTAYAKAGAVAEEVLSSIRTVFAFGGQKKEIKRYHKNLEDAKNVGVRKAITVNIAMGFTFFMIYMSYALAFWYGSTLILGGE-YTIGMLLTIFFAVLIGAFGLGQTSPNIQTFSSARGAAHKVFQIIDHEPKINSFSEEGYKLDVVKGNIEFKNINFRYPSRDDVKVLNGMNLKVMSGQTIALVGSSGCGKSTTIQLLQRFYDPQEGSVSIDGHDIRSLNVRGLRELIGVVSQEPVLFATTIAENIRYGRQDVTQDEIEQAAREANAYNFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQAALDKVRLGRTTIVVAHRLSTIRNADVIAGFQNGEIVELGTHDELMERKGIYHSLVNMQVRNP 638          

HSP 2 Score: 391.349 bits (1004), Expect = 1.091e-114
Identity = 227/588 (38.61%), Postives = 347/588 (59.01%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFG-----------------------FLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            + LG + ++ NGAV P   I+FG                       F  P  +N  + ++   + T+ I  + +  V  V++ +Q   +  +  +  K+ R I F +++KQ+I WFD   N  G L TRL+D+  +I    G+ LG +I  + +    + I F   W+++LV+LA  P++ +   +  ++M  F++ ++ A  ++G +A E + +IRTV     +   I+ Y + ++       +KA       G T   I+ +YA  F     L+L     +  +   F A++ GA  LG++      F   + AA  +F+++D  P INSFS +G  LDV  + G+I+ +N+ F YP R ++ +LN ++  + S QTIALVG SGCGKST I LLQRFYD   G++ ID + I+ +N++ LR+L  +VSQEP LF+ +I ENI YG      T D+I  AA+ +N ++FI+ LPD++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ ALDK + GRT +V+AHRLSTI+NAD I  F++G+I E GTH EL+ + GIY  ++++Q
Sbjct:   56 MMLGLIMSMANGAVLPLMVIVFGDMTDSFVDDTLLDNLKNITLPPNFTFPETSNITLGEK---MTTHAIYYSIMGFVVLVAAYMQVAFWTLAAGRQVKKLRKIFFHSIMKQEIGWFD--VNETGQLNTRLTDDVYKINEGIGDKLGMLIQNLTTFIVGIIIGFAKGWKLTLVILAVSPLLGISAAVIGKVMTTFTSKEQTAYAKAGAVAEEVLSSIRTVFAFGGQKKEIKRYHKNLEDAKNVGVRKAITVNIAMGFTFFMIYMSYALAFWYGSTLILGGEYTIGMLLTIFFAVLIGAFGLGQTSPNIQTFSSARGAAHKVFQIIDHEPKINSFSEEGYKLDV--VKGNIEFKNINFRYPSRDDVKVLNGMNLKVMSGQTIALVGSSGCGKSTTIQLLQRFYDPQEGSVSIDGHDIRSLNVRGLRELIGVVSQEPVLFATTIAENIRYGRQD--VTQDEIEQAAREANAYNFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQAALDKVRLGRTTIVVAHRLSTIRNADVIAGFQNGEIVELGTHDELMERKGIYHSLVNMQ 634          
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Match: A0A4W4E7J0 (ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 298/642 (46.42%), Postives = 414/642 (64.49%), Query Frame = 1
Query:  316 FSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERRDLC*C**RNYQRKSYKKTL 2241
            F YA   D+V+M    IM++  G   P +++VFG+ T+       ++N   + +   NE +  S      E + R+  Y         +++M G+          +   +Y+ V F+ + +  Q+  +R  FF A+++Q+IGWFD   +G L  +L DDI  ++ GIGDK+G ++Q    F  G I+ F++GWKLTLV L+ISPL+ I   +++K M   T +   AY KAG +AEEVL +IRT+ +F G++ E+ RY +NL+EA  +GI+K++     +G    +++ +YAL FWYG++LI  G  + +G +L VFF+ ++   GIGQ +P++ +F  AR AA ++F IID  P ID  +++G K +  +G I F+ ++FTYP+R D  +L+G+SL +  GQT+ALVG+SGCGKS+ +QL+QRFYD  EG V ID  +I+ LNV +LRE IGVVSQEPVLF  +I ENIRYGR DVT EEI QA   ANA  FI  LP K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTIIVAHRLST+RNA +I G + G++ E GTH +LM   G+Y  LV  Q  R  ++  E+     C  +   R    KTL
Sbjct:   28 FRYADGGDLVLMFFGTIMAMANGAVLPAMVIVFGDMTNS------FVNE--EIINGWNETVNQSLG----ESMTRHAIY---------YSIMGGI----------VLFAAYMQVAFWTLAAGRQVKRLRKMFFHAIIKQDIGWFDVNETGQLNTRLADDIYKINEGIGDKMGMLIQSITTFFAGFIVGFIKGWKLTLVILAISPLLGISAAIIAKVMTSFTTREQTAYAKAGAVAEEVLSAIRTVFAFGGQRKEIQRYQKNLEEAKNVGIKKAVTVNIAVGFTYFMIYMAYALAFWYGSTLIFAGE-YSIGSLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHEPNIDSFSDQGYKPDVVKGNIEFRNIQFTYPSRQDVKVLSGMSLKVSCGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVCIDGHDIRTLNVRYLRELIGVVSQEPVLFATTIAENIRYGREDVTQEEIQQAAREANAYDFIMKLPQKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADIIAGFQHGRIVELGTHDQLMQKKGVYHSLVTMQVRRSVSQYTEK-----CWKKQLHRPGASKTL 632          

HSP 2 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 263/581 (45.27%), Postives = 395/581 (67.99%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA--NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F  V+GLN  E  Y+ +G   A  NG +QP+F+I+F  ++   A  + +I+++ A++ + + A+ G  V++F++  LQ   FG +GE LT R R   F+AM++QD+ W+D+P N++GALTTRL+++  Q++G +G  +  +   + ++G ++ ISF + WQ++L+VL+ VPI+ V G +Q++++ G +  DK  LE +GK+A E IENIRTV +LTRE  F   +++ +        KKAH  GF +  +QA I+ AYA  F    +L    M     VF+   A+++GAM +G++ +  PN+ K K++A+H+  L+++V  IN+ S +G     E+ SG++++++V FSYP RP + +L  +S  +   QT+ALVG SGCGKSTII LL+RFYD      ++D +  K +NI  LR    IVSQEP LF  S+ ENIAYGD+++    +++  AA+A+NIH FI  LP +Y+T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEK+VQ+ALDKA+EGRTC+V+AHRLSTIQNAD I V K+G + E GTH +LLS+ G Y  +++ Q
Sbjct:  660 FLTVLGLNKKEWPYMVVGVFCATINGGLQPAFAIIFSKIIAVFAEMDEDIKRERANLFSLLFAVIG--VISFIALFLQGFCFGKAGEILTMRLRYRAFKAMMRQDLGWYDDPKNSVGALTTRLANDTAQVQGATGLRMATLAQNVANLGTSIIISFVYGWQLTLLVLSIVPIMAVAGAIQMKMLAGHALKDKKELELAGKVATEAIENIRTVVSLTRESKFESLFQQNLIVPYKNAQKKAHIFGFTFSFSQAMIYFAYAGCFKFGSWLYEKEMITFEGVFLVISAIMYGAMAVGEANSFTPNYAKAKMSASHVLMLINKVSAINNDSDEGE--QPEHFSGNVRLQDVHFSYPSRPAVPVLQGLSLRVKKGQTLALVGSSGCGKSTIIQLLERFYDP-RQGAMLDIHDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVAPEEVEQAARAANIHSFIEGLPQKYQTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKVVQEALDKAREGRTCIVVAHRLSTIQNADVIAVLKNGVLVEQGTHQQLLSQQGAYYALVNSQ 1235          

HSP 3 Score: 392.504 bits (1007), Expect = 2.842e-109
Identity = 226/548 (41.24%), Postives = 339/548 (61.86%), Query Frame = 1
Query:  520 DMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +M+E ++ ++       +N+F+L+      FA I +  FI  ++    F    +     +R   F+A+MRQ++GW+D  +NS GALT +L +D   V    G ++  + Q  A     II++FV GW+LTL+ LSI P++ +   +  K +     K  +    AG +A E + +IRT+VS  R  K+E + + +NL    K   +K+ + G        +++ +YA  F +G S + E        + +V  + +     +G+A     ++ +A+ +A+ +  +I++V  I+  ++EG++   F G +  + V F+YP+R   P+L GLSL ++ GQT+ALVG+SGCGKS++IQL++RFYD  +G +L D  + K LN+ WLR QIG+VSQEPVLF CS+ ENI YG     V  EE++QA   AN  +FI  LP K  T  GD+GTQLSGGQKQRIAIARA++RNPK+LLLDEATSALD+ESEK+VQ+ALDK  EGRT I+VAHRLST++NA VI  +K+G + EQGTH +L++  G Y  LV+ Q
Sbjct:  704 EMDEDIKRER-------ANLFSLL------FAVIGVISFIALFLQGFCFGKAGEILTMRLRYRAFKAMMRQDLGWYDDPKNSVGALTTRLANDTAQVQGATGLRMATLAQNVANLGTSIIISFVYGWQLTLLVLSIVPIMAVAGAIQMKMLAGHALKDKKELELAGKVATEAIENIRTVVSLTRESKFE-SLFQQNLIVPYKNAQKKAHIFGFTFSFSQAMIYFAYAGCFKFG-SWLYEKEMITFEGVFLVISAIMYGAMAVGEANSFTPNYAKAKMSASHVLMLINKVSAINNDSDEGEQPEHFSGNVRLQDVHFSYPSRPAVPVLQGLSLRVKKGQTLALVGSSGCGKSTIIQLLERFYDPRQGAML-DIHDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVAPEEVEQAARAANIHSFIEGLPQKYQTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKVVQEALDKAREGRTCIVVAHRLSTIQNADVIAVLKNGVLVEQGTHQQLLSQQGAYYALVNSQ 1235          

HSP 4 Score: 390.963 bits (1003), Expect = 8.346e-109
Identity = 223/581 (38.38%), Postives = 344/581 (59.21%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNI---------EQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK*IVQ 4063
            +F G + A+ NGAV P+  I+FG +  +  N  I         +     +  + I  + +  +   ++ +Q   +  +  +  KR R + F A++KQDI WFD   N  G L TRL+D+  +I    G+ +G +I +I +  A   + F   W+++LV+LA  P++ +   +  ++M  F+  ++ A  ++G +A E +  IRTV     +   IQ Y++ +++      KKA       G T   I+ AYA  F     L+      + ++   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS  G   DV  + G+I+  N++F+YP R ++ +L+ +S  ++  QTIALVG SGCGKST + LLQRFYD   G + ID + I+ +N++ LR+L  +VSQEP LF+ +I ENI YG      T ++I  AA+ +N +DFI+ LP ++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F+ G+I E GTH +L+ K G+Y  ++++Q  + + Q
Sbjct:   39 MFFGTIMAMANGAVLPAMVIVFGDMTNSFVNEEIINGWNETVNQSLGESMTRHAIYYSIMGGIVLFAAYMQVAFWTLAAGRQVKRLRKMFFHAIIKQDIGWFD--VNETGQLNTRLADDIYKINEGIGDKMGMLIQSITTFFAGFIVGFIKGWKLTLVILAISPLLGISAAIIAKVMTSFTTREQTAYAKAGAVAEEVLSAIRTVFAFGGQRKEIQRYQKNLEEAKNVGIKKAVTVNIAVGFTYFMIYMAYALAFWYGSTLIFAGEYSIGSLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHEPNIDSFSDQGYKPDV--VKGNIEFRNIQFTYPSRQDVKVLSGMSLKVSCGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVCIDGHDIRTLNVRYLRELIGVVSQEPVLFATTIAENIRYGRED--VTQEEIQQAAREANAYDFIMKLPQKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADIIAGFQHGRIVELGTHDQLMQKKGVYHSLVTMQVRRSVSQ 613          
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Match: A0A4W4E811 (ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 302/663 (45.55%), Postives = 420/663 (63.35%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNE--PITSSTS---------IPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAM-----FIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERRDLC*C**RNYQRKSYKKTLCSQ 2250
            ++F YA   D+V+M    IM++  G   P +++VFG+ T+       ++N   + +   NE  P+  S S         + ++E  +R   Y++  + S    L  G       I  ++        +Y+ V F+ + +  Q+  +R  FF A+++Q+IGWFD   +G L  +L DDI  ++ GIGDK+G ++Q    F  G I+ F++GWKLTLV L+ISPL+ I  +M S T      +   AY KAG +AEEVL +IRT+ +F G++ E+ RY +NL+EA  +GI+K++     +G    +++ +YAL FWYG++LI  G  + +G +L VFF+ ++   GIGQ +P++ +F  AR AA ++F IID  P ID  +++G K +  +G I F+ ++FTYP+R D  +L+G+SL +  GQT+ALVG+SGCGKS+ +QL+QRFYD  EG V ID  +I+ LNV +LRE IGVVSQEPVLF  +I ENIRYGR DVT EEI QA   ANA  FI  LP K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTIIVAHRLST+RNA +I G + G++ E GTH +LM   G+Y  LV  Q  R  ++              Y  K +KK +CS 
Sbjct:   27 EIFRYADGGDLVLMFFGTIMAMANGAVLPAMVIVFGDMTNS------FVNE--EIINGWNESVPLPPSESYIFPGQGLSVLELECYIR---YDWCYAPS----LHLGPPPHRHAIYYSIMGGIVLFAAYMQVAFWTLAAGRQVKRLRKMFFHAIIKQDIGWFDVNETGQLNTRLADDIYKINEGIGDKMGMLIQSITTFFAGFIVGFIKGWKLTLVILAISPLLGISAVMTSFTT-----REQTAYAKAGAVAEEVLSAIRTVFAFGGQRKEIQRYQKNLEEAKNVGIKKAVTVNIAVGFTYFMIYMAYALAFWYGSTLIFAGE-YSIGSLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHEPNIDSFSDQGYKPDVVKGNIEFRNIQFTYPSRQDVKVLSGMSLKVSCGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVCIDGHDIRTLNVRYLRELIGVVSQEPVLFATTIAENIRYGREDVTQEEIQQAAREANAYDFIMKLPQKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADIIAGFQHGRIVELGTHDQLMQKKGVYHSLVTMQVRRSVSQ--------------YTEKCWKKHVCSH 654          

HSP 2 Score: 492.656 bits (1267), Expect = 0.000e+0
Identity = 254/579 (43.87%), Postives = 384/579 (66.32%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F  V+GLN  E  Y+ +G   A  NG +QP+F+I+F  ++     P+I+++ A++ + + A+  I V++F++  LQ   FG +GE LT R R   F+AM++QD+ W+D+P N++GALTTRL+++  Q++G +G  +  +   + ++G ++ ISF + WQ++L+VL+ VPI+ V G +Q++++ G +  DK  LE +GK+                 +T   H++  +    G   KKAH  GF +  +QA I+ AYA  F    +L    M     VF+   A+++GAM +G++ +  PN+ K K++A+H+  L+++V  IN+ S +G     E+ SG++++++V FSYP RP + +L  +S  +   QT+ALVG SGCGKSTII LL+RFYD   G +++D +  K +NI  LR    IVSQEP LF  S+ ENIAYGD+++    +++  AA+A+NIH FI  LP QY+T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEK+VQ+ALDKA+EGRTC+V+AHRLSTIQNAD I V K+G + E GTH +LLS+ G Y  +++ Q
Sbjct:  677 FLTVLGLNKKEWPYMVVGVFCATINGGLQPAFAIIFSKIIAV--GPDIKRERANLFSLLFAV--IGVISFIALFLQGFCFGKAGEILTMRLRYRAFKAMMRQDLGWYDDPKNSVGALTTRLANDTAQVQGATGLRMATLAQNVANLGTSIIISFVYGWQLTLLVLSIVPIMAVAGAIQMKMLAGHALKDKKELELAGKVP---------------RYT---HHRHTMAY--GNAQKKAHIFGFTFSFSQAMIYFAYAGCFKFGSWLYEKEMITFEGVFLVISAIMYGAMAVGEANSFTPNYAKAKMSASHVLMLINKVSAINNDSDEGE--QPEHFSGNVRLQDVHFSYPSRPAVPVLQGLSLRVKKGQTLALVGSSGCGKSTIIQLLERFYDPRQGAVMLDIHDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVAPEEVEQAARAANIHSFIEGLP-QYQTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKVVQEALDKAREGRTCIVVAHRLSTIQNADVIAVLKNGVLVEQGTHQQLLSQQGAYYALVNSQ 1228          

HSP 3 Score: 375.17 bits (962), Expect = 1.373e-103
Identity = 231/614 (37.62%), Postives = 349/614 (56.84%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNI---EQQSADI---RTYVIALAGIAVV-------------------------AFVSSVL---------QNVGFGN--SGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK*IVQ 4063
            +F G + A+ NGAV P+  I+FG +  +  N  I     +S  +    +Y+    G++V+                         A   S++           V F    +G Q+ KR R + F A++KQDI WFD   N  G L TRL+D+  +I    G+ +G +I +I +  A   + F   W+++LV+LA  P++ +  +     M  F+  ++ A  ++G +A E +  IRTV     +   IQ Y++ +++      KKA       G T   I+ AYA  F     L+      + ++   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS  G   DV  + G+I+  N++F+YP R ++ +L+ +S  ++  QTIALVG SGCGKST + LLQRFYD   G + ID + I+ +N++ LR+L  +VSQEP LF+ +I ENI YG      T ++I  AA+ +N +DFI+ LP ++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F+ G+I E GTH +L+ K G+Y  ++++Q  + + Q
Sbjct:   40 MFFGTIMAMANGAVLPAMVIVFGDMTNSFVNEEIINGWNESVPLPPSESYIFPGQGLSVLELECYIRYDWCYAPSLHLGPPPHRHAIYYSIMGGIVLFAAYMQVAFWTLAAGRQV-KRLRKMFFHAIIKQDIGWFD--VNETGQLNTRLADDIYKINEGIGDKMGMLIQSITTFFAGFIVGFIKGWKLTLVILAISPLLGISAV-----MTSFTTREQTAYAKAGAVAEEVLSAIRTVFAFGGQRKEIQRYQKNLEEAKNVGIKKAVTVNIAVGFTYFMIYMAYALAFWYGSTLIFAGEYSIGSLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHEPNIDSFSDQGYKPDV--VKGNIEFRNIQFTYPSRQDVKVLSGMSLKVSCGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVCIDGHDIRTLNVRYLRELIGVVSQEPVLFATTIAENIRYGRED--VTQEEIQQAAREANAYDFIMKLPQKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADIIAGFQHGRIVELGTHDQLMQKKGVYHSLVTMQVRRSVSQ 641          

HSP 4 Score: 369.392 bits (947), Expect = 1.161e-101
Identity = 215/530 (40.57%), Postives = 318/530 (60.00%), Query Frame = 1
Query:  571 SNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +N+F+L+      FA I +  FI  ++    F    +     +R   F+A+MRQ++GW+D  +NS GALT +L +D   V    G ++  + Q  A     II++FV GW+LTL+ LSI P++ +   +  K +     K  +    AG +                 +Y   R+T     A K    K+ + G        +++ +YA  F +G S + E        + +V  + +     +G+A     ++ +A+ +A+ +  +I++V  I+  ++EG++   F G +  + V F+YP+R   P+L GLSL ++ GQT+ALVG+SGCGKS++IQL++RFYD  +G V++D  + K LN+ WLR QIG+VSQEPVLF CS+ ENI YG     V  EE++QA   AN  +FI  LP +  T  GD+GTQLSGGQKQRIAIARA++RNPK+LLLDEATSALD+ESEK+VQ+ALDK  EGRT I+VAHRLST++NA VI  +K+G + EQGTH +L++  G Y  LV+ Q
Sbjct:  727 ANLFSLL------FAVIGVISFIALFLQGFCFGKAGEILTMRLRYRAFKAMMRQDLGWYDDPKNSVGALTTRLANDTAQVQGATGLRMATLAQNVANLGTSIIISFVYGWQLTLLVLSIVPIMAVAGAIQMKMLAGHALKDKKELELAGKV----------------PRYTHHRHTMAYGNAQK----KAHIFGFTFSFSQAMIYFAYAGCFKFG-SWLYEKEMITFEGVFLVISAIMYGAMAVGEANSFTPNYAKAKMSASHVLMLINKVSAINNDSDEGEQPEHFSGNVRLQDVHFSYPSRPAVPVLQGLSLRVKKGQTLALVGSSGCGKSTIIQLLERFYDPRQGAVMLDIHDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVAPEEVEQAARAANIHSFIEGLP-QYQTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKVVQEALDKAREGRTCIVVAHRLSTIQNADVIAVLKNGVLVEQGTHQQLLSQQGAYYALVNSQ 1228          
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Match: E9G5N8 (ABC transporter, subfamily ABCB/MDR OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_347264 PE=4 SV=1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 300/637 (47.10%), Postives = 420/637 (65.93%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQM---ATYQYYMNSLTQFLTSQNE-----PITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIR---EGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERRDL 2190
            LF YA+ +D V++    + ++G GV +PL++++FG+ T+        Q  +N +   ++S        P+  + +I D  E   + +          F +   +      I   +F++ ++ VT    T+++Q+  IR+ F +AV+RQ++GW+D ++S    +++ +D+N +  G+G+KIG  +    CFI  II AF+ GW+LTLV L  +P++ + M +L+K    LT+   +AY KAGGIAEEV  SIRT+++F G++ E+ R+ ++L  A K GI++ + TG   GLV G+++ SYAL FWYG +LI    +GN +   D+LIVFFS L+    IGQA P+M +F+ AR AAA IF IIDRVP ID  + EG   +   GKI+F+ V F YP+R D  IL G+S  + PGQTVALVG SGCGKS+ IQL+QRFYD  EG V ID   +++LN+ WLR+Q+G+V QEPVLFG SI ENI YGR  V+ EE+++A   ANA  FI  LP K DTLVG+RG QLSGGQKQRIAIARALVR PKILLLDEATSALD++SE +VQ ALDK  +GRTTIIVAHRL+T+RNA  I  +KDG VQE GTH +LMALNG+Y  LV  Q+      ++E+ ++
Sbjct:   71 LFRYASSTDFVLLCFGTLGAVGTGVCFPLMLILFGDITNAFVGGGMDQETINEINCNISSDPNYTYPFPLGPTCNISDPSEFANSPQGQAVQDEFTKFGIYVAI------IGAVLFLLGFIFVTALNFTAENQVYRIRSKFLQAVLRQDVGWYDTKSSNDFASRITEDLNKIQDGVGEKIGMFIFSMTCFIASIINAFIHGWELTLVMLVSTPVLAVSMGVLAKVQASLTENELKAYAKAGGIAEEVFSSIRTVMAFGGQRKEIDRFQDDLAYAKKAGIKRGMATGIGAGLVWGIIYASYALAFWYGITLILAACDGNSYSSSDLLIVFFSVLIGAMQIGQAAPYMEAFSVARGAAATIFAIIDRVPPIDSSSNEGLVPDGVDGKISFRDVFFNYPSRPDVKILQGISFDVTPGQTVALVGTSGCGKSTCIQLLQRFYDPLEGSVTIDGNELRNLNLGWLRDQMGMVGQEPVLFGTSIGENICYGRDGVSKEEMERAAKEANAHDFIQRLPRKYDTLVGERGGQLSGGQKQRIAIARALVRQPKILLLDEATSALDTQSEAVVQKALDKARQGRTTIIVAHRLTTIRNADRIIVMKDGIVQEDGTHDKLMALNGIYYQLVIAQQGGESDSKKEKEEM 701          

HSP 2 Score: 490.73 bits (1262), Expect = 0.000e+0
Identity = 258/583 (44.25%), Postives = 376/583 (64.49%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILF----GFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
               +M +N  E  +I +G + +   G   P F+ILF    G L P  +     ++ A    Y +    + +V   S+  Q+  F  +GE LT R R +TF+A+LKQ+I WFD  +N++GAL  RLS +A  ++G +G  +G +  A+ +M A+  ++  F W++ LV L FVP++ V    Q +I+ G S  ++ AL++S K+A+E I NIRTV++L +E  F   Y E+++    E  KK+  +GF++G   +    AYA T    G+L++      T+VF    +L+FG   +G+++A APN+ K K+AA  +F LL RVP I++ S +G+VL  EN+ G++  E V+F YP R +  +L  +S  + + QT+ALVG SGCGKST I LL+RFYD  +G + +D   I  +NI +LR    IVSQEP LF+ +I +NIAYGD++++   D+II AA+ +NIH FI +LP+ YET VGE+G+  SGGQKQR+AIARAL+RNP+ILLLDEATSALD+ESE +VQ ALD A+EGRTC+ IAHRLSTIQNAD I+V   G I+E GTH EL+   G+Y ++ S+Q
Sbjct:  742 LMDIMRMNRKEWHFIVVGVIGSAIVGLSTPVFAILFSEVLGVLTPGGSAEEQAEKRAQGNFYALMFLILGIVVGFSAFAQSFSFSIAGESLTSRLRGLTFQAILKQEIGWFDRKTNSVGALCARLSGDAASVQGATGSRIGVLFQAVTTMIASTVLALYFQWKLGLVALCFVPLLLVSTYFQAKIIMGQSALEREALQKSAKVAMEAISNIRTVASLGKERQFHTIYMESLRGPHKEALKKSWIRGFIFGFASSIPMFAYAVTMYYGGWLVVNECLDFTSVFKVSESLLFGTQMIGQAVAFAPNYNKAKVAANRIFALLRRVPQIDASSNNGLVL--ENVDGNVNFEQVRFRYPTRKDAEVLQGLSLAVRAGQTVALVGHSGCGKSTCIQLLERFYDPDSGQVQLDGQDINPVNISSLRSQMGIVSQEPILFNLTIAQNIAYGDNSRVVPMDEIIEAARKANIHVFIQSLPNGYETMVGERGTQLSGGQKQRVAIARALIRNPKILLLDEATSALDSESEHVVQMALDAAREGRTCITIAHRLSTIQNADNIIVINHGTISEQGTHEELIKLGGLYFELCSVQ 1322          

HSP 3 Score: 388.267 bits (996), Expect = 3.135e-107
Identity = 223/500 (44.60%), Postives = 304/500 (60.80%), Query Frame = 1
Query:  664 FVITSQHQISAIRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLI-REGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F I  +   S +R   F+A+++Q IGWFD + +  GAL  +L  D  +V    G +IG + Q     I   +LA    WKL LV L   PL+++     +K +M  +    EA  K+  +A E + +IRT+ S   E+     Y E+L    K  ++KS + G + G    +   +YA+  +YG  L+  E   F    +  V  S L  T  IGQA     ++N+A+ AA  IF ++ RVP+ID  +  G  L +  G + F+ V+F YPTR D  +L GLSL+++ GQTVALVG SGCGKS+ IQL++RFYD + G+V +D  +I  +N+  LR Q+G+VSQEP+LF  +I +NI YG     V  +EI +A   AN   FI +LPN  +T+VG+RGTQLSGGQKQR+AIARAL+RNPKILLLDEATSALDSESE +VQ ALD   EGRT I +AHRLST++NA  I  I  G + EQGTH EL+ L GLY +L   Q
Sbjct:  825 FSIAGESLTSRLRGLTFQAILKQEIGWFDRKTNSVGALCARLSGDAASVQGATGSRIGVLFQAVTTMIASTVLALYFQWKLGLVALCFVPLLLVSTYFQAKIIMGQSALEREALQKSAKVAMEAISNIRTVASLGKERQFHTIYMESLRGPHKEALKKSWIRGFIFGFASSIPMFAYAVTMYYGGWLVVNECLDFT--SVFKVSESLLFGTQMIGQAVAFAPNYNKAKVAANRIFALLRRVPQIDASSNNGLVLENVDGNVNFEQVRFRYPTRKDAEVLQGLSLAVRAGQTVALVGHSGCGKSTCIQLLERFYDPDSGQVQLDGQDINPVNISSLRSQMGIVSQEPILFNLTIAQNIAYGDNSRVVPMDEIIEAARKANIHVFIQSLPNGYETMVGERGTQLSGGQKQRVAIARALIRNPKILLLDEATSALDSESEHVVQMALDAAREGRTCITIAHRLSTIQNADNIIVINHGTISEQGTHEELIKLGGLYFELCSVQ 1322          

HSP 4 Score: 365.155 bits (936), Expect = 1.152e-99
Identity = 212/522 (40.61%), Postives = 320/522 (61.30%), Query Frame = 2
Query: 2507 VAFVSSVLQNVGF------GNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLY----NMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            VA + +VL  +GF        + E    R RS   +A+L+QD+ W+D  S+N     +R++++  +I+   GE +G  I ++    A++  +F   W+++LV+L   P++ V   +  ++    + ++  A  ++G IA E   +IRTV     +   I  +++ +        K+  A G   GL    I+ +YA  F     L+L     N    +++ I F +++ GAM +G++      F   + AAA +F ++DRVPPI+S S +G+V D   + G I   +V F+YP RP++ IL  +SF++   QT+ALVG SGCGKST I LLQRFYD L G++ ID N+++++N+  LR    +V QEP LF  SI ENI YG      + +++  AAK +N HDFI  LP +Y+T VGE+G   SGGQKQRIAIARAL+R P+ILLLDEATSALDT+SE +VQ ALDKA++GRT +++AHRL+TI+NAD+I+V KDG + E GTH +L++ NGIY Q++  Q
Sbjct:  172 VAIIGAVLFLLGFIFVTALNFTAENQVYRIRSKFLQAVLRQDVGWYDTKSSN--DFASRITEDLNKIQDGVGEKIGMFIFSMTCFIASIINAFIHGWELTLVMLVSTPVLAVSMGVLAKVQASLTENELKAYAKAGGIAEEVFSSIRTVMAFGGQRKEIDRFQDDLAYAKKAGIKRGMATGIGAGLVWGIIYASYALAFWYGITLILAACDGNSYSSSDLLIVFFSVLIGAMQIGQAAPYMEAFSVARGAAATIFAIIDRVPPIDSSSNEGLVPD--GVDGKISFRDVFFNYPSRPDVKILQGISFDVTPGQTVALVGTSGCGKSTCIQLLQRFYDPLEGSVTIDGNELRNLNLGWLRDQMGMVGQEPVLFGTSIGENICYGRDG--VSKEEMERAAKEANAHDFIQRLPRKYDTLVGERGGQLSGGQKQRIAIARALVRQPKILLLDEATSALDTQSEAVVQKALDKARQGRTTIIVAHRLTTIRNADRIIVMKDGIVQEDGTHDKLMALNGIYYQLVIAQ 687          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 547.74 bits (1410), Expect = 4.145e-165
Identity = 290/619 (46.85%), Postives = 402/619 (64.94%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQ--MATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL-IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +LF YATC +++MM+  +  +   G+T P++ +VFG  T    ++  Q  +  L  F T+ +   +   +IP ++                I   MS  +  F  +  A+ ++    VT F++T+  Q   IR  +F AV+ Q + WFD    G L  +L DDINT++ G+GDKI   +Q++  F+ G I+ F+ GWKLTLV +S+SPL+     + SK +  LT K   AY KAG +AEE+L +IRT+V+F G++    +Y +NL  A   G++K++ T   +GL    +FG+YAL FWYG  L + +   + +G ++IVFFS ++    +GQ  P++ S  +AR AA  I+  ID    ID  +EEG K +  +G I F+ V F+YP+R D  IL G+SL +  G+T+ALVGASGCGKS+ IQL+QRFYD   GEV +D  +I+ LNV WLRE +G+VSQEPVLFG +I ENIRYGR D TD++ID+A+  ANA  FI+ LP+ L+T+VG+RG QLSGGQKQRIAIARALV+NPKILLLDEATSALD++SE IVQ ALDK   GRTTI++AHRLST+R A VI G KDG+V EQGTH ELM+  G+Y  LV +Q
Sbjct:    5 GFFQLFRYATCLEVLMMVLGLGCAALHGITLPIMCVVFGQMTDSFVLSGQQLNLTGLGNFSTNLS---SGCVAIPGID----------------IEASMSQHAYYFVALGAAVLLLGTFQVTLFLLTATRQTKRIREKYFHAVLHQPMAWFDTHPIGELNTRLTDDINTINDGLGDKICIFVQFFCTFLAGFIIGFIYGWKLTLVIMSVSPLLAASAAVWSKILATLTSKELSAYAKAGAVAEEILVAIRTVVAFNGQQKAAEKYEKNLITAKDFGVKKAVTTNVSMGLTQFFIFGAYALAFWYGTKLTVDDPVNYSIGKVIIVFFSVMIGAFSLGQGAPNLESVAKARGAAYSIYNTIDMPRPIDSSSEEGYKPDSVRGDIEFRNVHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPEAGEVTLDGRDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSEAIVQAALDKARAGRTTIVIAHRLSTIRTADVIAGFKDGEVVEQGTHGELMSKKGVYHSLVMQQ 604          

HSP 2 Score: 493.426 bits (1269), Expect = 2.152e-146
Identity = 248/583 (42.54%), Postives = 380/583 (65.18%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVE-NMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ-SH 4048
            F +++ LN  E  Y+ +G +++   G V P+ +ILF  ++   + P+ E +      + +    +  VAF++   Q   FG SGE LT R RS  F+A+L+QDI+WFD+ +N +G LTT+L+ +A+ ++G +G  LG     IC++  A+ ++F   WQ++L++LA  PI+     +Q+R M G ++ D+ ALE SG+I+ E +EN +TV +LT+E  F + + +++ K       KA   G  + L QA  +   AA F    +L+ +  ++  NVF+ F  ++F AM++G+S + AP+F K K AA  +  LL++ P I+ +S  G   D   N  GDI+  +V F YP RPNI IL  ++ ++   QT+ALVG SGCGKST I LL+RFY+   G +  D    + +N+  LR    +VSQEP LF  +I ENI YGD++++ + ++++ AA ++NIH+FI +LP++Y T+VG+KG+  SGGQKQRIAIARAL+R P++LLLDEATSALDTESEKIVQ ALD+A++GRTC+VIAHRL+T+QNAD I V ++G++ E G H EL++K+G Y  +++ Q SH
Sbjct:  689 FSRILALNKSEWPYLLVGTLASFVGGGVYPAVAILFAKIIGVFSEPDPEVKRQKALMFSLLFLLVGAVAFLTFFFQGYMFGKSGEILTMRLRSQAFKAILRQDISWFDDHNNAVGVLTTKLATDASLVKGAAGSRLGLATNTICALVIAMIVAFFHSWQLTLMILACTPILTGANFIQMRAMAGHTSKDQSALEMSGRISTETVENFKTVVSLTKEDVFFRKFNDSLNKPYRSALCKAPIYGITFALAQAIPYFVNAAVFRFGSWLIAHCHTQFENVFLVFSVIVFAAMSIGQSSSFAPDFAKAKAAAGRILALLEKTPEIDIYSEAG---DKPINFKGDIEFRDVHFFYPTRPNIKILQGLNVSVTQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRGLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVVEAAISANIHNFISDLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKVLLLDEATSALDTESEKIVQKALDEARKGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKHGAYYALVNAQVSH 1268          

HSP 3 Score: 390.963 bits (1003), Expect = 5.390e-112
Identity = 226/550 (41.09%), Postives = 334/550 (60.73%), Query Frame = 1
Query:  511 SIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            S PD  E+ R K   F+L    +F L+  ++       L  F   Y+    F  + +     +R+  F+A++RQ+I WFD  N+  G LT KL  D + V    G ++G         +  +I+AF   W+LTL+ L+ +P++     +  + M   T K   A   +G I+ E + + +T+VS   E     ++ ++L++  +  + K+ + G    L   + +   A  F +G+ LI   +     ++ +VF   + A   IGQ++     F +A++AA  I  ++++ PEID  +E GDK  +F+G I F+ V F YPTR +  IL GL++S+  GQT+ALVG SGCGKS+ IQL++RFY+   G+V  D  + + LN+ WLR Q+G+VSQEP+LF C+I ENI+YG     V+ EE+ +A + AN   FI+ LP K +T VGD+GTQLSGGQKQRIAIARALVR PK+LLLDEATSALD+ESEKIVQ ALD+  +GRT I++AHRL+TV+NA +I  I++G+V EQG H+ELMA +G Y  LV+ Q
Sbjct:  732 SEPD-PEVKRQKALMFSL----LFLLVGAVA------FLTFFFQGYM----FGKSGEILTMRLRSQAFKAILRQDISWFDDHNNAVGVLTTKLATDASLVKGAAGSRLGLATNTICALVIAMIVAFFHSWQLTLMILACTPILTGANFIQMRAMAGHTSKDQSALEMSGRISTETVENFKTVVSLTKEDVFFRKFNDSLNKPYRSALCKAPIYGITFALAQAIPYFVNAAVFRFGSWLIAHCHTQF-ENVFLVFSVIVFAAMSIGQSSSFAPDFAKAKAAAGRILALLEKTPEIDIYSEAGDKPINFKGDIEFRDVHFFYPTRPNIKILQGLNVSVTQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRGLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVVEAAISANIHNFISDLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKVLLLDEATSALDTESEKIVQKALDEARKGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKHGAYYALVNAQ 1265          

HSP 4 Score: 353.214 bits (905), Expect = 1.335e-99
Identity = 221/544 (40.62%), Postives = 313/544 (57.54%), Query Frame = 2
Query: 2429 AMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            A+   +IE   +    Y +AL G AV+       Q   F  +  + TKR R   F A+L Q +AWFD  ++ IG L TRL+D+   I    G+ +   +   C+  A   I F + W+++LV+++  P++     +  +I+   ++ +  A  ++G +A E +  IRTV     +    + Y++ +        KKA       GLTQ  IF AYA  F     L +     Y++ K+  VF S   ++ GA +LG+      +  K + AA  ++  +D   PI+S S +G   D  ++ GDI+  NV FSYP R ++ IL  +S  +   +TIALVG SGCGKST I LLQRFYD   G + +D   I+ +N++ LR+   IVSQEP LF  +I ENI YG      TD  I  A + +N ++FI  LPD   T VGE+G+  SGGQKQRIAIARAL++NP+ILLLDEATSALDT+SE IVQ ALDKA+ GRT +VIAHRLSTI+ AD I  FKDG++ E GTH EL+SK G+Y  ++  Q+
Sbjct:   74 AIPGIDIEASMSQHAYYFVAL-GAAVLLL--GTFQVTLFLLTATRQTKRIREKYFHAVLHQPMAWFD--THPIGELNTRLTDDINTINDGLGDKICIFVQFFCTFLAGFIIGFIYGWKLTLVIMSVSPLLAASAAVWSKILATLTSKELSAYAKAGAVAEEILVAIRTVVAFNGQQKAAEKYEKNLITAKDFGVKKAVTTNVSMGLTQFFIFGAYALAFWYGTKLTVDDPVNYSIGKVIIVFFS---VMIGAFSLGQGAPNLESVAKARGAAYSIYNTIDMPRPIDSSSEEGYKPD--SVRGDIEFRNVHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPEAGEVTLDGRDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDA--TDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSEAIVQAALDKARAGRTTIVIAHRLSTIRTADVIAGFKDGEVVEQGTHGELMSKKGVYHSLVMQQT 605          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Match: abcb4 (multidrug resistance protein 1 [Source:NCBI gene;Acc:103043081])

HSP 1 Score: 531.946 bits (1369), Expect = 5.596e-162
Identity = 267/579 (46.11%), Postives = 387/579 (66.84%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FF V+GLN  E  Y+ LG   AI NG +QP+F+I+F  ++   AN + +        + +  A I  V+FV+  LQ   FG SGE LT R R   F AML+QD  W+D+P N++GALTTRL+ +  Q++G +G  +  +   + ++G ++ ISF + WQ++L++L+ VPI+ V G +Q++++ G +  DK  LE +GK+A E IENIRTV +LTRE  F   Y++ +        KKAH  G  +  +QA I+ AYA  F    +L+   M     V++   A+++GAM +G++ +  PN+ K KI+A+H+  L++RVP I++ S +G     E+  G+++  +V F YP RP++ +L  +   +   Q++ALVG SGCGKST I LL+RFYD + G +++D+   K +NI  LR    IVSQEP LF  S+ ENIAYGD+++  T ++I  AAKA+NIH FI  LP +Y T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEKIVQ+ALDKA+EGRTC+V+AHRLSTIQNAD I VF++G + E GTH +LL++ G+Y  +++ Q
Sbjct:  458 FFTVLGLNKTEWPYMVLGVFCAIINGGMQPAFAIIFSKIISVFANLDEDIVRERTNFFSLMFAVIGAVSFVALFLQGYSFGKSGEILTMRLRYRAFRAMLRQDPGWYDDPKNSVGALTTRLATDTAQVQGATGVRMATLAQNVANLGTSIIISFVYGWQLTLLILSIVPIMAVAGAIQMKMLGGHAVKDKKELELAGKVATEAIENIRTVVSLTRESKFEILYQQNLVVPYQNAKKKAHIFGLTFSFSQAMIYFAYAGCFRFGAWLIEQKMMDFEGVYLVISAVMYGAMAVGEANSFTPNYAKAKISASHVLMLINRVPAIDNESEEGE--KPEDFEGNVRFHDVHFKYPSRPDVPVLQGLRLRVKKGQSLALVGSSGCGKSTTIQLLERFYDPMQGAVMLDDKDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVTQEEIERAAKAANIHSFIQELPQKYLTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKIVQEALDKAREGRTCIVVAHRLSTIQNADVIAVFQNGVVVEQGTHQQLLNQQGVYYTLVNSQ 1034          

HSP 2 Score: 459.144 bits (1180), Expect = 6.023e-137
Identity = 231/389 (59.38%), Postives = 291/389 (74.81%), Query Frame = 1
Query:  982 KASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            K   AY KAG +AEEVL +IRT+ +F G+K E+ RY +NL++A  +GIRK+I+    +G V  +++ SYAL FWYG++LI     + VG++L VFF+ ++   GIGQ +P++ +F  AR AA ++F IID  P ID  +EEG K +  +G I F+ + F YP+R D  +L G++L I+ GQT+ALVG+SGCGKS+ +QL+QRFYD  EG V IDD +I+ +NV  LRE IGVVSQEPVLF  SI ENIRYGR DVT EEI+QA   ANA  FI  LP+K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTIIVAHRLST+RNA VI G ++GK+ E GTH ELM + G+Y+ LV  Q
Sbjct:    7 KEQTAYAKAGAVAEEVLSAIRTVFAFGGQKKELKRYQKNLEDAKNVGIRKAIMVNISVGFVYFMIYMSYALAFWYGSTLII-AKEYQVGNLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHKPSIDSFSEEGYKPDVVKGNIEFRNIHFNYPSRQDVKVLNGMNLKIRSGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVTIDDHDIRSMNVRCLRELIGVVSQEPVLFATSIAENIRYGREDVTQEEIEQATREANAYDFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADVIAGFQNGKIVELGTHDELMGMKGVYQSLVTMQ 394          

HSP 3 Score: 417.927 bits (1073), Expect = 5.737e-123
Identity = 239/546 (43.77%), Postives = 339/546 (62.09%), Query Frame = 1
Query:  526 EEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            E+IVR +        +N F+LM      FA I    F+  ++    F  + +     +R   FRA++RQ+ GW+D  +NS GALT +L  D   V    G ++  + Q  A     II++FV GW+LTL+ LSI P++ +   +  K +     K  +    AG +A E + +IRT+VS  R  K+E+  Y +NL    +   +K+ + G        +++ +YA  F +GA LI +      G  L++  + +     +G+A     ++ +A+ +A+ +  +I+RVP ID  +EEG+K  DF+G + F  V F YP+R D P+L GL L ++ GQ++ALVG+SGCGKS+ IQL++RFYD  +G V++DD + K LN+ WLR QIG+VSQEPVLF CS+ ENI YG     VT EEI++A   AN  +FI  LP K  T  GD+GTQLSGGQKQRIAIARA++RNPK+LLLDEATSALD+ESEKIVQ+ALDK  EGRT I+VAHRLST++NA VI   ++G V EQGTH +L+   G+Y  LV+ Q
Sbjct:  505 EDIVRER--------TNFFSLM------FAVIGAVSFVALFLQGYSFGKSGEILTMRLRYRAFRAMLRQDPGWYDDPKNSVGALTTRLATDTAQVQGATGVRMATLAQNVANLGTSIIISFVYGWQLTLLILSIVPIMAVAGAIQMKMLGGHAVKDKKELELAGKVATEAIENIRTVVSLTRESKFEIL-YQQNLVVPYQNAKKKAHIFGLTFSFSQAMIYFAYAGCFRFGAWLIEQKMMDFEGVYLVIS-AVMYGAMAVGEANSFTPNYAKAKISASHVLMLINRVPAIDNESEEGEKPEDFEGNVRFHDVHFKYPSRPDVPVLQGLRLRVKKGQSLALVGSSGCGKSTTIQLLERFYDPMQGAVMLDDKDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVTQEEIERAAKAANIHSFIQELPQKYLTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKIVQEALDKAREGRTCIVVAHRLSTIQNADVIAVFQNGVVVEQGTHQQLLNQQGVYYTLVNSQ 1034          

HSP 4 Score: 319.316 bits (817), Expect = 8.296e-90
Identity = 175/399 (43.86%), Postives = 256/399 (64.16%), Query Frame = 2
Query: 2849 MQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            M  F++ ++ A  ++G +A E +  IRTV     +   ++ Y++ ++       +KA       G     I+ +YA  F     L++    ++ N+   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G   DV  + G+I+  N+ F+YP R ++ +LN ++  I S QTIALVG SGCGKST + LLQRFYD   G + ID++ I+ +N++ LR+L  +VSQEP LF+ SI ENI YG      T ++I  A + +N +DFI+ LPD++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F++GKI E GTH EL+   G+Y  ++++Q+
Sbjct:    1 MTSFTSKEQTAYAKAGAVAEEVLSAIRTVFAFGGQKKELKRYQKNLEDAKNVGIRKAIMVNISVGFVYFMIYMSYALAFWYGSTLIIAKEYQVGNLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHKPSIDSFSEEGYKPDV--VKGNIEFRNIHFNYPSRQDVKVLNGMNLKIRSGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVTIDDHDIRSMNVRCLRELIGVVSQEPVLFATSIAENIRYGRED--VTQEEIEQATREANAYDFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADVIAGFQNGKIVELGTHDELMGMKGVYQSLVTMQT 395          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Match: abcb4 (multidrug resistance protein 1 [Source:NCBI gene;Acc:103043081])

HSP 1 Score: 525.783 bits (1353), Expect = 2.547e-160
Identity = 266/579 (45.94%), Postives = 386/579 (66.67%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FF V+GLN  E  Y+ LG   AI NG +QP+F+I+F  ++        + Q+     + +  A I  V+FV+  LQ   FG SGE LT R R   F AML+QD  W+D+P N++GALTTRL+ +  Q++G +G  +  +   + ++G ++ ISF + WQ++L++L+ VPI+ V G +Q++++ G +  DK  LE +GK+A E IENIRTV +LTRE  F   Y++ +        KKAH  G  +  +QA I+ AYA  F    +L+   M     V++   A+++GAM +G++ +  PN+ K KI+A+H+  L++RVP I++ S +G     E+  G+++  +V F YP RP++ +L  +   +   Q++ALVG SGCGKST I LL+RFYD + G +++D+   K +NI  LR    IVSQEP LF  S+ ENIAYGD+++  T ++I  AAKA+NIH FI  LP +Y T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEKIVQ+ALDKA+EGRTC+V+AHRLSTIQNAD I VF++G + E GTH +LL++ G+Y  +++ Q
Sbjct:  431 FFTVLGLNKTEWPYMVLGVFCAIINGGMQPAFAIIFSKIISVG-----QVQTERTNFFSLMFAVIGAVSFVALFLQGYSFGKSGEILTMRLRYRAFRAMLRQDPGWYDDPKNSVGALTTRLATDTAQVQGATGVRMATLAQNVANLGTSIIISFVYGWQLTLLILSIVPIMAVAGAIQMKMLGGHAVKDKKELELAGKVATEAIENIRTVVSLTRESKFEILYQQNLVVPYQNAKKKAHIFGLTFSFSQAMIYFAYAGCFRFGAWLIEQKMMDFEGVYLVISAVMYGAMAVGEANSFTPNYAKAKISASHVLMLINRVPAIDNESEEGE--KPEDFEGNVRFHDVHFKYPSRPDVPVLQGLRLRVKKGQSLALVGSSGCGKSTTIQLLERFYDPMQGAVMLDDKDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVTQEEIERAAKAANIHSFIQELPQKYLTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKIVQEALDKAREGRTCIVVAHRLSTIQNADVIAVFQNGVVVEQGTHQQLLNQQGVYYTLVNSQ 1002          

HSP 2 Score: 460.685 bits (1184), Expect = 7.180e-138
Identity = 235/413 (56.90%), Postives = 300/413 (72.64%), Query Frame = 1
Query:  919 ISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
            + PL+  C+     T      K   AY KAG +AEEVL +IRT+ +F G+K E+ RY +NL++A  +GIRK+I+    +G V  +++ SYAL FWYG++LI     + VG++L VFF+ ++   GIGQ +P++ +F  AR AA ++F IID  P ID  +EEG K +  +G I F+ + F YP+R D  +L G++L I+ GQT+ALVG+SGCGKS+ +QL+QRFYD  EG V IDD +I+ +NV  LRE IGVVSQEPVLF  SI ENIRYGR DVT EEI+QA   ANA  FI  LP+K +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTTIIVAHRLST+RNA VI G ++GK+ E GTH ELM + G+Y+ LV  Q+ +
Sbjct:   16 VCPLLCFCVFKSVMTSFTS--KEQTAYAKAGAVAEEVLSAIRTVFAFGGQKKELKRYQKNLEDAKNVGIRKAIMVNISVGFVYFMIYMSYALAFWYGSTLII-AKEYQVGNLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHKPSIDSFSEEGYKPDVVKGNIEFRNIHFNYPSRQDVKVLNGMNLKIRSGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVTIDDHDIRSMNVRCLRELIGVVSQEPVLFATSIAENIRYGREDVTQEEIEQATREANAYDFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADVIAGFQNGKIVELGTHDELMGMKGVYQSLVTMQEEK 425          

HSP 3 Score: 415.616 bits (1067), Expect = 1.757e-122
Identity = 235/531 (44.26%), Postives = 333/531 (62.71%), Query Frame = 1
Query:  571 SNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSF-RGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +N F+LM      FA I    F+  ++    F  + +     +R   FRA++RQ+ GW+D  +NS GALT +L  D   V    G ++  + Q  A     II++FV GW+LTL+ LSI P++ +   +  K +     K  +    AG +A E + +IRT+VS  R  K+E+  Y +NL    +   +K+ + G        +++ +YA  F +GA LI +      G  L++  + +     +G+A     ++ +A+ +A+ +  +I+RVP ID  +EEG+K  DF+G + F  V F YP+R D P+L GL L ++ GQ++ALVG+SGCGKS+ IQL++RFYD  +G V++DD + K LN+ WLR QIG+VSQEPVLF CS+ ENI YG     VT EEI++A   AN  +FI  LP K  T  GD+GTQLSGGQKQRIAIARA++RNPK+LLLDEATSALD+ESEKIVQ+ALDK  EGRT I+VAHRLST++NA VI   ++G V EQGTH +L+   G+Y  LV+ Q
Sbjct:  480 TNFFSLM------FAVIGAVSFVALFLQGYSFGKSGEILTMRLRYRAFRAMLRQDPGWYDDPKNSVGALTTRLATDTAQVQGATGVRMATLAQNVANLGTSIIISFVYGWQLTLLILSIVPIMAVAGAIQMKMLGGHAVKDKKELELAGKVATEAIENIRTVVSLTRESKFEIL-YQQNLVVPYQNAKKKAHIFGLTFSFSQAMIYFAYAGCFRFGAWLIEQKMMDFEGVYLVIS-AVMYGAMAVGEANSFTPNYAKAKISASHVLMLINRVPAIDNESEEGEKPEDFEGNVRFHDVHFKYPSRPDVPVLQGLRLRVKKGQSLALVGSSGCGKSTTIQLLERFYDPMQGAVMLDDKDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVTQEEIERAAKAANIHSFIQELPQKYLTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKIVQEALDKAREGRTCIVVAHRLSTIQNADVIAVFQNGVVVEQGTHQQLLNQQGVYYTLVNSQ 1002          

HSP 4 Score: 321.627 bits (823), Expect = 6.876e-91
Identity = 176/402 (43.78%), Postives = 257/402 (63.93%), Query Frame = 2
Query: 2846 IMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            +M  F++ ++ A  ++G +A E +  IRTV     +   ++ Y++ ++       +KA       G     I+ +YA  F     L++    ++ N+   F A+I GA  +G++      F   + AA  +F ++D  P I+SFS +G   DV  + G+I+  N+ F+YP R ++ +LN ++  I S QTIALVG SGCGKST + LLQRFYD   G + ID++ I+ +N++ LR+L  +VSQEP LF+ SI ENI YG      T ++I  A + +N +DFI+ LPD++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALDTESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F++GKI E GTH EL+   G+Y  ++++Q  K
Sbjct:   28 VMTSFTSKEQTAYAKAGAVAEEVLSAIRTVFAFGGQKKELKRYQKNLEDAKNVGIRKAIMVNISVGFVYFMIYMSYALAFWYGSTLIIAKEYQVGNLLTVFFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHKPSIDSFSEEGYKPDV--VKGNIEFRNIHFNYPSRQDVKVLNGMNLKIRSGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVTIDDHDIRSMNVRCLRELIGVVSQEPVLFATSIAENIRYGRED--VTQEEIEQATREANAYDFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADVIAGFQNGKIVELGTHDELMGMKGVYQSLVTMQEEK 425          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 521.546 bits (1342), Expect = 2.723e-156
Identity = 283/609 (46.47%), Postives = 381/609 (62.56%), Query Frame = 1
Query:  349 MICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTL--------MSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL-IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            M+  ++ S   G   P++ +VFG+ T                L+ Q    T             N  +N T  SS+  T         M+  +  F GI   + ++    V  FVITS  Q   IR  +F AV+ Q + WFD      L  +L DDINT++ G+GDKI   +Q++  F+ G I+ F+ GWKLTLV +S+SPL+     + SK +  LT +   AY KAG ++ E+LG+IRT+V+F G +  + +Y  NL EA   G+RK+I T   +G+   L+F ++AL FWYG  L + E   + +G +L VFFS ++    +GQ  P++ S  +AR AA  I+  ID    ID  + +G K +   G I FK + F+YP+R D  IL G+SL +  G+T+ALVGASGCGKS+ IQL+QRFYD + GEV +D  +I+ LNV WLRE +G+VSQEPVLFG +I ENIRYGR D TD++ID+A+  ANA  FI+ LP+ L+T+VG+RG QLSGGQKQRIAIARALV+NPKILLLDEATSALD++SE IVQ ALDK   GRTTI++AHRLST+R A VI G KDG+V EQGTH ELM   G+Y  LV +Q
Sbjct:    1 MLVGLLCSAIHGAALPIMFIVFGSMTDSF------------ILSGQQLNFTG------------NYTFNLTKRSSDCMTFPGEDIEGSMTKNAYYFVGIGAGVLLLGTFQVMLFVITSTRQTKRIREKYFHAVLHQPMAWFDTHPIRELNTRLTDDINTINDGLGDKICIFVQYFCRFLAGFIIGFIYGWKLTLVIMSVSPLLAGSAALCSKILATLTGRELSAYAKAGSVSAEILGAIRTVVAFNGRQKALEKYETNLLEAKNFGVRKAITTNAAMGITQFLLFSTFALAFWYGTKLSVDEPENYSIGKVLTVFFSVMIGALSLGQGAPNLESIAKARGAAYSIYSTIDMPRPIDSSSIKGYKPDSVSGDIEFKKIHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDAGEVTLDGRDIRCLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSEAIVQAALDKARAGRTTIVIAHRLSTIRTADVIAGFKDGEVVEQGTHRELMNKKGVYYSLVMQQ 585          

HSP 2 Score: 489.574 bits (1259), Expect = 2.826e-145
Identity = 246/584 (42.12%), Postives = 381/584 (65.24%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA--NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ-SH 4048
            F +++ LN PE   + +G +++   G V P   ILF  ++   A  +P +++Q + + + +  L G   +AF++   Q    G SGE LT R RS  F+A+L+QDI+WFD+  N +G LTT+L+ +A+ ++G +G  L    ++ CS+G +V ++  F WQ++L++LA VP +     +Q R M+G ++ D+ ALE SGKI+ E +EN RTV  LT+E  F+Q + +++ +       KA   G  + L QA+ +   AA F    +L+ +  ++  ++++ F  L+   MN+G++ +   +F K K AA  +  LL++ P I+ +S  GV     N  GDI+  +V FSYP +P++ IL  ++ ++   QT+ALVG SGCGKST I LL+RFY+   G +  D    + +N+  LR    +VSQEP LF  +I ENI YGD++++ + ++++ AAK +NIH+FI+NLP++Y T+VG+KG+  SGGQKQRIAIARAL+RNP++LLLDEATSALDTESEKIVQ ALD+A++GRTC+VIAHRL+T+QNAD I V ++G++ E G H EL++K G Y  +++ Q SH
Sbjct:  667 FGRILALNKPEWPCVLMGTLASCVGGGVYPCVGILFAKIIGVFAELDPEVKRQKSMMFSLLFFLVG--TMAFLTYFFQGYMLGKSGESLTMRLRSQAFKAILRQDISWFDDYDNAVGVLTTKLATDASLVKGAAGSRLSLATSSFCSLGVSVIVALCFSWQLTLLILACVPFLTGAMFIQTRSMKGHASKDQRALETSGKISTETVENFRTVVALTKEEVFMQKFSDSLSEPYKSALWKAPLYGMSFALAQASSYFVRAAFFRFGAWLIAHCYAQYEDIYLVFSVLVLSTMNVGQTSSANLDFAKAKAAAGRIIALLEKKPEIDIYSDAGV--KPTNFRGDIEFHDVHFSYPTQPDVRILQGLNVSVRQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRGLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVVEAAKKANIHEFILNLPERYNTRVGDKGTQLSGGQKQRIAIARALVRNPKVLLLDEATSALDTESEKIVQKALDEARKGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKQGAYYALVNAQVSH 1246          

HSP 3 Score: 379.022 bits (972), Expect = 2.735e-108
Identity = 211/488 (43.24%), Postives = 308/488 (63.11%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ+I WFD  ++  G LT KL  D + V    G ++      +      +I+A    W+LTL+ L+  P +   M + +++M     K   A   +G I+ E + + RT+V+   E+  + +++++L E  K  + K+ L G    L     +   A  F +GA LI         D+ +VF   +++T  +GQ +     F +A++AA  I  ++++ PEID  ++ G K  +F+G I F  V F+YPT+ D  IL GL++S++ GQT+ALVG SGCGKS+ IQL++RFY+   G+V  D  + + LN+ WLR Q+G+VSQEP+LF C+I ENI+YG     V+ EE+ +A   AN   FI  LP + +T VGD+GTQLSGGQKQRIAIARALVRNPK+LLLDEATSALD+ESEKIVQ ALD+  +GRT I++AHRL+TV+NA +I  I++G+V EQG H+ELMA  G Y  LV+ Q
Sbjct:  757 LRSQAFKAILRQDISWFDDYDNAVGVLTTKLATDASLVKGAAGSRLSLATSSFCSLGVSVIVALCFSWQLTLLILACVPFLTGAMFIQTRSMKGHASKDQRALETSGKISTETVENFRTVVALTKEEVFMQKFSDSLSEPYKSALWKAPLYGMSFALAQASSYFVRAAFFRFGAWLIAHCYA-QYEDIYLVFSVLVLSTMNVGQTSSANLDFAKAKAAAGRIIALLEKKPEIDIYSDAGVKPTNFRGDIEFHDVHFSYPTQPDVRILQGLNVSVRQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRGLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVVEAAKKANIHEFILNLPERYNTRVGDKGTQLSGGQKQRIAIARALVRNPKVLLLDEATSALDTESEKIVQKALDEARKGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKQGAYYALVNAQ 1243          

HSP 4 Score: 342.813 bits (878), Expect = 2.880e-96
Identity = 219/595 (36.81%), Postives = 325/595 (54.62%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFG-----FLLPAMA-------NPNIEQQSADIRTY------------VIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            + +G + +  +GA  P   I+FG     F+L             N+ ++S+D  T+                 GI     +    Q + F  +  + TKR R   F A+L Q +AWFD  ++ I  L TRL+D+   I    G+ +   +   C   A   I F + W+++LV+++  P++     L  +I+   +  +  A  ++G ++ E +  IRTV         ++ Y+  + +      +KA       G+TQ  +F  +A  F     L +     Y++ K+  VF S   ++ GA++LG+      +  K + AA  ++  +D   PI+S S  G   D  ++SGDI+ + + FSYP R ++ IL  +S  +   +TIALVG SGCGKST I LLQRFYD   G + +D   I+ +N++ LR+   IVSQEP LF  +I ENI YG      TD  I  A + +N ++FI  LPD   T VGE+G+  SGGQKQRIAIARAL++NP+ILLLDEATSALDT+SE IVQ ALDKA+ GRT +VIAHRLSTI+ AD I  FKDG++ E GTH EL++K G+Y  ++  Q+
Sbjct:    1 MLVGLLCSAIHGAALPIMFIVFGSMTDSFILSGQQLNFTGNYTFNLTKRSSDCMTFPGEDIEGSMTKNAYYFVGIGAGVLLLGTFQVMLFVITSTRQTKRIREKYFHAVLHQPMAWFD--THPIRELNTRLTDDINTINDGLGDKICIFVQYFCRFLAGFIIGFIYGWKLTLVIMSVSPLLAGSAALCSKILATLTGRELSAYAKAGSVSAEILGAIRTVVAFNGRQKALEKYETNLLEAKNFGVRKAITTNAAMGITQFLLFSTFALAFWYGTKLSVDEPENYSIGKVLTVFFS---VMIGALSLGQGAPNLESIAKARGAAYSIYSTIDMPRPIDSSSIKGYKPD--SVSGDIEFKKIHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDAGEVTLDGRDIRCLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDA--TDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSEAIVQAALDKARAGRTTIVIAHRLSTIRTADVIAGFKDGEVVEQGTHRELMNKKGVYYSLVMQQT 586          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 517.694 bits (1332), Expect = 9.057e-156
Identity = 259/584 (44.35%), Postives = 390/584 (66.78%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMA--NPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ-SH 4048
            F +++ LN PE  Y+ +G ++++  GAV P   ILF  ++   A  +P +++Q   + + +  L G   VAF++   Q   FG SGE LT R RS  F+A+L+QDI+WFD+ +N +G LTT+L+ +A+ ++GV+G  +G   +++C++G +V I+F F WQ++L++LA VP +     +Q+R MQG ++ D+ ALE SGKI+ E +EN +TV  LT+E  F + + +++ +       KA   G  + L QA  +   AA F    +L+ +  ++  NVF+ F  +IF AM++G+S + AP+F K K+AA  +  LL++ P I+ +S  G      N  GDI+   + FSYP RPNI IL  ++ ++   QT+ALVG SGCGKST I LL+RFY+   G +  D    + +N+  LR    +VSQEP LF  +I ENI YGD++++ + +++  AAK +NIH+FI+NLP++Y T+VG+KG+  SGGQKQRIAIARAL+RNP++LLLDEATSALDTESEKIVQ ALD A++GRTC+VIAHRL+T+QNAD I V ++G++ E G H EL++K+G Y  +++ Q SH
Sbjct:  582 FGRILALNKPEWPYVMVGTLASLVGGAVYPCVGILFAKIIGVFAETDPEVKRQKTMMFSLLFLLVG--AVAFITYFFQGYMFGKSGEILTMRLRSQAFKAILRQDISWFDDHNNAVGVLTTKLATDASLVKGVTGSRIGLATSSVCALGISVIIAFCFSWQLTLLILACVPFLTGANFIQMRAMQGHASKDQSALETSGKISTETVENFKTVVALTKEDVFFRKFNDSLAEPYKSALCKAPIYGITFALAQAIPYLVNAAVFRFGAWLIAHCHTQYENVFLVFSVIIFAAMSIGQSSSFAPDFAKAKVAAGRILSLLEKTPEIDIYSEAGD--KPMNFKGDIEFHELHFSYPTRPNIKILQGLNVSVRQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRMLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVEEAAKNANIHEFILNLPERYNTRVGDKGTQLSGGQKQRIAIARALVRNPKVLLLDEATSALDTESEKIVQKALDDARQGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKHGAYYALVNAQVSH 1161          

HSP 2 Score: 505.368 bits (1300), Expect = 1.378e-151
Identity = 258/517 (49.90%), Postives = 353/517 (68.28%), Query Frame = 1
Query:  601 SQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL-IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            S  F GI   + ++    V  F++T+  Q   IR  +F AV+ Q + WFD    G L  +L DDINT++ G+GDKI   +Q++  F+ GII+ F+ GWKLTLV +S+SPL+     + SK +  LT K   AY KAG +AEE+L +IRT+V+F G++  + +Y +NL++A   G++K+I T   +G+    +FG+YAL FWYG  L + E   + +G ++ VFFS ++    +GQ  P++ S  +AR AA  I+  ID    ID  ++EG K +  +G I FK + F+YP+R D  IL G+SL +  G+T+ALVGASGCGKS+ IQL+QRFYD + GEV +D  +I+ LNV WLRE +G+VSQEPVLFG +I ENIRYGR D TD++ID+A+  ANA  FI+ LP+ L+T+VG+RG QLSGGQKQRIAIARALV+NPKILLLDEATSALD++SE   Q        GRTTI++AHRLST+R A VI G K+G+V EQGTH EL+   G+Y  LV +Q
Sbjct:   22 SYYFVGIGAGVLLLGTFQVMLFLLTATRQTKRIREKYFHAVLHQQMAWFDTHPIGELNTRLTDDINTINDGLGDKICIFVQFFCRFLAGIIIGFIYGWKLTLVIMSVSPLLAGSAAVWSKILATLTGKELSAYAKAGAVAEEILVAIRTVVAFNGQQKALEKYEKNLEDAKNFGVKKAITTNVSMGITQFFIFGTYALAFWYGTKLSVDEPENYSIGKVITVFFSVMIGAFSLGQGAPNLESVAKARGAAYSIYNTIDMPRPIDSSSKEGHKPDSVRGDIEFKNIHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDAGEVTLDGRDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSES--QGNFPNARAGRTTIVIAHRLSTIRTADVIAGFKEGEVVEQGTHRELLNKKGVYYSLVMQQ 536          

HSP 3 Score: 387.111 bits (993), Expect = 1.445e-111
Identity = 215/489 (43.97%), Postives = 309/489 (63.19%), Query Frame = 1
Query:  697 IRNAFFRAVMRQNIGWFDAQNS--GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIG-GIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +R+  F+A++RQ+I WFD  N+  G LT KL  D + V    G +IG +     C +G  +I+AF   W+LTL+ L+  P +     +  + M     K   A   +G I+ E + + +T+V+   E     ++ ++L E  K  + K+ + G    L   + +   A  F +GA LI   +     ++ +VF   + A   IGQ++     F +A+ AA  I  ++++ PEID  +E GDK  +F+G I F  + F+YPTR +  IL GL++S++ GQT+ALVG SGCGKS+ IQL++RFY+   G+V  D  + + LN+ WLR Q+G+VSQEP+LF C+I ENI+YG     V+ EE+++A   AN   FI  LP + +T VGD+GTQLSGGQKQRIAIARALVRNPK+LLLDEATSALD+ESEKIVQ ALD   +GRT I++AHRL+TV+NA +I  I++G+V EQG H+ELMA +G Y  LV+ Q
Sbjct:  672 LRSQAFKAILRQDISWFDDHNNAVGVLTTKLATDASLVKGVTGSRIG-LATSSVCALGISVIIAFCFSWQLTLLILACVPFLTGANFIQMRAMQGHASKDQSALETSGKISTETVENFKTVVALTKEDVFFRKFNDSLAEPYKSALCKAPIYGITFALAQAIPYLVNAAVFRFGAWLIAHCHT-QYENVFLVFSVIIFAAMSIGQSSSFAPDFAKAKVAAGRILSLLEKTPEIDIYSEAGDKPMNFKGDIEFHELHFSYPTRPNIKILQGLNVSVRQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRMLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVEEAAKNANIHEFILNLPERYNTRVGDKGTQLSGGQKQRIAIARALVRNPKVLLLDEATSALDTESEKIVQKALDDARQGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKHGAYYALVNAQ 1158          

HSP 4 Score: 332.028 bits (850), Expect = 2.574e-93
Identity = 204/521 (39.16%), Postives = 297/521 (57.01%), Query Frame = 2
Query: 2495 GIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL-----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            GI     +    Q + F  +  + TKR R   F A+L Q +AWFD  ++ IG L TRL+D+   I    G+ +   +   C   A + I F + W+++LV+++  P++     +  +I+   +  +  A  ++G +A E +  IRTV     +   ++ Y++ ++       KKA       G+TQ  IF  YA  F     L +     Y++ K+  VF S   ++ GA +LG+      +  K + AA  ++  +D   PI+S S +G   D  ++ GDI+ +N+ FSYP R ++ IL  +S  +   +TIALVG SGCGKST I LLQRFYD   G + +D   I+ +N++ LR+   IVSQEP LF  +I ENI YG      TD  I  A + +N ++FI  LPD   T VGE+G+  SGGQKQRIAIARAL++NP+ILLLDEATSALDT+SE   Q     A+ GRT +VIAHRLSTI+ AD I  FK+G++ E GTH ELL+K G+Y  ++  Q
Sbjct:   27 GIGAGVLLLGTFQVMLFLLTATRQTKRIREKYFHAVLHQQMAWFD--THPIGELNTRLTDDINTINDGLGDKICIFVQFFCRFLAGIIIGFIYGWKLTLVIMSVSPLLAGSAAVWSKILATLTGKELSAYAKAGAVAEEILVAIRTVVAFNGQQKALEKYEKNLEDAKNFGVKKAITTNVSMGITQFFIFGTYALAFWYGTKLSVDEPENYSIGKVITVFFS---VMIGAFSLGQGAPNLESVAKARGAAYSIYNTIDMPRPIDSSSKEGHKPD--SVRGDIEFKNIHFSYPSRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPDAGEVTLDGRDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDA--TDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSES--QGNFPNARAGRTTIVIAHRLSTIRTADVIAGFKEGEVVEQGTHRELLNKKGVYYSLVMQQ 536          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Match: ABCB1 (ATP binding cassette subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:40])

HSP 1 Score: 564.303 bits (1453), Expect = 7.324e-174
Identity = 278/579 (48.01%), Postives = 407/579 (70.29%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            F+KV+ LN  E  YI LG + A  NGA+QP+F+++F  ++   A  ++ ++      Y +    + +V+FV+  LQ   FG SGE LT + RS+   AML+QD+ WFD+P N+ GALTTRL+ +A+Q++G +G  L  +   I +MG A+ ISF + W+++L++LA VP +   G L+++ + G +N DK  LEE+GKIA E +ENIRTV++LTRE T  + Y+++++       KK+   G  YG +Q  ++ A AA F    +L+     +  NVF+ F A++FGAM +G++ + AP++ K K +A H+F L   +P I+S+S +G  L  E+  G+++ ++V F+YP+RPN+ +L  +S  + + QT+ALVG SGCGKST + LL+RFYDTL+GN+LID   ++ ++IQ LR    IVSQEP LF  S+ ENIAYGD+++I   D+I+AAA+A+NIH FI +LP++Y TKVG+KG+  SGGQKQRIAIARAL+R P+ILLLDEATSALDTESEKIVQ+ALD+A+EGRTC+VIAHRLST+Q ADKI V ++G++ E GTH +LL+K G Y  +++ Q
Sbjct:  481 FWKVLALNKKEWPYITLGTLCAGVNGALQPAFAVIFSRIIGVFAETDLVKREEQSNLYSLLFLVLGIVSFVTFFLQGFLFGRSGELLTMKLRSMGLRAMLRQDMMWFDDPKNSTGALTTRLATDASQVQGATGARLATIAQNIANMGTAIVISFVYGWELTLLILAIVPFVGAAGFLEMQALTGQANRDKKLLEEAGKIATEAVENIRTVASLTRERTLEKIYQDSLEGPAKTAKKKSQFYGLTYGFSQGVVYLAQAAAFRFGAFLVTAGRMEFENVFLVFSAIVFGAMAVGQTSSFAPDYAKAKTSANHLFYLFQLIPAIDSYSDEGEKL--EDCEGNVEFQSVGFNYPMRPNVEVLKGLSLKVENGQTLALVGSSGCGKSTSVQLLERFYDTLSGNVLIDGKDVRSLHIQWLRAQMGIVSQEPVLFDCSMAENIAYGDNSRIVPQDEIVAAARAANIHTFIDSLPEKYNTKVGDKGTQLSGGQKQRIAIARALVRQPKILLLDEATSALDTESEKIVQEALDRAREGRTCIVIAHRLSTVQTADKIAVIQNGQVIEQGTHQQLLAKKGAYHLLVNAQ 1057          

HSP 2 Score: 405.601 bits (1041), Expect = 2.855e-119
Identity = 214/416 (51.44%), Postives = 290/416 (69.71%), Query Frame = 1
Query:  901 TLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            TLV L+ISP++ I   + SK +   T +   AY KAG +AEEVL +IRT+++F G++ E+ RY +NL EA  IGI+K+I T   +G  M +++ SY+L FWYG+ L+ E   + +G+++IVFF+ ++   GIGQA P + + + AR AA  IFEIIDR   +   N     L + + + T+        +   C +L G++L ++ GQTVALVG+SGCGKS+ IQL+QRFYD  +G +++D  +++ LN+  LR+ IGVVSQEPVLF  +I ENIR+G   VT E+I++A   ANA  FI+ +P + +TLVGDRG QLSGGQKQRIAIARAL+RNPK+LLLDEATSALD ESE IVQ+ALDK  EGRTTI++AHRLST+RNA +I G   G + E GTH ELM  NG+Y  LV  Q
Sbjct:    1 TLVILAISPVLAISAGLWSKILTSFTNRELLAYSKAGAVAEEVLSAIRTVMAFGGQEKELKRYDKNLVEARNIGIKKAITTNLSIGFTMFIVYASYSLAFWYGSRLVLEDTSYTIGNVMIVFFAVIIGAFGIGQAAPFLEAISVARGAAYTIFEIIDRTIHMYPFNTHNSSLRN-RKRCTWFREHTLVNSIAFCQVLKGVNLQVKSGQTVALVGSSGCGKSTTIQLLQRFYDPQQGTIMVDGRDVRTLNLRSLRQLIGVVSQEPVLFATTIAENIRFGHEKVTMEDIERAARNANAYDFISQMPERFNTLVGDRGAQLSGGQKQRIAIARALIRNPKLLLLDEATSALDGESEAIVQEALDKAREGRTTIVIAHRLSTIRNADIIAGFDGGVIVELGTHDELMKRNGVYHTLVSMQ 415          

HSP 3 Score: 397.512 bits (1020), Expect = 1.573e-116
Identity = 220/530 (41.51%), Postives = 328/530 (61.89%), Query Frame = 1
Query:  571 SNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            SN+++L+      F  + +  F+  ++    F  + +     +R+   RA++RQ++ WFD    ++GALT +L  D + V    G ++  + Q  A     I+++FV GW+LTL+ L+I P +     +  + +     +  +   +AG IA E + +IRT+ S   E+     Y ++L+   K   +KS   G   G   G+++ + A  F +GA L+  G      ++ +VF + +     +GQ +     + +A+++A  +F +   +P ID  ++EG+KL D +G + F+ V F YP R +  +L GLSL ++ GQT+ALVG+SGCGKS+ +QL++RFYD+  G VLID  +++ L++ WLR Q+G+VSQEPVLF CS+ ENI YG     V  +EI  A   AN  TFI++LP K +T VGD+GTQLSGGQKQRIAIARALVR PKILLLDEATSALD+ESEKIVQ+ALD+  EGRT I++AHRLSTV+ A  I  I++G+V EQGTH +L+A  G Y  LV+ Q
Sbjct:  535 SNLYSLL------FLVLGIVSFVTFFLQGFLFGRSGELLTMKLRSMGLRAMLRQDMMWFDDPKNSTGALTTRLATDASQVQGATGARLATIAQNIANMGTAIVISFVYGWELTLLILAIVPFVGAAGFLEMQALTGQANRDKKLLEEAGKIATEAVENIRTVASLTRERTLEKIYQDSLEGPAKTAKKKSQFYGLTYGFSQGVVYLAQAAAFRFGAFLVTAGR-MEFENVFLVFSAIVFGAMAVGQTSSFAPDYAKAKTSANHLFYLFQLIPAIDSYSDEGEKLEDCEGNVEFQSVGFNYPMRPNVEVLKGLSLKVENGQTLALVGSSGCGKSTSVQLLERFYDTLSGNVLIDGKDVRSLHIQWLRAQMGIVSQEPVLFDCSMAENIAYGDNSRIVPQDEIVAAARAANIHTFIDSLPEKYNTKVGDKGTQLSGGQKQRIAIARALVRQPKILLLDEATSALDTESEKIVQEALDRAREGRTCIVIAHRLSTVQTADKIAVIQNGQVIEQGTHQQLLAKKGAYHLLVNAQ 1057          

HSP 4 Score: 293.893 bits (751), Expect = 4.490e-82
Identity = 178/429 (41.49%), Postives = 259/429 (60.37%), Query Frame = 2
Query: 2786 SLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMS-KMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIII--------LNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            +LV+LA  P++ +   L  +I+  F+N +  A  ++G +A E +  IRTV     +   ++ Y + + +      KKA       G T   ++ +Y+  F     L+L + S  + NV I F A+I GA  +G++          + AA  +FE++DR   +  F+T        N S    + N K     R + ++        L  V+  + S QT+ALVG SGCGKST I LLQRFYD   G I++D   ++ +N+++LRQL  +VSQEP LF+ +I ENI +G   K+  +D I  AA+ +N +DFI  +P+++ T VG++G+  SGGQKQRIAIARAL+RNP++LLLDEATSALD ESE IVQ+ALDKA+EGRT +VIAHRLSTI+NAD I  F  G I E GTH EL+ +NG+Y  ++S+Q+
Sbjct:    1 TLVILAISPVLAISAGLWSKILTSFTNRELLAYSKAGAVAEEVLSAIRTVMAFGGQEKELKRYDKNLVEARNIGIKKAITTNLSIGFTMFIVYASYSLAFWYGSRLVLEDTSYTIGNVMIVFFAVIIGAFGIGQAAPFLEAISVARGAAYTIFEIIDRTIHMYPFNT-------HNSS----LRNRKRCTWFREHTLVNSIAFCQVLKGVNLQVKSGQTVALVGSSGCGKSTTIQLLQRFYDPQQGTIMVDGRDVRTLNLRSLRQLIGVVSQEPVLFATTIAENIRFGHE-KVTMED-IERAARNANAYDFISQMPERFNTLVGDRGAQLSGGQKQRIAIARALIRNPKLLLLDEATSALDGESEAIVQEALDKAREGRTTIVIAHRLSTIRNADIIAGFDGGVIVELGTHDELMKRNGVYHTLVSMQT 416          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Match: abcb11b (ATP-binding cassette, sub-family B (MDR/TAP), member 11b [Source:ZFIN;Acc:ZDB-GENE-050517-14])

HSP 1 Score: 476.093 bits (1224), Expect = 6.433e-141
Identity = 270/619 (43.62%), Postives = 383/619 (61.87%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSL---TQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G+ +LF +A   DIV+M+   + +I  G   P ++LVFG        Y      L    +   + +    + T+IP+                ++I   ++  +  + GI   + ++ Y+ + F+V+ +  Q+  IR AFF  +MR  IGWFD  + G L  ++ DDIN ++  I DK+   +Q +  F+ G ++ F+ GWKLTLV L++SPL+ +   ++   + ++T +  +AY KAG +AEEVL SIRT+ +F GEK E  RY +NL  A K GIRK ++ G   G +  ++F  YAL FWYG++L+ E   +  G +L VFF  L+    +GQA+P + +F   R AA  +F IIDR P ID M+++G+ L   +G I F  VKF+YPTR D   L   +L +  G+T A VG SG GKS+ +QL+QRFYD  EG+V +D  +I+ LN+ W+R  IGVV QEP+LF  +I ENIRYGR +VT  E++QA   ANA  FI  LP+K DT+VG+ G Q+SGGQKQRIAIARALVRNP+ILLLD+ATSALD+ESE +VQ ALDKV +G TTI +AHRLST+ +A VI G + G   E+G+H  LMA  G+Y  LV  Q
Sbjct:   52 GLCQLFRFAKGGDIVLMVTGALGAIVHGAALPFMLLVFGRMADAFIEYDLETQELQDPNKMCLNNSILWVNGTTIPNAT----------ACGHTDIEVELTTFAFYYLGIGCVVLLVGYLQICFWVMAAARQVLRIRQAFFHNIMRMEIGWFDMNSVGELNTRISDDINKINDAIADKMSIFIQRFTTFVCGFLIGFLNGWKLTLVILAVSPLLGLGGALMGSFVARMTGRELKAYAKAGAVAEEVLSSIRTVAAFGGEKKEENRYDKNLVMAQKWGIRKGMILGFFQGYMWFIIFLCYALAFWYGSNLVLEEEEYSPGTLLQVFFGVLVGAINLGQASPCLEAFASGRGAATHVFNIIDREPIIDCMSDDGNILQKVKGDIEFHNVKFSYPTRLDLTALHSFNLKVNAGETTAFVGPSGAGKSTAMQLIQRFYDPQEGKVTLDGHDIRSLNLRWMRSLIGVVEQEPILFATTIAENIRYGRDNVTVSEVEQAARRANAYNFIMELPHKFDTMVGEGGGQMSGGQKQRIAIARALVRNPRILLLDQATSALDNESEAVVQSALDKVRKGCTTISIAHRLSTIHSADVIVGFELGCAVERGSHEALMARQGVYFTLVTLQ 660          

HSP 2 Score: 448.358 bits (1152), Expect = 1.452e-131
Identity = 244/575 (42.43%), Postives = 348/575 (60.52%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            +++  NAPE  Y+  G V A  NG +QP F+ILF  +L     P  E+Q   I    +    I +V+FV+  LQ   F  SGE LT+R R   F AML+QD+ WFD+  N+ GALTTRL+ +A+Q++GV    +    + +    ++        W+    ++           + IR   G  N  + A         E I NIRTV+ L +E TF++ Y +++        +KA+  G  +  +Q+ IF  YAA+F   G+L+ ++  K   VF  F AL+F    LG++ + AP++ K KI+AA +F+L DR P I+S    GV  D     GD+   N  F+YP RP+  +LN +S ++   QT+ALVG SGCGKST + LL+RFYD   G +LID    + +N+  LR    IVSQEP LF  SI +NI YG + +  T D++I A+KA+ +HDF++ LP++YET VG+KG+  S G+KQR+AIARA++R+PRILLLDEATSALDTESE+ VQ ALD+A++GRTC+VIAHRLSTIQNAD+I V   G + E GTH EL+   G Y ++++
Sbjct:  742 RILKYNAPEWPYMVFGAVGAAINGGIQPVFAILFSEILGTFTLPTEEEQRNMINLTCLLFVLIGIVSFVTYFLQGYMFSKSGELLTRRLRRCGFTAMLRQDVGWFDDLKNSPGALTTRLATDASQVQGVKICYVFEFHSRMFFSFSSSCCCCSHRWERQTFIMN----------IYIRTPYGEDNRTRNA---RAHFVNESIVNIRTVAGLGKERTFVKQYTDSLTVPHRAAIRKANVFGATFSFSQSVIFFTYAASFRYGGFLVAHDGLKFPLVFRVFSALVFSGTALGRASSYAPDYAKAKISAARLFKLFDRTPAIDSSPDKGVSWD--GFRGDVTFTNCTFTYPSRPDTQVLNGLSVSVQPGQTLALVGTSGCGKSTSVQLLERFYDPDGGQVLIDGRDSRTVNVGFLRSKIGIVSQEPVLFDCSIADNIRYGANFRELTWDEVINASKAAQLHDFVMGLPEKYETNVGDKGAQLSRGEKQRVAIARAIIRDPRILLLDEATSALDTESEQTVQSALDQARQGRTCIVIAHRLSTIQNADQIAVISQGLVIEKGTHNELMDAQGAYYKLVT 1301          

HSP 3 Score: 339.732 bits (870), Expect = 1.095e-95
Identity = 199/517 (38.49%), Postives = 300/517 (58.03%), Query Frame = 1
Query:  610 FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYA---CFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGR--MDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            F  I +  F+  ++    F  + +     +R   F A++RQ++GWFD    + GALT +L  D + V    G KI  + ++++                W+     ++I                   +       +A  + E ++ +IRT+     E+  V +YT++L    +  IRK+ + G        ++F +YA  F YG  L+   +G     +  VF + + + T +G+A+ +   + +A+ +AA +F++ DR P ID   ++G   + F+G +TF    FTYP+R D  +L GLS+S+QPGQT+ALVG SGCGKS+ +QL++RFYD + G+VLID  + + +NV +LR +IG+VSQEPVLF CSI +NIRYG    ++T +E+  A   A    F+  LP K +T VGD+G QLS G+KQR+AIARA++R+P+ILLLDEATSALD+ESE+ VQ ALD+  +GRT I++AHRLST++NA  I  I  G V E+GTH ELM   G Y  LV
Sbjct:  801 FVLIGIVSFVTYFLQGYMFSKSGELLTRRLRRCGFTAMLRQDVGWFDDLKNSPGALTTRLATDASQVQ---GVKICYVFEFHSRMFFSFSSSCCCCSHRWERQTFIMNI------------YIRTPYGEDNRTRNARAHFVNESIV-NIRTVAGLGKERTFVKQYTDSLTVPHRAAIRKANVFGATFSFSQSVIFFTYAASFRYGGFLVAH-DGLKFPLVFRVFSALVFSGTALGRASSYAPDYAKAKISAARLFKLFDRTPAIDSSPDKGVSWDGFRGDVTFTNCTFTYPSRPDTQVLNGLSVSVQPGQTLALVGTSGCGKSTSVQLLERFYDPDGGQVLIDGRDSRTVNVGFLRSKIGIVSQEPVLFDCSIADNIRYGANFRELTWDEVINASKAAQLHDFVMGLPEKYETNVGDKGAQLSRGEKQRVAIARAIIRDPRILLLDEATSALDTESEQTVQSALDQARQGRTCIVIAHRLSTIQNADQIAVISQGLVIEKGTHNELMDAQGAYYKLV 1300          

HSP 4 Score: 307.76 bits (787), Expect = 2.188e-85
Identity = 213/601 (35.44%), Postives = 321/601 (53.41%), Query Frame = 2
Query: 2357 GCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQS---------------------------------ADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            G + AI +GA  P   ++FG +  A    ++E Q                                   ++ T+     GI  V  +   LQ   +  +  +   R R   F  +++ +I WFD   N++G L TR+SD+  +I     + +   I    +      I F   W+++LV+LA  P++ +GG L    +   +  +  A  ++G +A E + +IRTV+    E      Y + +        +K    GF  G     IF  YA  F     L+L    Y+   +  VF  FG L+ GA+NLG++      F  G+ AA H+F ++DR P I+  S DG +L  + + GDI+  NVKFSYP R ++  L+  +  +N+ +T A VGPSG GKST + L+QRFYD   G + +D + I+ +N++ +R L  +V QEP LF+ +I ENI YG      T  ++  AA+ +N ++FI+ LP +++T VGE G   SGGQKQRIAIARAL+RNPRILLLD+ATSALD ESE +VQ ALDK ++G T + IAHRLSTI +AD I+ F+ G   E G+H  L+++ G+Y  +++LQS 
Sbjct:   71 GALGAIVHGAALPFMLLVFGRMADAFIEYDLETQELQDPNKMCLNNSILWVNGTTIPNATACGHTDIEVELTTFAFYYLGIGCVVLLVGYLQICFWVMAAARQVLRIRQAFFHNIMRMEIGWFD--MNSVGELNTRISDDINKINDAIADKMSIFIQRFTTFVCGFLIGFLNGWKLTLVILAVSPLLGLGGALMGSFVARMTGRELKAYAKAGAVAEEVLSSIRTVAAFGGEKKEENRYDKNLVMAQKWGIRKGMILGFFQGYMWFIIFLCYALAFWYGSNLVLEEEEYSPGTLLQVF--FGVLV-GAINLGQASPCLEAFASGRGAATHVFNIIDREPIIDCMSDDGNIL--QKVKGDIEFHNVKFSYPTRLDLTALHSFNLKVNAGETTAFVGPSGAGKSTAMQLIQRFYDPQEGKVTLDGHDIRSLNLRWMRSLIGVVEQEPILFATTIAENIRYGRDN--VTVSEVEQAARRANAYNFIMELPHKFDTMVGEGGGQMSGGQKQRIAIARALVRNPRILLLDQATSALDNESEAVVQSALDKVRKGCTTISIAHRLSTIHSADVIVGFELGCAVERGSHEALMARQGVYFTLVTLQSQ 662          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001786.1 (pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-1 gene:ENSPMAG00000001622.1 transcript:ENSPMAT00000001786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 433.335 bits (1113), Expect = 1.162e-135
Identity = 215/478 (44.98%), Postives = 323/478 (67.57%), Query Frame = 2
Query: 2609 QDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            Q+I WF    NN GALT +LS +A Q++G +G   G ++  +  +   + I+    W+++L++LAF+P +   G++Q  +    + + K A E++ KI+ E ++NIRTV++L  E  F   +++ + +    + ++ +     +G TQ  +  AYAA F L G+L+        +V+  FGA+IFGA+ +G++MAMAPN+G+ K++AA +  LL R   I+S+S  G+  D     G++++  V F YP RP+  +L  VS  +   QT+ALVGPSG GKSTI+ LL RFYD+  G +L++  +++ +N+  LR+   +VSQEP LF  SI ENIAYGD ++  + D+++AAA+A+N+HDF+ +LP  Y+T VGE+G+  SGGQKQR+AIARALLR+PR+LLLDEATSALD ESEK+VQDAL+KAQ+GRTC+VIAHRLST++ AD I V +DG I E G+H ELLS  G+Y +++  Q
Sbjct:    7 QEIRWFYNHKNNTGALTAQLSTDAAQVQGATGRRAGMLVQNVSGLATGLLIALLVGWKLALLMLAFMPFMVGAGLVQSVLQGSEATTIKRAYEQASKISTEAVQNIRTVASLCLEEKFSGMFEQCLLEPYRVIKRRGYLFSVTFGFTQGILCFAYAAVFRLGGFLVAQGELTFQDVYKVFGAIIFGALAVGQAMAMAPNYGRAKVSAARILALLRREMAIDSYSEGGIQPDA--FDGELQLSGVHFRYPTRPHAEVLRGVSLRVAPGQTLALVGPSGSGKSTIMQLLLRFYDSSAGQLLLNGVEVRQLNLGWLRRQLGVVSQEPVLFGCSIAENIAYGDVSRAVSRDEVVAAARAANLHDFVESLPQAYDTVVGERGAQLSGGQKQRVAIARALLRDPRVLLLDEATSALDAESEKVVQDALEKAQQGRTCIVIAHRLSTVRAADVIAVLQDGDICELGSHEELLSARGLYYRLVEAQ 482          

HSP 2 Score: 364.77 bits (935), Expect = 6.788e-112
Identity = 202/477 (42.35%), Postives = 291/477 (61.01%), Query Frame = 1
Query:  730 QNIGWF--DAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            Q I WF     N+GALT +L  D   V    G + G ++Q  +    G+++A + GWKL L+ L+  P ++   L+ S            AY +A  I+ E + +IRT+ S   E+     + + L E  ++  R+  L     G   G++  +YA  F  G  L+ +G      D+  VF + +     +GQA     ++  A+ +AA I  ++ R   ID  +E G + + F G++    V F YPTR    +L G+SL + PGQT+ALVG SG GKS+++QL+ RFYDS+ G++L++   ++ LN+ WLR Q+GVVSQEPVLFGCSI ENI YG +   V+ +E+  A   AN   F+ +LP   DT+VG+RG QLSGGQKQR+AIARAL+R+P++LLLDEATSALD+ESEK+VQDAL+K  +GRT I++AHRLSTVR A VI  ++DG + E G+H EL++  GLY  LV+ Q
Sbjct:    7 QEIRWFYNHKNNTGALTAQLSTDAAQVQGATGRRAGMLVQNVSGLATGLLIALLVGWKLALLMLAFMPFMVGAGLVQSVLQGSEATTIKRAYEQASKISTEAVQNIRTVASLCLEEKFSGMFEQCLLEPYRVIKRRGYLFSVTFGFTQGILCFAYAAVFRLGGFLVAQGE-LTFQDVYKVFGAIIFGALAVGQAMAMAPNYGRAKVSAARILALLRREMAIDSYSEGGIQPDAFDGELQLSGVHFRYPTRPHAEVLRGVSLRVAPGQTLALVGPSGSGKSTIMQLLLRFYDSSAGQLLLNGVEVRQLNLGWLRRQLGVVSQEPVLFGCSIAENIAYGDVSRAVSRDEVVAAARAANLHDFVESLPQAYDTVVGERGAQLSGGQKQRVAIARALLRDPRVLLLDEATSALDAESEKVVQDALEKAQQGRTCIVIAHRLSTVRAADVIAVLQDGDICELGSHEELLSARGLYYRLVEAQ 482          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Match: abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10 [Source:ZFIN;Acc:ZDB-GENE-040525-2])

HSP 1 Score: 317.775 bits (813), Expect = 3.491e-94
Identity = 188/526 (35.74%), Postives = 301/526 (57.22%), Query Frame = 1
Query:  583 TLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD---VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMA-LNGLYKDLVDRQ 2148
            T ++ ++   +GI +A  I +   V    ++ Q  +  +R++ FRA+MRQ +G+FD   +G L N+L  D   +   + + +   ++  A    GI + F    KL    L + P I +  ++  + + ++T++  ++  +A  +AEE +G+IRT+ SF  E+ E+ +Y+  ++   ++  ++++      G           L   Y   L+ +     VGD+             IG  +       +     + I++++DR P I     +   L   +G+I F+ V F YPTR   P+   L L++  GQ  A+VG SGCGKS+L+ L+ R YD  +G+VLID  +++++N  WLR QIG VSQEP+LF CSI ENI YG  +    +  +I +A   ANA  FI   P+  DT+VG++G  LSGGQKQRIAIARA+++NP ILLLDEATSALDSESE +VQ+ALD+++ GRT +++AHRLST++ A  I  ++ G+V + GT+A+L A   G++  LV+RQ
Sbjct:   69 TDLAHLATVLSGIFMAGAIANAGRVYLMQVSGQRIVQRLRDSLFRAIMRQELGFFDRTRTGELVNRLSADTALMGRAVTENLSDGLRSVAQVTVGIGMMFYVSPKLATFVLGVVPPIALIAVVYGRYLRRITKRTQDSLAEATQVAEERIGNIRTVRSFAKEELEMQKYSSKVNYVLQLAYKEALARAGFFGATGLSGNL-IVLAVLYKGGLLMQSAHITVGDLSAFLLYSGWVGISIGGLSSFYSELMKGLGTGSRIWQLLDRQPTIPLGEGQVVPLQALRGEIEFRGVHFAYPTRETAPVFRSLDLAVPAGQVTAVVGPSGCGKSTLLSLLLRLYDPQKGQVLIDGQDVREVNPSWLRSQIGTVSQEPILFSCSIAENIAYGAANPEAASKADIARAAQAANAYGFIEGFPSGFDTVVGEKGVLLSGGQKQRIAIARAILKNPNILLLDEATSALDSESESLVQEALDRLMTGRTVLVIAHRLSTIQGADRIAVLERGRVAQAGTYAQLTADTGGMFHRLVERQ 593          

HSP 2 Score: 269.24 bits (687), Expect = 1.760e-77
Identity = 203/600 (33.83%), Postives = 324/600 (54.00%), Query Frame = 2
Query: 2294 SSAGFFKVMGLNAPEK----CYIFLGCVSAIFNGAVQPSFSILFGFLLPAM-ANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVG----FGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLS-DEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMT----NVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDS-AKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKN-GIYSQMISLQS 4045
            SS    K+M L  PE       + L C+S++    V  S     G ++  + +   ++    D+      L+GI    F++  + N G       SG+++ +R R   F A+++Q++ +FD      G L  RLS D A   R V+ E+L   + ++  +   + + F    +++  VL  VP I +  ++  R ++  +   + +L E+ ++A E I NIRTV +  +E   +Q Y   +  +     K+A A+   +G T  +      A     G  LL   + +T    + F+ +   +   +++G   +      KG    + +++LLDR P I     +G V+ ++ + G+I+   V F+YP R    +   +   + + Q  A+VGPSGCGKST++ LL R YD   G +LID   ++++N   LR     VSQEP LFS SI ENIAYG +  +  +   I  AA+A+N + FI   P  ++T VGEKG   SGGQKQRIAIARA+L+NP ILLLDEATSALD+ESE +VQ+ALD+   GRT +VIAHRLSTIQ AD+I V + G++A++GT+ +L +   G++ +++  Q+
Sbjct:   12 SSKDLKKLMALARPESRTLAAAVGLLCISSV----VTMSVPFCLGKVIDVINSTGGVDMAPTDLAHLATVLSGI----FMAGAIANAGRVYLMQVSGQRIVQRLRDSLFRAIMRQELGFFDR--TRTGELVNRLSADTALMGRAVT-ENLSDGLRSVAQVTVGIGMMFYVSPKLATFVLGVVPPIALIAVVYGRYLRRITKRTQDSLAEATQVAEERIGNIRTVRSFAKEELEMQKYSSKVNYVLQLAYKEALARAGFFGATGLSGNLIVLAVLYKGG--LLMQSAHITVGDLSAFLLYSGWV--GISIGGLSSFYSELMKGLGTGSRIWQLLDRQPTIPL--GEGQVVPLQALRGEIEFRGVHFAYPTRETAPVFRSLDLAVPAGQVTAVVGPSGCGKSTLLSLLLRLYDPQKGQVLIDGQDVREVNPSWLRSQIGTVSQEPILFSCSIAENIAYGAANPEAASKADIARAAQAANAYGFIEGFPSGFDTVVGEKGVLLSGGQKQRIAIARAILKNPNILLLDEATSALDSESESLVQEALDRLMTGRTVLVIAHRLSTIQGADRIAVLERGRVAQAGTYAQLTADTGGMFHRLVERQT 594          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Match: abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:NCBI gene;Acc:548340])

HSP 1 Score: 308.916 bits (790), Expect = 8.639e-91
Identity = 175/487 (35.93%), Postives = 282/487 (57.91%), Query Frame = 1
Query:  691 SAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQ-IGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +++R + F A++RQ++ +FDA  +G L N+L  D+    +     I Q ++     +G +   ++   KLT + + +   ++    ++   + KL+++A E   KA G+A+E LG++RT+ +F  E  +  +Y   +D++CK+     I      GL   ++        + G SL+  G     G+++    +       +   +   G      SA A +FE ++  P I          +   G + F  V F+YPTR    +L   +L++ P QT+A+VG SG GKS++  L++RFYD   G + +D  +++ L+  WLR + IG ++QEPVLFG +I ENIR+G+   TD+E+  A  +ANA  FI + P+  +T+VG+RG  LSGGQKQR+AIARAL++ P +L+LDEATSALD+E+E  VQ+AL++   GRT +++AHRLSTV  A++I  +  G VQE GTHAEL+   GLY +L+ RQ
Sbjct:  135 ASMRKSLFEALIRQDVAFFDANRTGHLVNRLTSDVQEFKSSFKLVISQGLRSVTQTVGCVASLYLISPKLTGLMVVVMTAMVGGGALIGSFLRKLSRRAQEQISKATGVADETLGNVRTVRAFAMEDSKSEQYAVEVDKSCKMNEDLGIGIAIFQGLSNIVLNCIVLGTIFVGGSLM-AGEELSPGELMSFLVASQTVQRSMASVSILFGQMVRGLSAGARLFEYMELEPSIPVRGGGIIPHHSCLGHVRFNNVTFSYPTRPGQVVLHNFNLNLPPSQTIAIVGLSGGGKSTVAALLERFYDPASGSITLDGKDLRTLDPSWLRGRVIGFINQEPVLFGTTIIENIRFGKPGATDDEVYAAARLANADDFIRSFPDGYNTVVGERGATLSGGQKQRVAIARALIKQPAVLVLDEATSALDAEAEGAVQEALERAAHGRTVLVIAHRLSTVAGANLICVVAGGTVQEMGTHAELLKKGGLYAELIRRQ 620          

HSP 2 Score: 271.937 bits (694), Expect = 3.634e-78
Identity = 181/514 (35.21%), Postives = 282/514 (54.86%), Query Frame = 2
Query: 2555 GEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRG----VSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGAL---IFGAMNLGKSMA-MAPNFG---KGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLR-QLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMI---SLQSHK 4051
            GE++    R   FEA+++QD+A+FD  +N  G L  RL+ +  + +     V  + L +V   +  + +   IS      + +V+ A V     GG L    ++  S   +  + ++  +A E + N+RTV     E +  + Y   + K                GL+   + C    T  + G L       M    +S G L   +  +  + +SMA ++  FG   +G  A A +FE ++  P I      G ++   +  G ++  NV FSYP RP  ++L++ + N+  +QTIA+VG SG GKST+  LL+RFYD  +G+I +D   ++ ++   LR ++   ++QEP LF  +I ENI +G      TDD++ AAA+ +N  DFI + PD Y T VGE+G+  SGGQKQR+AIARAL++ P +L+LDEATSALD E+E  VQ+AL++A  GRT +VIAHRLST+  A+ I V   G + E GTH ELL K G+Y+++I   +++ HK
Sbjct:  130 GERIAASMRKSLFEALIRQDVAFFD--ANRTGHLVNRLTSDVQEFKSSFKLVISQGLRSVTQTVGCVASLYLISPKLTGLMVVVMTAMVG----GGALIGSFLRKLSRRAQEQISKATGVADETLGNVRTVRAFAMEDSKSEQYAVEVDKSCKMNEDLGIGIAIFQGLSNIVLNCIVLGTIFVGGSL-------MAGEELSPGELMSFLVASQTVQRSMASVSILFGQMVRGLSAGARLFEYMELEPSIPV--RGGGIIPHHSCLGHVRFNNVTFSYPTRPGQVVLHNFNLNLPPSQTIAIVGLSGGGKSTVAALLERFYDPASGSITLDGKDLRTLDPSWLRGRVIGFINQEPVLFGTTIIENIRFGKPGA--TDDEVYAAARLANADDFIRSFPDGYNTVVGERGATLSGGQKQRVAIARALIKQPAVLVLDEATSALDAEAEGAVQEALERAAHGRTVLVIAHRLSTVAGANLICVVAGGTVQEMGTHAELLKKGGLYAELIRRQNMEQHK 626          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Match: MDL1 (Mitochondrial inner membrane half-type ABC transporter; mediates export of peptides generated upon proteolysis of mitochondrial proteins; plays a role in the regulation of cellular resistance to oxidative stress [Source:SGD;Acc:S000004178])

HSP 1 Score: 256.914 bits (655), Expect = 1.269e-72
Identity = 189/562 (33.63%), Postives = 295/562 (52.49%), Query Frame = 1
Query:  520 DMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVS----VTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWY-ACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFN----EARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRY---GRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVE-GRTTIIVAHRLSTVRNA-HVIFGIKDGKVQEQGTHAELMA-----LNGLYKDLVDRQ 2148
            D E    NK Y FT              +QF     A+FI+  V+    +    +T +  ++ +R    +A + Q+  + D    G L ++L  D + V   +   +    +     F+G  +++F+  WKLT V + ++P +    L+  + +  L+++   + G    +AEE L + RTI ++ GEK EV RY + +     IG+++++ +G   G    +   +       G S+I+ G+   VG++     S +M     G +   + SF     +   AAA +FE+ DR P I +     D ++  Q  I FK V FTYPTR    I   L+++I+PG+ V  VG SG GKS++  L+ R+YD N G +   D +I++ N+   R  IG V QEP+LF  +I +NI Y     +   D+ I +A+  AN   F+   P+ L T+VG RG QLSGGQKQRIA+ARA + +P +L+LDEATSALDS+SE+IV   L + VE G TTI +AHRLST++++  VI   K G V E G+  +L+A     LN L  +  D +
Sbjct:  138 DEEGSKSNKLYGFT-------------KKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL-SWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGS-MTVGEL----SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLI-RPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQQDEE 679          

HSP 2 Score: 226.483 bits (576), Expect = 2.674e-62
Identity = 164/522 (31.42%), Postives = 273/522 (52.30%), Query Frame = 2
Query: 2471 RTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLT-----QAAIFCAYAATFML-AGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPIN-SFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIF-TDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALD-KAQEGRTCVVIAHRLSTIQNADKILVF-KDGKIAESGTHFELLS 4006
            + +  AL  + ++  V++  + +    +GE+L  R R+ T +A L QD  + D  +N +G L +RLS +A+ +     +++     AI        +     W+++ V++   P +    ++  R ++  S   + ++    K+A E +   RT+     E   ++ Y + ++ +     K+A   G  +G T      A +      T M+ +G + +  +S      +  G+ +FG  +    +       KG  AAA +FEL DR P I  +   D V L  +     I  +NV F+YP RP   I  D++  I   + +  VGPSG GKSTI  LL R+YD  +G+I   +  I++ N++  R+L   V QEP LF+ +I +NI Y    +I   DD+I  A   +N   F+ N PD  +T VG +G+  SGGQKQRIA+ARA L +P +L+LDEATSALD++SE+IV   L  + + G T + IAHRLSTI+++ +++V  K G + E+G+  +L++
Sbjct:  153 KQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLD--TNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELM------KGAGAAARVFELNDRKPLIRPTIGKDPVSLAQK----PIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIA 662          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Match: MDL2 (Mitochondrial inner membrane half-type ABC transporter; required for respiratory growth at high temperature; localizes to vacuole membrane in response to H2O2; similar to human TAP1 and TAP2 implicated in bare lymphocyte syndrome and Wegener-like granulomatosis [Source:SGD;Acc:S000006191])

HSP 1 Score: 250.751 bits (639), Expect = 6.723e-70
Identity = 164/489 (33.54%), Postives = 250/489 (51.12%), Query Frame = 1
Query:  670 ITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFN----EARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG-RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIV--AHRLSTVRNA-HVIFGIKDGKVQEQGTHAELMA 2112
            I S+  ++ +R    +  + Q+  +FD    G L ++L  D   V   +  K+   ++   C + G+ +      +L+++ L  +P ++    +  K +   ++   EA G+   +AEE L  I+T+ SF  E  E++RY   + +  ++G   +            L   S+     YG+ L+ +     +GD+     + ++ T   G A   + +F     +   AA+ +FE+ DR P I      G K    +G I FK V F+YPTR    I   L+  I PG +V +VG SG GKS++  L+ R+Y+   G + ID+ +I  LN   LR  IG+V QEPVL   +I++NI YG     T EEI           FI   PN  DT++G  GT LSGGQKQRIAIARAL++ P IL+LDEATSALD ESE  +     ++++ ++  IV  AHRLST+R + +VI    DG V E G   EL A
Sbjct:  194 ILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQ-LSIGDLT----AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT--VGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675          

HSP 2 Score: 217.238 bits (552), Expect = 9.077e-59
Identity = 169/497 (34.00%), Postives = 259/497 (52.11%), Query Frame = 2
Query: 2558 EQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQI-RGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVP-IIFVGGIL--QIRIMQGFSNSDKGALEESG---KIAVECIENIRTVSNLTREHTFIQHYKEAIKKL--DGEVSKKAHAQGF----LYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGR--TCVVIAHRLSTIQNADKILVF-KDGKIAESGTHFEL 4000
            E++  R R+   +  L QD  +FD  ++ +G L +RL  +A  + R ++ +    V   IC +   V +      Q+S+++L F P ++F   +   QIR      N+ K   E +G   ++A E +  I+TV +   E   +  Y  AI+ +   G+ +   +A+ F    L G        AY +  +L   L + +++         G  +FG       +       +G  AA+ +FEL DR P I+         D     G I+ ++V FSYP RP++ I  +++F I    ++ +VGPSG GKSTI  LL R+Y+   G I IDN  I  +N ++LR+   IV QEP L S +IR+NI YG +    T ++I + AK    H+FI   P+ Y+T +G  G+  SGGQKQRIAIARAL++ P IL+LDEATSALD ESE  +     +  + +  T V IAHRLSTI+ ++ ++V   DG + E G   EL
Sbjct:  197 ERVVARLRANVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGV-VGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIR------NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM------QGAGAASRLFELTDRKPSISPTVGHKYKPD----RGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Match: STE6 (Plasma membrane ATP-binding cassette (ABC) transporter; required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport; contains 12 transmembrane domains and two ATP binding domains; expressed only in MATa cells; human homolog ABCB1 mediates multidrug resistance in many chemotherapy-resistant tumors by effluxing toxic compounds from the cell [Source:SGD;Acc:S000001692])

HSP 1 Score: 211.846 bits (538), Expect = 2.204e-55
Identity = 159/591 (26.90%), Postives = 286/591 (48.39%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSAD---IRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVIT--AICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL---YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGD-----------------IKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            + LG + ++  GA  P FS  F FLL  +  P+ + ++     +  + + + G+A    + +  +        E      R+   E + ++++ WF   +N    ++  + ++   +R +  E L A+ +   + ++G   A+  G  W++SLV ++  P+I +   +   I+Q      K ++ +      + + NI+T+  L  E  F   Y +   K+    SK+A A GF   +T   + C  A  +     L++   Y   +M   F      I    +L   ++  P+  +G+ AA+ ++ +LD              L+VEN +                   + I+N+ F+YP  P   +  +++F++   QT+ ++G SG GKST++ LL + Y+   G I ID   + D N+ +LR+  S+V Q+P LF+ +IR+N+ YG   +I  + ++  A K   IHDF+++ P   +T++    +  SGGQ QR+ IARALLR  +IL+LDE TSALD+ S  I+ + + K       +VI H    +++ + I V KDGK+ E G    L +  G   Q++S QS
Sbjct:  717 LILGLLCSLIAGATNPVFSYTFSFLLEGIV-PSTDGKTGSSHYLAKWSLLVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLVSEFLSAMTSFVTVSTIGLIWALVSG--WKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSL---VSQIPDISRGQRAASWIYRILDEKHN---------TLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEIL-EIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGELFQIVSNQS 1289          

HSP 2 Score: 201.06 bits (510), Expect = 5.104e-52
Identity = 147/508 (28.94%), Postives = 251/508 (49.41%), Query Frame = 1
Query:  646 YVSVTFFVITSQHQISAIRNAFFRAVMRQN-IGWFDAQNS--GALT--NKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIID----RVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDV-------TDEE---IDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMA 2112
            ++S+T ++   + Q   IR+    A + +  + W+D      G  T  N+ V+++ +  A       Q +      +G    +F   W LTL+ L  SP+I    ++ S+ +   ++K +    KA  +    + + + +  +  ++ E  ++ E +       I+         G++  L    +  GFW+G+++I++G    + D++  F SC+M  + +      +    +   A  +I  ++     R P ++K       L+     +TF  V F+YP+R    +L  +SL+   GQ   +VG SG GKS+L  L+ RFYD   G + I+  NI+ ++   L E I VV Q   LF  ++++NI  G  D        T+E    I  A  MA    FI  LP+ L+TL+G  G  LSGGQ+QR+AIARA +R+  IL LDEA SALD     ++  A+    +G+TTII+ H LS + +   ++ +K+G+V E GT +EL+A
Sbjct:   90 WLSLTSWMHIGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDFTQINRCVEELRSSSAEASAITFQNLVAICALLGT---SFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKKGK-LNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLA 592          

HSP 3 Score: 200.29 bits (508), Expect = 7.624e-52
Identity = 147/528 (27.84%), Postives = 266/528 (50.38%), Query Frame = 1
Query:  616 GIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGA--LTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASL--IREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDR---VPEIDKMNEE--GDKLNDFQGK-----ITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD-VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKN 2154
            G+A A  I ++         S++ +  +RN     + R+N+ WF  +N+ A  ++  +++D+  + + + + +  M  +      G+I A V GWKL+LV +S+ PLIII   +    + K       +  +      +++ +I+TI   + E +    Y +   +  +I  +++I TG  + +   ++    A+ ++YG  L  I E     +     +    +M+ T +    P +   +  + AA+ I+ I+D      E++  N    G   + + GK     ++ + + F YP+     +   ++  +  GQT+ ++G SG GKS+L+ L+ + Y+   G++ ID T++ D N+  LR++I VV Q+P+LF  +I++N+ YG  D + + E+  AL       F+ + P  LDT +    T LSGGQ QR+ IARAL+R  KIL+LDE TSALDS S  I+ + + K      T+++ H    +R+ + I  +KDGKV E+G    L    G    +V  Q +
Sbjct:  768 GVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDI---SRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGELFQIVSNQSS 1290          

HSP 4 Score: 192.971 bits (489), Expect = 1.221e-49
Identity = 141/496 (28.43%), Postives = 243/496 (48.99%), Query Frame = 2
Query: 2555 GEQLTKRCRSITFEAMLKQD-IAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELL---DRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDD--------QIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLS 4006
            GE+   R RS   EA L++  + W+D     +G  T +++    ++R  S E+       + ++ A +  SF + W ++L++L   PII    ++  R++  +S  +     ++ ++    +   + V     +    + +KE I   +    K         G+ +      +   F     ++      + +V   F + I     L  ++       KG +A   +  LL    +  P+N        LD    + D+   NV FSYP RP+  +L +VS N ++ Q   +VG SG GKST+  LL RFYD  NG+I I+ + I+ I+ + L +  ++V Q  TLF+ ++R+NI  G +  +   D         I  A + + +  FI++LPD  ET +G  G   SGGQ+QR+AIARA +R+  IL LDEA SALD     ++  A+   ++G+T +++ H LS I++ D + + K+G++ ESGT  ELL+
Sbjct:  100 GERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDFT-QINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYA--TSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLA 592          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 199.904 bits (507), Expect = 1.506e-53
Identity = 137/427 (32.08%), Postives = 223/427 (52.22%), Query Frame = 1
Query:  871 ILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKL--NDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEK-IVQDALDKVVEG-RTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNG-LYKDL 2136
            IL +  G     +T S   L  I  +  +       + A++A  KA  +A + L +   +  F  EKY   +Y  +L       I+ S     L      +   +     + G + +  GN   VGD++++       +  +           ++      +F++  R  E+   N E   +   +    ITF+ V F Y    D  IL   S +I  G   A+VG+SG GKS++++L+ RFYD   G +LI+  +IK+ ++  LR+ IGVV Q+  LF  +I EN+++GR+D TDEE+   +  A     I  LP   DT+VG+RG  +SGG+KQR+AIAR L++N +I+  DEATSALD+ +E+ +++   D    G RT++ +AHRL T+ +A  I  + +G+V+E+G H EL+A+ G LY++L
Sbjct:  249 ILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGN-LTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKL--RKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGSLYREL 670          

HSP 2 Score: 184.111 bits (466), Expect = 2.346e-48
Identity = 157/515 (30.49%), Postives = 254/515 (49.32%), Query Frame = 2
Query: 2528 LQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFG---FCWQISLVVLAFVPIIFVGGILQIRIM---QGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFG-AMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEK-IVQDALDKAQEG-RTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNG-IYSQMISLQ 4042
            L+N  F    +   +     TF+ ++K D+ W    S   G LT R  D  T  +G+S + L A++  I  +   +++  G   + +  S   + F  ++    I  I+       F      A  ++  +A++ + N   V     E      Y  ++        K + +  FL    Q  IF       M  G   +   +      +    L+F  ++ L    ++  +  +  I    +F+L  R   +   + +  ++  EN+  DI  ENV F Y   P+  IL + SF I +    A+VG SG GKSTI+ L+ RFYD  +G ILI+   IK+ +I  LR++  +V Q+  LF+ +I EN+ +G      TD+++I   + + +   I  LP  ++T VGE+G   SGG+KQR+AIAR LL+N RI+  DEATSALDT +E+ +++   D    G RT V IAHRL TI +ADKI+V  +G++ E G H ELL+  G +Y ++ ++Q
Sbjct:  174 LRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGW--HLSRQTGGLT-RAMDRGT--KGIS-QVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYS-IFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS-GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKL--RKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDA--TDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGSLYRELWTIQ 674          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 141.354 bits (355), Expect = 1.026e-33
Identity = 89/234 (38.03%), Postives = 148/234 (63.25%), Query Frame = 2
Query: 3317 GDIKIENVKFSYPLRPNI-IILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLP-DQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKN 4012
            GDIK  N    Y  RP + ++L  ++ +I  N+ + +VG +G GKS++   L R  +   GNI+IDN  I +I + +LR   SI+ Q+  +F  ++RENI   D    +TD+ I  A + S++ + ++++  D  + ++ E G N S GQ+Q + +ARA+L   +IL+LDEAT+A+D E++K+VQ+ +  A + RT + IAHRL+TI ++D+I+V  +GK+AE  +  +LLS N
Sbjct: 1270 GDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENI---DPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDN 1498          

HSP 2 Score: 134.035 bits (336), Expect = 1.971e-31
Identity = 78/232 (33.62%), Postives = 140/232 (60.34%), Query Frame = 1
Query: 1426 QGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNK-LDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALN 2118
            QG I F      Y    D  +L  +++ I+P + V +VG +G GKSSL   + R  +++EG ++ID+  I ++ +  LR ++ ++ Q+  +F  +++ENI       TDE I +AL +++ K  + ++ N  LD  + + G  LS GQ+Q + +ARA++   KIL+LDEAT+A+D E++K+VQ+ +    + RT + +AHRL+T+ ++  I  + +GKV E  +  +L++ N
Sbjct: 1269 QGDIKFNNYSTRYRPELDL-VLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDN 1498          

HSP 3 Score: 74.3294 bits (181), Expect = 2.690e-13
Identity = 69/276 (25.00%), Postives = 128/276 (46.38%), Query Frame = 1
Query: 1315 MGSFNEARSAAAEIFEII-------DRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPI-LTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTF-INALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSE-SEKIVQDAL--DKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAEL 2106
            + SF EA  +   +F          D V  + K+   GD   +     TF + +     + +  + L  ++   + G    +VG  G GK++L+  M           L D   +K    +     +  VSQ P +   ++KENI +G     D E  +  + A A T  +  L +   TLVG++G  LSGGQK R+++ARA+       LLD+  +A+D   +  +++  L  + ++  +T ++  +++S +  A  I  + +G++ +QGT+ E+
Sbjct:  585 LNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQR-----KPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCM-----------LGDLFRVKGFATV--HGSVAYVSQVPWIMNGTVKENILFGHR--YDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEI 840          

HSP 4 Score: 65.855 bits (159), Expect = 8.373e-11
Identity = 58/236 (24.58%), Postives = 111/236 (47.03%), Query Frame = 2
Query: 3317 GDIKI---ENVKFSYPLRPNI-IILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKI-FTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTE-SEKIVQDAL--DKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFEL 4000
            GD+ I   ++  F +  +P   + L +++F         +VG  G GK+ ++  +               +  +      +    + VSQ P + + +++ENI +G      F +  I A A   ++      L D  +T VGEKG + SGGQK R+++ARA+       LLD+  +A+D   +  +++  L  +     +T V+  +++S +  AD I +  +G+I + GT+ E+
Sbjct:  622 GDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCM-------------LGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDL----AILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEI 840          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Match: EDO49737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK3])

HSP 1 Score: 532.332 bits (1370), Expect = 1.070e-161
Identity = 272/520 (52.31%), Postives = 363/520 (69.81%), Query Frame = 1
Query:  589 MSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            M+ ++  +  +A+   I++Y+   FF  T+  Q   IR  FF+AVMRQ+IGWFD  ++G L N+L +DI+ V  G+G K+G ++Q+   F+ G I+ F   WKLTLV L+++PL++I   ++ K +   T K  EAY KAG IAEEVL SIRT+ +F GEK E  RY  +L EA   G++K + TG   G    +MFGSY+L FWYGA L+ +      GD+L+VFFS ++  T +GQA P++ +   AR AA E++ IIDR P ID  +EEG K    +G I F  + F YP+R D  +L GL L+I+ GQTVALVG SGCGKS+LI+L+QRFYD  EG V +D  +I+ LN+ WLR+ IGVVSQEP+LF  ++ ENIRYGR  +T  EI++A  MANA  FI  LP   +T+VG+RG Q+SGGQKQRIAIARALV+NP +L+LDEATSALD+ESEKIVQ ALDK  EGRTT+++AHRLST+RNA VI  I+DG V E+G+H ELMA +GLY+ L+  Q
Sbjct:    1 MTDLAIYYIYLAIGALIVAYLQAGFFQYTAVRQAKRIRCNFFKAVMRQDIGWFDTYDAGELNNRLTEDISKVVDGLGSKVGLVVQFTTTFLAGFIMGFAYSWKLTLVILALTPLMVIAGGIMGKVISVFTSKELEAYAKAGAIAEEVLSSIRTVAAFGGEKKECERYNSHLGEAQAFGVKKGLSTGLGFGFFQLIMFGSYSLAFWYGAVLVAD-KAINSGDLLVVFFSVMVGATQLGQAGPNIEAIATARGAAYELYSIIDRQPPIDSSSEEGLKPASVKGDIDFTDIHFQYPSRPDVKVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRFYDPAEGTVCMDGIDIRSLNLKWLRQHIGVVSQEPILFATTVAENIRYGREGITQAEIEKATKMANAHDFIRNLPQGYNTVVGERGAQMSGGQKQRIAIARALVKNPTLLILDEATSALDTESEKIVQAALDKASEGRTTLVIAHRLSTIRNATVIAAIQDGVVVEKGSHNELMATDGLYRQLITLQ 519          

HSP 2 Score: 489.189 bits (1258), Expect = 7.114e-147
Identity = 252/578 (43.60%), Postives = 375/578 (64.88%), Query Frame = 2
Query: 2309 FKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
             +V+ +N+ +   + +G +SA+ NG +  SF++L G +L      N ++   +   + +    +   +F + + QN  F  SGE LT + R ++F+++L+Q++A+FD+P +  GALTT L+  A+ ++G +G  LG +   + ++ A+   +F   W++SLVV AF+P I + G L ++   G  +  K    ESGKIAVE  EN+RT++ L REHTF +HY  +I        ++AH  G  YGLT+A +F   AA F    YL++     M  V      ++   +  G+  +++P++ K + AA  +F+LLDR P I+S S +G  L    + G +++ +V+F YP RPN+ +L  +S  +N  QT+ALVGPSGCGKST + LL+RFYD  +G + IDN  ++ +N++ LR    IVSQEP LF YSI +NIAYGD+++  +  +I  AAKA+NIH+FI  LP  Y+T+VG+KG+  SGGQKQRIAIARAL+RNP ILLLDEATSALDTESEK+VQDALD A EGRT ++IAHRLST++NAD I V   G++AE GTH EL++ NGIY+ +++ Q
Sbjct:  537 LRVLRMNSDQWPVMVVGVISALINGLLPMSFALLLGEILNVFTLVNTDEMKKEATFWALMFLVMGGASFFTQIFQNYMFAISGEALTVKIRRLSFKSLLRQEMAFFDDPFHTTGALTTALATHASDVKGAAGSRLGTLALGLSTVVASAIYAFYNGWKLSLVVCAFIPFIVLAGALHMKAFTG-DHGGKDDYIESGKIAVEAFENVRTIATLGREHTFFEHYSRSIDGPHKVAVRRAHLSGASYGLTEAIMFLCNAACFRFGAYLIVQGEMDMPRVMKVVMCIVIAGLVAGQISSLSPDYQKARTAAGKIFKLLDRTPAIDSASENG--LQPAAVRGTVQVRSVRFKYPTRPNVKVLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDGEMAIDNANVRQLNLKWLRSKIGIVSQEPVLFGYSIAQNIAYGDNSREVSMAEIETAAKAANIHNFICGLPKGYDTEVGDKGTLISGGQKQRIAIARALIRNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEQGTHQELMAMNGIYTGLVTAQ 1111          

HSP 3 Score: 393.275 bits (1009), Expect = 2.532e-114
Identity = 230/538 (42.75%), Postives = 324/538 (60.22%), Query Frame = 1
Query:  574 NIFTLMSG--MSQQFAGIALAMFIM---SYVSVTF----FVITSQHQISAIRNAFFRAVMRQNIGWFDA--QNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            N+FTL++   M ++    AL   +M   S+ +  F    F I+ +     IR   F++++RQ + +FD     +GALT  L    + V    G ++G +    +  +   I AF  GWKL+LV  +  P I++   +  K          + Y ++G IA E   ++RTI +   E      Y+ ++D   K+ +R++ L+G   GL   +MF   A  F +GA LI +G   +   M +V    ++A    GQ +     + +AR+AA +IF+++DR P ID  +E G +    +G +  + V+F YPTR +  +L GLSL +  GQT+ALVG SGCGKS+ + L++RFYD  +GE+ ID+ N++ LN+ WLR +IG+VSQEPVLFG SI +NI YG    +V+  EI+ A   AN   FI  LP   DT VGD+GT +SGGQKQRIAIARAL+RNP ILLLDEATSALD+ESEK+VQDALD   EGRT I++AHRLSTV+NA VI  I  G+V EQGTH ELMA+NG+Y  LV  Q
Sbjct:  576 NVFTLVNTDEMKKEATFWALMFLVMGGASFFTQIFQNYMFAISGEALTVKIRRLSFKSLLRQEMAFFDDPFHTTGALTTALATHASDVKGAAGSRLGTLALGLSTVVASAIYAFYNGWKLSLVVCAFIPFIVLAGALHMKAFTGD-HGGKDDYIESGKIAVEAFENVRTIATLGREHTFFEHYSRSIDGPHKVAVRRAHLSGASYGLTEAIMFLCNAACFRFGAYLIVQGEMDMPRVMKVVM-CIVIAGLVAGQISSLSPDYQKARTAAGKIFKLLDRTPAIDSASENGLQPAAVRGTVQVRSVRFKYPTRPNVKVLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDGEMAIDNANVRQLNLKWLRSKIGIVSQEPVLFGYSIAQNIAYGDNSREVSMAEIETAAKAANIHNFICGLPKGYDTEVGDKGTLISGGQKQRIAIARALIRNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEQGTHQELMAMNGIYTGLVTAQ 1111          

HSP 4 Score: 372.859 bits (956), Expect = 1.667e-107
Identity = 211/532 (39.66%), Postives = 318/532 (59.77%), Query Frame = 2
Query: 2465 DIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ---SHK 4051
            D+  Y I LA   + A + + LQ   F  +  +  KR R   F+A+++QDI WFD  + + G L  RL+++ +++    G  +G V+    +  A   + F + W+++LV+LA  P++ + G +  +++  F++ +  A  ++G IA E + +IRTV+    E    + Y   + +      KK  + G  +G  Q  +F +Y+  F     L+        ++ + F +++ GA  LG++          + AA  ++ ++DR PPI+S S +G  L   ++ GDI   ++ F YP RP++ +L  +   I S QT+ALVG SGCGKST+I L+QRFYD   G + +D   I+ +N++ LRQ   +VSQEP LF+ ++ ENI YG      T  +I  A K +N HDFI NLP  Y T VGE+G+  SGGQKQRIAIARAL++NP +L+LDEATSALDTESEKIVQ ALDKA EGRT +VIAHRLSTI+NA  I   +DG + E G+H EL++ +G+Y Q+I+LQ   +HK
Sbjct:    3 DLAIYYIYLA---IGALIVAYLQAGFFQYTAVRQAKRIRCNFFKAVMRQDIGWFD--TYDAGELNNRLTEDISKVVDGLGSKVGLVVQFTTTFLAGFIMGFAYSWKLTLVILALTPLMVIAGGIMGKVISVFTSKELEAYAKAGAIAEEVLSSIRTVAAFGGEKKECERYNSHLGEAQAFGVKKGLSTGLGFGFFQLIMFGSYSLAFWYGAVLVADKAINSGDLLVVFFSVMVGATQLGQAGPNIEAIATARGAAYELYSIIDRQPPIDSSSEEG--LKPASVKGDIDFTDIHFQYPSRPDVKVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRFYDPAEGTVCMDGIDIRSLNLKWLRQHIGVVSQEPILFATTVAENIRYGREG--ITQAEIEKATKMANAHDFIRNLPQGYNTVVGERGAQMSGGQKQRIAIARALVKNPTLLILDEATSALDTESEKIVQAALDKASEGRTTLVIAHRLSTIRNATVIAAIQDGVVVEKGSHNELMATDGLYRQLITLQGKHNHK 525          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Match: EDO48846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHG7])

HSP 1 Score: 476.863 bits (1226), Expect = 1.135e-145
Identity = 252/587 (42.93%), Postives = 382/587 (65.08%), Query Frame = 2
Query: 2300 AGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTY----VIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALE--ESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            A F +++ LN+PE  +I +G +SA+ NG +   F++  G +L      + + ++ +  T+     +A+ GI+   F + + QN  F  SGE LT R R ++ +A+L+Q+IA+FD+P ++ GALTT L+   + ++G +G  LG + T I ++ A+   +    W+++L VLAFVP + +G  L+I+   G++    G  +  ESGK+AVE  EN+RT++ L RE TF + Y + + +       +AH  G  YG+T+A ++  +AA F    +L++     M  V      ++   M  G+  A +P++ K K+A A +F+L+DR+P I+S S +G  L    + G +++ +++F YP RP++ +L  +S  +   QT+ALVGPSGCGKST + LL+RFYD   G + +DN  ++ +NI+ LR    IVSQEP LF YSI +NIAYGD+++  +  +I  AA+A+NIHDFI  LP  YET+VG+KG+  SGGQKQRIAIARAL++NP ILLLDEATSALDTESEK+VQDALD A EGRT ++IAHRLST++NAD I V   G++AE GTH EL++ NGIY+ +++ Q
Sbjct:  264 APFLRILKLNSPEWVFIAIGALSAMANGFLPLGFALCLGEILTVFTITDQKDKAKEEATFWALMFLAMGGIS---FFTQLFQNYMFALSGEALTVRLRRMSLKALLRQEIAFFDDPMHSTGALTTALATHTSDVKGAAGSRLGTIATGISTVIASAIYASINGWKLTLAVLAFVPFLAIGRALEIK---GYTGDTGGQNDYIESGKVAVEAFENVRTIAILGREKTFFERYAQTLVRPHRAAVVRAHLFGAGYGVTEAIMYFCFAACFRYGAHLMVEKEMTMEEVMKVVMCIMIAGMVAGELFAFSPDYLKAKVAGARIFKLVDRIPVIDSASDEG--LTPSTVQGTLQMRSLRFRYPARPDVKVLRGLSLEVKQGQTLALVGPSGCGKSTTVSLLERFYDPEEGKVAVDNRDVRQLNIKWLRSKIGIVSQEPVLFGYSIAQNIAYGDNSREVSMKEIETAARAANIHDFISGLPKGYETEVGDKGTLLSGGQKQRIAIARALVKNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEHGTHQELMAMNGIYTGLVTAQ 842          

HSP 2 Score: 378.637 bits (971), Expect = 6.887e-112
Identity = 218/516 (42.25%), Postives = 312/516 (60.47%), Query Frame = 1
Query:  625 LAMFIMSYVSVTF----FVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            LAM  +S+ +  F    F ++ +     +R    +A++RQ I +FD    ++GALT  L    + V    G ++G +    +  I   I A + GWKLTL  L+  P + I   +  K     T   ++ Y ++G +A E   ++RTI     EK    RY + L    +  + ++ L G   G+   +M+  +A  F YGA L+ E     + +++ V    ++A    G+       + +A+ A A IF+++DR+P ID  ++EG   +  QG +  + ++F YP R D  +L GLSL ++ GQT+ALVG SGCGKS+ + L++RFYD  EG+V +D+ +++ LN+ WLR +IG+VSQEPVLFG SI +NI YG    +V+ +EI+ A   AN   FI+ LP   +T VGD+GT LSGGQKQRIAIARALV+NP ILLLDEATSALD+ESEK+VQDALD   EGRT I++AHRLSTV+NA VI  I  G+V E GTH ELMA+NG+Y  LV  Q
Sbjct:  329 LAMGGISFFTQLFQNYMFALSGEALTVRLRRMSLKALLRQEIAFFDDPMHSTGALTTALATHTSDVKGAAGSRLGTIATGISTVIASAIYASINGWKLTLAVLAFVPFLAIGRALEIKGYTGDTGGQND-YIESGKVAVEAFENVRTIAILGREKTFFERYAQTLVRPHRAAVVRAHLFGAGYGVTEAIMYFCFAACFRYGAHLMVEKE-MTMEEVMKVVMCIMIAGMVAGELFAFSPDYLKAKVAGARIFKLVDRIPVIDSASDEGLTPSTVQGTLQMRSLRFRYPARPDVKVLRGLSLEVKQGQTLALVGPSGCGKSTTVSLLERFYDPEEGKVAVDNRDVRQLNIKWLRSKIGIVSQEPVLFGYSIAQNIAYGDNSREVSMKEIETAARAANIHDFISGLPKGYETEVGDKGTLLSGGQKQRIAIARALVKNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEHGTHQELMAMNGIYTGLVTAQ 842          

HSP 3 Score: 259.996 bits (663), Expect = 5.984e-72
Identity = 124/196 (63.27%), Postives = 157/196 (80.10%), Query Frame = 1
Query: 1561 SSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            S++I+L+QRFYD   G V +D T+I+ LN+ WLR++IGVVSQEP LF  +I ENIRYG+  VT  EI+QA  MANA  FI  LP   +T+VG++G+QLSGGQKQR+AIARALVRNP+IL+LDEATSALD+ESE++VQ ALDK  EGRTT+++AHRLSTVRNA +I  I +G V E G+HAELMA +G+Y+ LV  Q
Sbjct:    1 STVIKLIQRFYDPENGSVCLDGTDIRSLNLHWLRQRIGVVSQEPALFATTIAENIRYGQDGVTQAEIEQAAKMANAHDFITKLPKGYETVVGEQGSQLSGGQKQRVAIARALVRNPRILILDEATSALDTESERVVQAALDKAREGRTTLVIAHRLSTVRNADMIAAIHNGVVVETGSHAELMATDGVYRQLVTLQ 196          

HSP 4 Score: 225.328 bits (573), Expect = 1.552e-60
Identity = 116/199 (58.29%), Postives = 151/199 (75.88%), Query Frame = 2
Query: 3449 STIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQS 4045
            ST+I L+QRFYD  NG++ +D   I+ +N+  LRQ   +VSQEP LF+ +I ENI YG      T  +I  AAK +N HDFI  LP  YET VGE+GS  SGGQKQR+AIARAL+RNPRIL+LDEATSALDTESE++VQ ALDKA+EGRT +VIAHRLST++NAD I    +G + E+G+H EL++ +G+Y Q+++LQ+
Sbjct:    1 STVIKLIQRFYDPENGSVCLDGTDIRSLNLHWLRQRIGVVSQEPALFATTIAENIRYGQDG--VTQAEIEQAAKMANAHDFITKLPKGYETVVGEQGSQLSGGQKQRVAIARALVRNPRILILDEATSALDTESERVVQAALDKAREGRTTLVIAHRLSTVRNADMIAAIHNGVVVETGSHAELMATDGVYRQLVTLQA 197          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Match: EDO41930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S348])

HSP 1 Score: 355.525 bits (911), Expect = 3.288e-104
Identity = 203/530 (38.30%), Postives = 304/530 (57.36%), Query Frame = 1
Query:  637 IMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILT------------------GLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKR 2172
            I + +    F +  Q  ++ IR   F A+++Q + +FD   +G L N+L  D   +   +   +  ++++    IG ++  F    KLT V +S+ P++ +      + +  L +K  +  G A  +AEE +GSIRT+ SF  EK  +  Y E + E+  +G R +I +G   G+VM +   +  L  WYG  L+ EG    VG +       +         +   G F +A  A+  +FE++DRVP+I KM E G  L  F+  I F  V+F+YP+R D  +L                    LS  I PG+TVALVG SG GKS++I L++RFYD   G + I DT+I  L++ W R++I +VSQEPVLF  +I  NI YGR D + EEI++A   ANA  FI    +   T VG+RG +LSGGQKQR+AIARAL+ +P+ILLLDEATSALD+ESE  V++A+D+ +  RT +++AHRLSTVR+A+++  +  GK+ E+G H  L+A  G+Y+ LV RQ +    +R
Sbjct:  277 IAAMIRAWLFTLAGQRLVARIRRELFNAIIKQEVAFFDTNRTGELINRLSSDTQVIQNAVTVNVSMLLRYIVQIIGSLVFMFTLSAKLTGVLISVIPIVGVGAQKYGQFVQGLRKKFQDELGNASTVAEESIGSIRTVRSFSQEKKTMKLYAEAIHESYLVGARLAIASGAFSGVVMAVGQAAIVLVLWYGGKLVNEGE-MNVGILTAFALYTVNVAMAFAFLSSLYGDFMQAVGASFRMFELMDRVPKI-KM-EGGVILPSFKEPIVFDDVRFSYPSREDTEVLKIEEAARQANAHDFITTFEALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGNIRIGDTDISLLDLAWYRKKIALVSQEPVLFATTIASNIAYGR-DASQEEIEEAARQANAHDFITTFEDGYKTQVGERGVKLSGGQKQRVAIARALLMDPEILLLDEATSALDAESEHFVKEAIDRAMVNRTVLVIAHRLSTVRSANLVLVMDKGKIVERGNHDSLLAKGGVYRKLVLRQLSASKNER 802          

HSP 2 Score: 301.982 bits (772), Expect = 4.555e-86
Identity = 206/593 (34.74%), Postives = 325/593 (54.81%), Query Frame = 2
Query: 2324 LNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGAL--IFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILN------------------DVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            L  PE   +F+  ++ + +   Q +    FG ++ +   P +   +  I T    L G+ V   ++++++   F  +G++L  R R   F A++KQ++A+FD  +N  G L  RLS +   I+     ++  ++  I  +  ++   F    +++ V+++ +PI+ VG     + +QG     +  L  +  +A E I +IRTV + ++E   ++ Y EAI +     ++ A A G   G+  A    A        G L+  N  +M    ++  AL  +  AM      ++  +F +   A+  MFEL+DRVP I      GV+L   +    I  ++V+FSYP R +  +L                    +SF IN  +T+ALVGPSG GKST+I L++RFYD + GNI I +  I  +++   R+  ++VSQEP LF+ +I  NIAYG  A   + ++I  AA+ +N HDFI    D Y+T+VGE+G   SGGQKQR+AIARALL +P ILLLDEATSALD ESE  V++A+D+A   RT +VIAHRLST+++A+ +LV   GKI E G H  LL+K G+Y +++  Q
Sbjct:  217 LAYPELGILFIATLALMVSAGSQIAAPYFFGQVISSAIQPGMNALNRTILT----LLGLYVGGSIAAMIRAWLFTLAGQRLVARIRRELFNAIIKQEVAFFD--TNRTGELINRLSSDTQVIQNAVTVNVSMLLRYIVQIIGSLVFMFTLSAKLTGVLISVIPIVGVGAQKYGQFVQGLRKKFQDELGNASTVAEESIGSIRTVRSFSQEKKTMKLYAEAIHESYLVGARLAIASGAFSGVVMAVGQAAIVLVLWYGGKLV--NEGEMNVGILTAFALYTVNVAMAFAFLSSLYGDFMQAVGASFRMFELMDRVPKIKM--EGGVILP--SFKEPIVFDDVRFSYPSREDTEVLKIEEAARQANAHDFITTFEALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGNIRIGDTDISLLDLAWYRKKIALVSQEPVLFATTIASNIAYGRDA---SQEEIEEAARQANAHDFITTFEDGYKTQVGERGVKLSGGQKQRVAIARALLMDPEILLLDEATSALDAESEHFVKEAIDRAMVNRTVLVIAHRLSTVRSANLVLVMDKGKIVERGNHDSLLAKGGVYRKLVLRQ 794          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Match: EDO45926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRD5])

HSP 1 Score: 330.872 bits (847), Expect = 1.042e-98
Identity = 196/502 (39.04%), Postives = 292/502 (58.17%), Query Frame = 1
Query:  661 FFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGS----FNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTD--EEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            F  + S+  I  I N  F +++ Q+I +FD   +G + ++L  D   +   +   +   ++      G  I  F   W+L++VT+   PLI     +      KL+    +A  +   +A EV+ S++T+ SF  E+ E+ RY E  +E  K+ I+++++ G   G    +      +  +YG  L+ EG  +L G  L+ F   ++    +  A   +G       EA  AA ++F++IDR P I  +N         +G I FK V F+YPTR D P+L  +S  ++PGQ VALVG SG GKS+ I L++  Y+   GEVLID   +KDL+  +L  ++ +V QEPVLF  SIK+NI YG  D+ D  E ++    +ANA +F++ +P   DT  G++G QLSGGQKQRIAIARAL+RNPKILLLDEATSALD+ESE +VQDA+ K ++G T +I+AHRLST+  A +I  I  G+V E GT++ L+A +GL+  LV RQ
Sbjct:   75 FRYVASRFNIR-INNLLFGSIVNQDISFFDKTKTGEIVSRLTSDTTKMSDQVSLNVNVFLRNVFKGAGVCIFMFKLSWQLSVVTMIGLPLIAFLSEVYGNYYKKLSTAVQDAIARTNEVAAEVVSSMKTVRSFANEQGELNRYKEKNNEVFKLQIKEAVVIGGYNGCTEIMFLAMEVIILYYGGHLVLEG--YLTGGNLVSF---ILYQLELADALEEIGDVYTGLMEAVGAAEKVFKLIDREPAI--LNNGKVIPLSCEGAIEFKDVSFSYPTRPDIPVLDNVSFMVEPGQVVALVGPSGGGKSTCINLLEHLYEPTGGEVLIDAVPVKDLDHYYLHNKVSLVGQEPVLFARSIKKNIAYGVEDLADNPETVEHVSRLANAHSFVSGMPKGYDTETGEKGLQLSGGQKQRIAIARALIRNPKILLLDEATSALDAESEHLVQDAIYKNLQGHTVLIIAHRLSTIEKADLIIVIDKGQVAEIGTYSHLIAKDGLFNRLVQRQ 568          

HSP 2 Score: 276.944 bits (707), Expect = 3.251e-80
Identity = 192/588 (32.65%), Postives = 314/588 (53.40%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAI-SFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQ------AAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKI----AAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            K++    P+  Y+ L     +   A Q       G ++  +A   IE+        ++ +  I +   + +  +   F     +   R  ++ F +++ QDI++FD+     G + +RL+ + T++      ++   +  +   GA V I  F   WQ+S+V +  +P+I     +     +  S + + A+  + ++A E + +++TV +   E   +  YKE   ++     K+A   G   G T+        I   Y    +L GYL   N+       +SF   I   + L  ++    +   G +    AA  +F+L+DR P I     +G V+ + +  G I+ ++V FSYP RP+I +L++VSF +   Q +ALVGPSG GKST I LL+  Y+   G +LID   +KD++   L    S+V QEP LF+ SI++NIAYG        + +   ++ +N H F+  +P  Y+T+ GEKG   SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE +VQDA+ K  +G T ++IAHRLSTI+ AD I+V   G++AE GT+  L++K+G++++++  Q
Sbjct:    1 KLLSYLKPDMGYVALAFFFLVAACAAQIFIPYYTGLVIDGIA---IEKNKKKFEMAILTMGLICLGEAICAGFRGAIFRYVASRFNIRINNLLFGSIVNQDISFFDKTKT--GEIVSRLTSDTTKMSDQVSLNVNVFLRNVFK-GAGVCIFMFKLSWQLSVVTMIGLPLIAFLSEVYGNYYKKLSTAVQDAIARTNEVAAEVVSSMKTVRSFANEQGELNRYKEKNNEVFKLQIKEAVVIGGYNGCTEIMFLAMEVIILYYGGHLVLEGYLTGGNL-------VSF---ILYQLELADALEEIGDVYTGLMEAVGAAEKVFKLIDREPAI---LNNGKVIPL-SCEGAIEFKDVSFSYPTRPDIPVLDNVSFMVEPGQVVALVGPSGGGKSTCINLLEHLYEPTGGEVLIDAVPVKDLDHYYLHNKVSLVGQEPVLFARSIKKNIAYGVEDLADNPETVEHVSRLANAHSFVSGMPKGYDTETGEKGLQLSGGQKQRIAIARALIRNPKILLLDEATSALDAESEHLVQDAIYKNLQGHTVLIIAHRLSTIEKADLIIVIDKGQVAEIGTYSHLIAKDGLFNRLVQRQ 568          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Match: EDO39130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY5])

HSP 1 Score: 291.582 bits (745), Expect = 8.164e-84
Identity = 178/540 (32.96%), Postives = 291/540 (53.89%), Query Frame = 1
Query:  550 YNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFN----EARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRM--DVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELM-ALNGLYKDLVDRQ 2148
            Y  +     +  L+  + Q   G+ L     ++  V    ++ Q  +  +R   F +++RQ   +FD   +G L N+L  D   V   + D +   ++  A    G+ +      KLT + L I P + +  ++  + +  +T++  ++   A  +AEE + +I  + +F  E  E+  YT+ ++   ++  R+++      G           L   Y   ++       VG++     S ++ T  +G +   + SF     +   A++ ++++ DR P +         ++     I FK V FTYP+R +  I   LSL ++ G   A+VG SG GKS+L  L+ R YD   G V +   ++K L++ WLR  +G V Q+P+LF CSI ENI YG    +V+ + I  A   ANA  FI + PN  DT+VG+RG  LSGGQ+QRIAIARA+++NPKILLLDEATSALDSESE +VQ+AL+++++GRT I +AHRLST++NA  I  +  G + E G++++LM   +GL++ LV+RQ
Sbjct:  159 YTASEDPERMMNLLKTICQVLCGVFLLGGAANFGRVYLIQVSGQRIVKQLRQNLFSSILRQETAFFDRTKTGELVNRLSADTILVGKAVTDNVSDGLRAVAQVTAGVSMMAYVSPKLTGIVLLIVPPVAVGAVVYGRFLRSITKRTQDSLADATQVAEERISNIHVVRAFGQENREIKSYTDRVEYVLQLAKREALARAVFFGFTGLSGNL-IVLSVLYSGGMMMTSAQISVGELT----SFMLYTGFVGVSIAGLSSFYSELMKGIGASSRVWQLSDRKPAMSFTGGLQPSIDVLARGIQFKNVNFTYPSRPNARIFADLSLDMRAGSVTAVVGPSGSGKSTLGALLLRLYDPESGSVFVGGHDVKSLSLDWLRGAVGAVHQDPILFSCSIAENIAYGAASSEVSMDAIKDAARQANAANFIESFPNGYDTIVGERGQMLSGGQRQRIAIARAILKNPKILLLDEATSALDSESEHLVQEALERLMKGRTVITIAHRLSTIKNADNIVVLDGGSIVESGSYSQLMEEPDGLFRKLVERQ 693          

HSP 2 Score: 270.781 bits (691), Expect = 9.793e-77
Identity = 193/596 (32.38%), Postives = 330/596 (55.37%), Query Frame = 2
Query: 2294 SSAGFFKVMGLNAPEKCYIF----LGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALI-------FGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSK-NGIYSQMISLQS 4045
            S    ++++ L  PE+  I     L  VS+    AV  S   +   +  A  +P  E+    ++T    L G+ ++   ++  +      SG+++ K+ R   F ++L+Q+ A+FD      G L  RLS +   +     +++   + A+  + A V++      +++ +VL  VP + VG ++  R ++  +   + +L ++ ++A E I NI  V    +E+  I+ Y + ++ +     ++A A+   +G      F   +   ++   L    M  MT+  IS G L        F  +++    +      KG  A++ +++L DR P + SF T G+   ++ ++  I+ +NV F+YP RPN  I  D+S ++ +    A+VGPSG GKST+  LL R YD  +G++ +  + +K +++  LR     V Q+P LFS SI ENIAYG ++   + D I  AA+ +N  +FI + P+ Y+T VGE+G   SGGQ+QRIAIARA+L+NP+ILLLDEATSALD+ESE +VQ+AL++  +GRT + IAHRLSTI+NAD I+V   G I ESG++ +L+ + +G++ +++  Q+
Sbjct:  112 SRTDVYRLLNLAKPERWRIAAAIGLLLVSSTVTMAVPFSIGKIIDIIYTASEDP--ERMMNLLKTICQVLCGVFLLGGAANFGRVYLIQVSGQRIVKQLRQNLFSSILRQETAFFDR--TKTGELVNRLSADTILVGKAVTDNVSDGLRAVAQVTAGVSMMAYVSPKLTGIVLLIVPPVAVGAVVYGRFLRSITKRTQDSLADATQVAEERISNIHVVRAFGQENREIKSYTDRVEYVLQLAKREALARAVFFG------FTGLSGNLIVLSVLYSGGM-MMTSAQISVGELTSFMLYTGFVGVSIAGLSSFYSELMKGIGASSRVWQLSDRKPAM-SF-TGGLQPSIDVLARGIQFKNVNFTYPSRPNARIFADLSLDMRAGSVTAVVGPSGSGKSTLGALLLRLYDPESGSVFVGGHDVKSLSLDWLRGAVGAVHQDPILFSCSIAENIAYGAASSEVSMDAIKDAARQANAANFIESFPNGYDTIVGERGQMLSGGQRQRIAIARAILKNPKILLLDEATSALDSESEHLVQEALERLMKGRTVITIAHRLSTIKNADNIVVLDGGSIVESGSYSQLMEEPDGLFRKLVERQT 694          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Match: abcb4 (ATP binding cassette subfamily B member 1 [Source:NCBI gene;Acc:101171435])

HSP 1 Score: 553.132 bits (1424), Expect = 7.974e-175
Identity = 290/612 (47.39%), Postives = 394/612 (64.38%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +F +A   DI+M++   +M+I  G   PL+ +VFG+ T  +                          I  M+   R K         N  +L    +  ++ +   + + +Y+ V+ + I +  Q+  IR  FF  +M+Q+IGWFD   +G L  +L DD+  +  GIGDK+G ++Q  + FI   ++ F +GWKLTLV L++SP + I   + SK +   T K   AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL +A K+G++K+I     +G    +++ SYAL FWYG++LI  G  + +G +L VFF  ++    +GQ +P++ +F  AR AA +++ IID+ P ID  +E+G K +  +G I F  + FTYP+R D  IL  +SLS++ GQT+ALVG+SGCGKS+ IQL+QRFYD  EG V ID  +I+ LNV +LRE IGVVSQEP+LF  +I ENIRYGR DVT  EI+QA   ANA  FI  LPNK +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTT+IVAHRLST+RNA VI G ++GKV E GTH+ELM   G+Y+ LV  Q
Sbjct:   34 VFRFADGWDILMLVIGTVMAIANGAVLPLMCIVFGDMTDSL--------------------------INGMKGCFRAK---------NATSLFPSFAVYYSIMGAVVLVAAYLQVSLWTIAAGRQVKRIRTLFFHKIMQQDIGWFDINETGELNTRLTDDVYKIQEGIGDKVGMLIQSVSSFITAFVIGFTKGWKLTLVILAVSPALGISGALFSKVLTSFTSKEQSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTFLMIYFSYALAFWYGSTLILSGE-YTIGSVLTVFFVVIIGVFTMGQTSPNIQTFASARGAAHKVYNIIDKEPIIDSYSEDGFKPDFIKGDIEFSNIHFTYPSRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREMIGVVSQEPILFATTISENIRYGRPDVTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELMEKQGVYRMLVTMQ 609          

HSP 2 Score: 402.905 bits (1034), Expect = 1.693e-122
Identity = 226/570 (39.65%), Postives = 352/570 (61.75%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMANP-----NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            + +G V AI NGAV P   I+FG +  ++ N        +  ++   ++ +  + +  V  V++ LQ   +  +  +  KR R++ F  +++QDI WFD   N  G L TRL+D+  +I+   G+ +G +I ++ S   A  I F   W+++LV+LA  P + + G L  +++  F++ ++ A  ++G +A E + +IRTV   + ++  I+ Y + +++      KKA +     G T   I+ +YA  F     L+L     + +V   F  +I G   +G++      F   + AA  ++ ++D+ P I+S+S DG   D   + GDI+  N+ F+YP RP++ IL ++S ++ S QT+ALVG SGCGKST I LLQRFYD + GN+ ID + I+ +N++ LR++  +VSQEP LF+ +I ENI YG      T  +I  AAK +N +DFI+NLP+++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F++GK+ E GTH EL+ K G+Y  ++++Q
Sbjct:   46 LVIGTVMAIANGAVLPLMCIVFGDMTDSLINGMKGCFRAKNATSLFPSFAVYYSIMGAVVLVAAYLQVSLWTIAAGRQVKRIRTLFFHKIMQQDIGWFD--INETGELNTRLTDDVYKIQEGIGDKVGMLIQSVSSFITAFVIGFTKGWKLTLVILAVSPALGISGALFSKVLTSFTSKEQSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTFLMIYFSYALAFWYGSTLILSGEYTIGSVLTVFFVVIIGVFTMGQTSPNIQTFASARGAAHKVYNIIDKEPIIDSYSEDGFKPDF--IKGDIEFSNIHFTYPSRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREMIGVVSQEPILFATTISENIRYGRPD--VTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELMEKQGVYRMLVTMQ 609          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Match: abcb4 (ATP binding cassette subfamily B member 1 [Source:NCBI gene;Acc:101171435])

HSP 1 Score: 554.673 bits (1428), Expect = 3.033e-167
Identity = 291/612 (47.55%), Postives = 399/612 (65.20%), Query Frame = 1
Query:  313 LFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +F +A   DI+M++   +M+I  G   PL+ +VFG+ T  +                   P   +   P++  I      N T+   +I   M+  +  ++ +   + + +Y+ V+ + I +  Q+  IR  FF  +M+Q+IGWFD   +G L  +L DD+  +  GIGDK+G ++Q  + FI   ++ F +GWKLTLV L++SP + I   + SK +   T K   AY KAG +AEEVL SIRT+ +F G+  E+ RY +NL +A K+G++K+I     +G    +++ SYAL FWYG++LI  G  + +G +L VFF  ++    +GQ +P++ +F  AR AA +++ IID+ P ID  +E+G K +  +G I F  + FTYP+R D  IL  +SLS++ GQT+ALVG+SGCGKS+ IQL+QRFYD  EG V ID  +I+ LNV +LRE IGVVSQEP+LF  +I ENIRYGR DVT  EI+QA   ANA  FI  LPNK +TLVGDRGTQ+SGGQKQRIAIARALVRNPKILLLDEATSALD+ESE IVQ ALDKV  GRTT+IVAHRLST+RNA VI G ++GKV E GTH+ELM   G+Y+ LV  Q
Sbjct:   46 VFRFADGWDILMLVIGTVMAIANGAVLPLMCIVFGDMTDSLI---------------NGAPPNMTAGYPNLTFI------NMTI---DIEEEMTVFAVYYSIMGAVVLVAAYLQVSLWTIAAGRQVKRIRTLFFHKIMQQDIGWFDINETGELNTRLTDDVYKIQEGIGDKVGMLIQSVSSFITAFVIGFTKGWKLTLVILAVSPALGISGALFSKVLTSFTSKEQSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTFLMIYFSYALAFWYGSTLILSGE-YTIGSVLTVFFVVIIGVFTMGQTSPNIQTFASARGAAHKVYNIIDKEPIIDSYSEDGFKPDFIKGDIEFSNIHFTYPSRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREMIGVVSQEPILFATTISENIRYGRPDVTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELMEKQGVYRMLVTMQ 632          

HSP 2 Score: 533.487 bits (1373), Expect = 5.759e-160
Identity = 272/579 (46.98%), Postives = 396/579 (68.39%), Query Frame = 2
Query: 2306 FFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            FF+V+ LN  E  +IFLG   AI NG +QP F++LF  ++   A P+ E      + + +    I  V+FV+  LQ   FG SGE LT + R   F+AML+QD+ WFD+  N++GALTTRL+ +A Q++G +G  L  V     ++G  + ++F + W+++L+VLA VPII V G + ++++ G +  DK  LE++GKIA E IENIRTV++LTRE  F   Y+E +K       KKAH  GF +  +Q+ I+ AYA  F    +L++     +  VF+   A++FGAM +G++ + APN+ K K++AAH+  L+++VP I++ S +G   D    +G++  ++V+F+YP RP++ IL  ++  +   +T+ALVG SGCGKST I LL+RFYDT  G +++D+  IK +NI  LR    IVSQEP LF  ++ ENIAYGD+++  T ++I AAAKA+NIH FI  LP +Y T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEK+VQDALD+A +GRTC+++AHRLSTI+NAD+I VF+ G + E GTH +LL+K G+Y  +++ Q
Sbjct:  704 FFRVLMLNKSEWPFIFLGTFCAIINGGIQPVFAVLFSKIIAVFAEPDQEVVRERSQFFSLMFVTIGCVSFVTMFLQGFCFGKSGEVLTLKLRLGAFKAMLRQDLGWFDDSKNSVGALTTRLATDAAQVQGATGARLATVAQNFANLGTGIILAFIYGWELTLLVLAVVPIIAVAGAVGMQMLTGHAAEDKKELEKAGKIATEAIENIRTVASLTREAKFESLYQENLKVPYKNSQKKAHTHGFTFSFSQSMIYFAYAGCFRFGAWLIVQGRMDVEGVFLVISAVLFGAMAVGEANSFAPNYAKAKMSAAHLMMLINKVPDIDNLSNEGETPD--KFNGNVIFKDVRFNYPSRPDVPILKGLNLKVKKGETLALVGSSGCGKSTTIQLLERFYDTKEGKVVLDDVDIKQLNIHWLRSQIGIVSQEPVLFDCTLAENIAYGDNSRTVTMEEIEAAAKAANIHKFIEELPQRYNTQAGDKGTQLSGGQKQRIAIARAILRNPQVLLLDEATSALDTESEKVVQDALDQASKGRTCIIVAHRLSTIRNADRIAVFQGGVVVEQGTHQQLLAKKGVYHMLVTTQ 1280          

HSP 3 Score: 420.239 bits (1079), Expect = 1.253e-121
Identity = 239/548 (43.61%), Postives = 343/548 (62.59%), Query Frame = 1
Query:  517 PDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            PD +E+VR +        S  F+LM      F  I    F+  ++    F  + +     +R   F+A++RQ++GWFD ++NS GALT +L  D   V    G ++  + Q +A    GIILAF+ GW+LTL+ L++ P+I +   +  + +     +  +   KAG IA E + +IRT+ S   E    + Y ENL    K   +K+   G        +++ +YA  F +GA LI +G   + G + +V  + L     +G+A     ++ +A+ +AA +  +I++VP+ID ++ EG+  + F G + FK V+F YP+R D PIL GL+L ++ G+T+ALVG+SGCGKS+ IQL++RFYD+ EG+V++DD +IK LN+ WLR QIG+VSQEPVLF C++ ENI YG     VT EEI+ A   AN   FI  LP + +T  GD+GTQLSGGQKQRIAIARA++RNP++LLLDEATSALD+ESEK+VQDALD+  +GRT IIVAHRLST+RNA  I   + G V EQGTH +L+A  G+Y  LV  Q
Sbjct:  749 PD-QEVVRER--------SQFFSLM------FVTIGCVSFVTMFLQGFCFGKSGEVLTLKLRLGAFKAMLRQDLGWFDDSKNSVGALTTRLATDAAQVQGATGARLATVAQNFANLGTGIILAFIYGWELTLLVLAVVPIIAVAGAVGMQMLTGHAAEDKKELEKAGKIATEAIENIRTVASLTREAKFESLYQENLKVPYKNSQKKAHTHGFTFSFSQSMIYFAYAGCFRFGAWLIVQGRMDVEG-VFLVISAVLFGAMAVGEANSFAPNYAKAKMSAAHLMMLINKVPDIDNLSNEGETPDKFNGNVIFKDVRFNYPSRPDVPILKGLNLKVKKGETLALVGSSGCGKSTTIQLLERFYDTKEGKVVLDDVDIKQLNIHWLRSQIGIVSQEPVLFDCTLAENIAYGDNSRTVTMEEIEAAAKAANIHKFIEELPQRYNTQAGDKGTQLSGGQKQRIAIARAILRNPQVLLLDEATSALDTESEKVVQDALDQASKGRTCIIVAHRLSTIRNADRIAVFQGGVVVEQGTHQQLLAKKGVYHMLVTTQ 1280          

HSP 4 Score: 402.905 bits (1034), Expect = 6.826e-116
Identity = 232/588 (39.46%), Postives = 354/588 (60.20%), Query Frame = 2
Query: 2348 IFLGCVSAIFNGAVQPSFSILFGFLLPAMAN----------PNI----------EQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            + +G V AI NGAV P   I+FG +  ++ N          PN+          E+ +     Y I  A + V A++   L  +  G       KR R++ F  +++QDI WFD   N  G L TRL+D+  +I+   G+ +G +I ++ S   A  I F   W+++LV+LA  P + + G L  +++  F++ ++ A  ++G +A E + +IRTV   + ++  I+ Y + +++      KKA +     G T   I+ +YA  F     L+L     + +V   F  +I G   +G++      F   + AA  ++ ++D+ P I+S+S DG   D   + GDI+  N+ F+YP RP++ IL ++S ++ S QT+ALVG SGCGKST I LLQRFYD + GN+ ID + I+ +N++ LR++  +VSQEP LF+ +I ENI YG      T  +I  AAK +N +DFI+NLP+++ET VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD ESE IVQ ALDK + GRT +++AHRLSTI+NAD I  F++GK+ E GTH EL+ K G+Y  ++++Q+ +
Sbjct:   58 LVIGTVMAIANGAVLPLMCIVFGDMTDSLINGAPPNMTAGYPNLTFINMTIDIEEEMTVFAVYYSIMGAVVLVAAYLQVSLWTIAAGRQ----VKRIRTLFFHKIMQQDIGWFD--INETGELNTRLTDDVYKIQEGIGDKVGMLIQSVSSFITAFVIGFTKGWKLTLVILAVSPALGISGALFSKVLTSFTSKEQSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTFLMIYFSYALAFWYGSTLILSGEYTIGSVLTVFFVVIIGVFTMGQTSPNIQTFASARGAAHKVYNIIDKEPIIDSYSEDGFKPDF--IKGDIEFSNIHFTYPSRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREMIGVVSQEPILFATTISENIRYGRPD--VTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELMEKQGVYRMLVTMQTFQ 635          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Match: abcb11a (ATP binding cassette subfamily B member 11 [Source:NCBI gene;Acc:101157171])

HSP 1 Score: 514.227 bits (1323), Expect = 3.977e-153
Identity = 264/580 (45.52%), Postives = 389/580 (67.07%), Query Frame = 2
Query: 2297 SAGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            SA   +++  N PE  Y+ LG + A  NG+V P +++LF  +L   + P++++Q   I    +    +AV++F S  +Q   F  SGE LT+R R + F+AMLKQ+I WFD+P N+ GALTTRL+ +A+ ++G +G  +G +I ++ S+GA+  I+F F W+++LV+L F+P+I + G+ Q +++ GF+  DK A+E +G+++ E + NIRTV+ LT+E +F++ ++E ++       K+A+  G  +GLTQ  IF AYAA+F   GYL+     +   VF    A++     LG++ +  P++ K K AAA  F+LLDRVP I+   TDG     EN  G+++  N KF+YP RP+  +L  +  ++   QT+ALVG SGCGKST + LL+RFYD   G +LID      +++  LR    IVSQEP LF  SI ENI YGD++     ++I+ AAK +N+HDF++ LPD+Y+T+VG +GS  S GQKQRIAIARA++RNP+ILLLDEATSALDTESE+IVQ ALD+A++GRTC+VIAHRLSTIQNAD I V   G + E GTH EL++K G Y ++++
Sbjct:  725 SASVARILKYNQPEWPYMLLGSLGAAINGSVNPIYAVLFSQILGTFSIPDLDEQRRQINGICLLFCVVAVISFFSQFIQGFSFAKSGELLTRRLRKVGFQAMLKQEIGWFDDPENSPGALTTRLATDASMVQGATGSQIGMIINSLTSIGASFIIAFYFSWKLTLVILGFLPLIGLSGVFQAKMLTGFAKEDKKAMEAAGRVSSEALGNIRTVAGLTKERSFVESFEEKLELPYKSAKKRANIYGLCFGLTQCVIFMAYAASFRFGGYLVRAEGLQYMLVFRVISAVVISGTALGRASSFTPDYAKAKTAAAQFFKLLDRVPKIS--HTDGE--KWENFKGEVEFLNCKFTYPTRPDTQVLKGLVVSVKPGQTLALVGSSGCGKSTGVQLLERFYDPDEGKVLIDGRPSYSVSVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSHRINMEEIVEAAKTANLHDFVMTLPDKYDTQVGAQGSQLSRGQKQRIAIARAIIRNPKILLLDEATSALDTESEQIVQSALDEARKGRTCIVIAHRLSTIQNADIIAVMSHGVVIEQGTHDELMAKRGAYYKLVT 1300          

HSP 2 Score: 472.241 bits (1214), Expect = 7.346e-139
Identity = 274/616 (44.48%), Postives = 377/616 (61.20%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +L+ +AT  D VMM+     ++  G   PL++LV+G  T     Y+  +    Q L   N+   + T       I             NI   M+  +  + GI   + ++SY  + F+V  +  Q   IR  +FR VM+  IGWFD  + G L  ++ DDIN +   I D++   ++  + FI G ++ F+ GWKLTLV +++SPLI +   +++  + +LT +  +AY KAG +A+EVL SIRT+ +F GE+ E  RY  NL EA   G++K  + G   G +  ++F  YAL FWYG+ L+ +      G+++ VFF  L+A T +GQA P + +F   R+AA  +FE IDR PEID ++E+G KL+  +G I F  V F YP+R D  IL  L+L I+ G+T A VG SG GK+S +QL+QRFYD  EG V +D  +++ LN+ WLR  IG+V QEPVLF  +I ENIRYGR  VT E+I QA   ANA  FI  LP K DTLVG+ G Q+SGGQKQRIAIARALVR P+ILLLD ATSALD+ESE  VQ+AL+KV   RTTI VAHRLST+R+A VI G + G+  E+GTH EL+   G+Y  LV  Q
Sbjct:   29 GYFQLYRFATGRDTVMMVVGGFCALIHGAATPLMLLVYGMMTDTFVAYELEV----QELKDPNKECLNDTIYWINGSIYETTDNQTVTCGVNIEGQMTQFAYYYIGIGSGVLLVSYFQIMFWVSAAARQTQRIRKTYFRRVMQMEIGWFDCNSVGELNTRISDDINKISNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVVAVSPLIGMGAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEEKEAERYDRNLVEAQNWGVKKGSIIGVFQGYLWCIIFLCYALAFWYGSKLVIDSKELSPGNLIQVFFGVLIAATNLGQAAPCLEAFASGRAAAKTVFETIDREPEIDCLSEDGYKLDKIKGDIEFHNVTFYYPSRPDIKILDDLNLHIKAGETTAFVGPSGSGKTSAVQLIQRFYDPKEGMVTLDGHDLRSLNIQWLRSLIGIVEQEPVLFATTIAENIRYGRPGVTMEDIIQATREANAYHFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALVRKPRILLLDMATSALDNESEATVQEALNKVHTERTTISVAHRLSTIRSADVIVGFEHGRAVEKGTHRELLERKGVYFTLVTLQ 640          

HSP 3 Score: 382.874 bits (982), Expect = 3.741e-109
Identity = 243/588 (41.33%), Postives = 356/588 (60.54%), Query Frame = 1
Query:  391 WPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIR-EGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            WP ++L      S  A     +N +   L SQ   I  + SIPD++E  R                ++G+   F  +A+  F   ++    F  + +     +R   F+A+++Q IGWFD  +NS GALT +L  D + V    G +IG ++          I+AF   WKLTLV L   PLI +  +  +K +    ++  +A   AG ++ E LG+IRT+     E+  V  + E L+   K   +++ + G   GL   ++F +YA  F +G  L+R EG  +++  +  V  + +++ T +G+A+     + +A++AAA+ F+++DRVP+I   + +G+K  +F+G++ F   KFTYPTR D  +L GL +S++PGQT+ALVG+SGCGKS+ +QL++RFYD +EG+VLID      ++V +LR QIG+VSQEPVLF CSI ENI+YG     +  EEI +A   AN   F+  LP+K DT VG +G+QLS GQKQRIAIARA++RNPKILLLDEATSALD+ESE+IVQ ALD+  +GRT I++AHRLST++NA +I  +  G V EQGTH ELMA  G Y  LV
Sbjct:  739 WPYMLL-----GSLGAAINGSVNPIYAVLFSQ---ILGTFSIPDLDEQRRQ---------------INGICLLFCVVAVISFFSQFIQGFSFAKSGELLTRRLRKVGFQAMLKQEIGWFDDPENSPGALTTRLATDASMVQGATGSQIGMIINSLTSIGASFIIAFYFSWKLTLVILGFLPLIGLSGVFQAKMLTGFAKEDKKAMEAAGRVSSEALGNIRTVAGLTKERSFVESFEEKLELPYKSAKKRANIYGLCFGLTQCVIFMAYAASFRFGGYLVRAEGLQYML--VFRVISAVVISGTALGRASSFTPDYAKAKTAAAQFFKLLDRVPKIS--HTDGEKWENFKGEVEFLNCKFTYPTRPDTQVLKGLVVSVKPGQTLALVGSSGCGKSTGVQLLERFYDPDEGKVLIDGRPSYSVSVPFLRSQIGIVSQEPVLFDCSIAENIQYGDNSHRINMEEIVEAAKTANLHDFVMTLPDKYDTQVGAQGSQLSRGQKQRIAIARAIIRNPKILLLDEATSALDTESEQIVQSALDEARKGRTCIVIAHRLSTIQNADIIAVMSHGVVIEQGTHDELMAKRGAYYKLV 1299          

HSP 4 Score: 320.857 bits (821), Expect = 7.990e-89
Identity = 208/537 (38.73%), Postives = 302/537 (56.24%), Query Frame = 2
Query: 2444 NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL--YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            NIE Q      Y I   GI     + S  Q + + ++  + T+R R   F  +++ +I WFD   N++G L TR+SD+  +I     + +   I  I +      + F   W+++LVV+A  P+I +G  L    +   +  +  A  ++G +A E + +IRTV+    E    + Y   + +      KK    G   G     IF  YA  F     L++    +S    + + FG LI  A NLG++      F  G+ AA  +FE +DR P I+  S DG  LD   + GDI+  NV F YP RP+I IL+D++ +I + +T A VGPSG GK++ + L+QRFYD   G + +D + ++ +NIQ LR L  IV QEP LF+ +I ENI YG       D  II A + +N + FI++LP +++T VGE G   SGGQKQRIAIARAL+R PRILLLD ATSALD ESE  VQ+AL+K    RT + +AHRLSTI++AD I+ F+ G+  E GTH ELL + G+Y  +++LQ+ 
Sbjct:  116 NIEGQMTQFAYYYI---GIGSGVLLVSYFQIMFWVSAAARQTQRIRKTYFRRVMQMEIGWFD--CNSVGELNTRISDDINKISNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVVAVSPLIGMGAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEEKEAERYDRNLVEAQNWGVKKGSIIGVFQGYLWCIIFLCYALAFWYGSKLVIDSKELSPGNLIQVFFGVLI-AATNLGQAAPCLEAFASGRAAAKTVFETIDREPEIDCLSEDGYKLD--KIKGDIEFHNVTFYYPSRPDIKILDDLNLHIKAGETTAFVGPSGSGKTSAVQLIQRFYDPKEGMVTLDGHDLRSLNIQWLRSLIGIVEQEPVLFATTIAENIRYGRPGVTMED--IIQATREANAYHFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALVRKPRILLLDMATSALDNESEATVQEALNKVHTERTTISVAHRLSTIRSADVIVGFEHGRAVEKGTHRELLERKGVYFTLVTLQNQ 642          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Match: ABCB4 (multidrug resistance protein 1-like [Source:NCBI gene;Acc:105357817])

HSP 1 Score: 462.225 bits (1188), Expect = 1.080e-144
Identity = 234/486 (48.15%), Postives = 344/486 (70.78%), Query Frame = 2
Query: 2585 ITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            I F+++  QD+ WFD+  N++GALTTRL+ +A Q++G +G  L  V     ++G  + ++F + W+++L+VLA VPII V G + ++++ G +  DK  LE++GKIA E IENIRTV++LTRE  F   Y+E +K       KKAH  GF +  +Q+ I+ AYA  F    +L++     +  VF+   A++FGAM +G++ + APN+ K K++AAH+  L+++VP I++ S +G   D    +G++  ++V+F+YP RP++ IL  ++  +   +T+ALVG SGCGKST I LL+RFYDT  G +++D+  IK +NI  LR    IVSQEP LF  ++ ENIAYGD+++  T ++I AAAKA+NIH FI  LP +Y T+ G+KG+  SGGQKQRIAIARA+LRNP++LLLDEATSALDTESEK+VQDALD+A +GRTC+++AHRLSTI+NAD+I VF+ G + E GTH +LL+K G+Y  +++ Q
Sbjct:   20 IIFDSL--QDLGWFDDSKNSVGALTTRLATDAAQVQGATGARLATVAQNFANLGTGIILAFIYGWELTLLVLAVVPIIAVAGAVGMQMLTGHAAEDKKELEKAGKIATEAIENIRTVASLTREAKFESLYQENLKVPYKNSQKKAHTHGFTFSFSQSMIYFAYAGCFRFGAWLIVQGRMDVEGVFLVISAVLFGAMAVGEANSFAPNYAKAKMSAAHLMMLINKVPDIDNLSNEGETPD--KFNGNVIFKDVRFNYPSRPDVPILKGLNLKVKKGETLALVGSSGCGKSTTIQLLERFYDTKEGKVVLDDVDIKQLNIHWLRSQIGIVSQEPVLFDCTLAENIAYGDNSRTVTMEEIEAAAKAANIHKFIEELPQRYNTQAGDKGTQLSGGQKQRIAIARAILRNPQVLLLDEATSALDTESEKVVQDALDQASKGRTCIIVAHRLSTIRNADRIAVFQGGVVVEQGTHQQLLAKKGVYHMLVTTQ 501          

HSP 2 Score: 406.371 bits (1043), Expect = 3.336e-125
Identity = 222/477 (46.54%), Postives = 313/477 (65.62%), Query Frame = 1
Query:  730 QNIGWFD-AQNS-GALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            Q++GWFD ++NS GALT +L  D   V    G ++  + Q +A    GIILAF+ GW+LTL+ L++ P+I +   +  + +     +  +   KAG IA E + +IRT+ S   E    + Y ENL    K   +K+   G        +++ +YA  F +GA LI +G   + G + +V  + L     +G+A     ++ +A+ +AA +  +I++VP+ID ++ EG+  + F G + FK V+F YP+R D PIL GL+L ++ G+T+ALVG+SGCGKS+ IQL++RFYD+ EG+V++DD +IK LN+ WLR QIG+VSQEPVLF C++ ENI YG     VT EEI+ A   AN   FI  LP + +T  GD+GTQLSGGQKQRIAIARA++RNP++LLLDEATSALD+ESEK+VQDALD+  +GRT IIVAHRLST+RNA  I   + G V EQGTH +L+A  G+Y  LV  Q
Sbjct:   26 QDLGWFDDSKNSVGALTTRLATDAAQVQGATGARLATVAQNFANLGTGIILAFIYGWELTLLVLAVVPIIAVAGAVGMQMLTGHAAEDKKELEKAGKIATEAIENIRTVASLTREAKFESLYQENLKVPYKNSQKKAHTHGFTFSFSQSMIYFAYAGCFRFGAWLIVQGRMDVEG-VFLVISAVLFGAMAVGEANSFAPNYAKAKMSAAHLMMLINKVPDIDNLSNEGETPDKFNGNVIFKDVRFNYPSRPDVPILKGLNLKVKKGETLALVGSSGCGKSTTIQLLERFYDTKEGKVVLDDVDIKQLNIHWLRSQIGIVSQEPVLFDCTLAENIAYGDNSRTVTMEEIEAAAKAANIHKFIEELPQRYNTQAGDKGTQLSGGQKQRIAIARAILRNPQVLLLDEATSALDTESEKVVQDALDQASKGRTCIIVAHRLSTIRNADRIAVFQGGVVVEQGTHQQLLAKKGVYHMLVTTQ 501          
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Match: abcb11b (bile salt export pump [Source:NCBI gene;Acc:101163554])

HSP 1 Score: 481.485 bits (1238), Expect = 1.708e-141
Identity = 283/637 (44.43%), Postives = 387/637 (60.75%), Query Frame = 1
Query:  301 GVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSS-------TSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMS--------------QQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            G  +LF +ATC D++MM+   + ++  G   PL++LVFG  T     Y   +  L+     + E + ++       T   DM   +     +   S+  +FT +S MS                + GI   +F++ Y  ++ +V  +  QI  IR  +F  VMR  IGWFD  + G L  +L DDIN ++  I D++   +Q +  F+ G  + FV+GWKLTLV ++ SPLI I   +++  + KLT    +AY KAG +A+EVL SIRT+ +F GE  EV RY  NL  A + GIRK ++ G   G +  ++F  YAL FWYG++L+ +   +  G +L VFF  L+A   +GQA+P + +F   R AA  IFE IDR P+ID ++E G KL   +G I F  V F YP+R +  IL  LS+ ++ G+T A VG SG GKS+ IQL+QRFYD  EG V +D  +I+ LN+ WLR  IG+V QEPVLF  +I ENIRYGR  V+ ++I  A   ANA  FI  LP K DTLVG+ G Q+SGGQKQRIAIARALVRNP+ILLLD ATSALD+ESE +VQ+ALDKV  GRTTI +AHRLST++NA VI G + G+  E+G H EL+   G+Y  LV  Q
Sbjct:   56 GFFQLFRFATCKDVLMMVLGSVCAVLHGSAQPLMLLVFGLLTDTFIDYDIELQELSD---DRKECVNNTIQWKRNYTGTLDMTLPLNQSFGSLINSTLEMFTPLSNMSCGILDIEHEMTLFALYYVGIGAGVFLLGYFQISLWVTAAARQIQLIRKLYFTKVMRMEIGWFDCTSVGELNTRLSDDINKINDAIADQVSIFVQRFTTFVCGFCIGFVKGWKLTLVIVAASPLIGIGAGLMALFVAKLTGMELQAYAKAGAVADEVLSSIRTVAAFGGEIKEVERYDRNLVSAQRWGIRKGLIMGFFTGYMWLIIFLCYALAFWYGSTLVVDTAEYTPGTLLQVFFGVLVAAMSLGQASPCLEAFAAGRGAATIIFETIDREPQIDCLSESGYKLERVKGDIEFHNVTFHYPSRPEVKILDQLSVQVKSGETTAFVGPSGAGKSTAIQLIQRFYDPLEGMVTLDGHDIRGLNIQWLRSLIGIVEQEPVLFATTIAENIRYGRPGVSMDDIINAAKEANAYNFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKVRMGRTTISIAHRLSTIKNADVIVGFEHGRAVERGKHNELLERKGVYFTLVTLQ 689          

HSP 2 Score: 476.478 bits (1225), Expect = 7.327e-140
Identity = 251/575 (43.65%), Postives = 374/575 (65.04%), Query Frame = 2
Query: 2312 KVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMIS 4036
            +++  NAPE  Y+  G + A  NG V P +S+LF  +L   +  +   Q  +I    +  A + VV+F + +LQ   F  SGE LT+R R I F AML Q+I WFD+  N+ GALTTRL+ +A+Q++G +G  +G ++ ++ ++G AV +SF F W+++L++L F+P + + G  Q +++ GF+  DK A+E +G+I+ E + NIRT++ L +E  F++ Y+  +        KKA+  G  YG  Q  +F   +A++   GYL+       + VF    A++     LG++ +  P++ K KI+AA  F+LLDR+P I+ +S  G   +  N  G+I+  + KF+YP RP+I +LN ++ ++   QT+A VG SGCGKST + LL+RFYD  +G +LID +  K +N+  LR    IVSQEP LF  SI ENI YGD+++  + D++I AAK + +HDF+  LP+QY T VG +GS  S GQKQRIAIARA++R+P+ILLLDEATSALDTESEK VQ+ALDKA+EGRTC+VIAHRLSTIQN+D I V   G + E G+H +L+   G Y ++++
Sbjct:  785 RILKYNAPEWPYMLFGSLGAAINGGVNPVYSLLFSQILATFSVQDPAAQRREIDGICVFFAMVGVVSFFTQMLQGYAFSKSGELLTRRLRRIGFHAMLGQEIGWFDDHRNSPGALTTRLATDASQVQGATGSQIGMIVNSLTNIGVAVLMSFYFSWKLTLLILCFLPFLALSGGFQAKMLTGFAKQDKQAMETAGRISGEALNNIRTIAGLGKEKNFVEMYEFQLDAPYQAALKKANVYGACYGFAQCVVFMTNSASYRFGGYLVKQEGLHFSLVFRVISAIVTSGTALGRASSYTPDYAKAKISAARFFQLLDRIPTISVYSDKGDKWN--NFQGNIEFIDCKFTYPTRPDIQVLNGLTVSVKPGQTLAFVGSSGCGKSTSVQLLERFYDPDHGKVLIDGHDSKHVNVPYLRSKIGIVSQEPILFDCSIAENIKYGDNSREISMDEVILAAKKAQLHDFVTALPEQYNTNVGSQGSQLSRGQKQRIAIARAIIRDPKILLLDEATSALDTESEKTVQEALDKAREGRTCIVIAHRLSTIQNSDIIAVMSRGILIEQGSHDQLMGLKGAYYKLVT 1357          

HSP 3 Score: 360.533 bits (924), Expect = 1.557e-101
Identity = 210/521 (40.31%), Postives = 319/521 (61.23%), Query Frame = 1
Query:  589 MSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQ--NSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYG--RMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLV 2139
            + G+   FA + +  F    +    F  + +     +R   F A++ Q IGWFD    + GALT +L  D + V    G +IG ++         ++++F   WKLTL+ L   P + +     +K +    ++  +A   AG I+ E L +IRTI     EK  V  Y   LD   +  ++K+ + G   G    ++F + +  + +G  L+++  G     +  V  + + + T +G+A+ +   + +A+ +AA  F+++DR+P I   +++GDK N+FQG I F   KFTYPTR D  +L GL++S++PGQT+A VG+SGCGKS+ +QL++RFYD + G+VLID  + K +NV +LR +IG+VSQEP+LF CSI ENI+YG    +++ +E+  A   A    F+ ALP + +T VG +G+QLS GQKQRIAIARA++R+PKILLLDEATSALD+ESEK VQ+ALDK  EGRT I++AHRLST++N+ +I  +  G + EQG+H +LM L G Y  LV
Sbjct:  837 IDGICVFFAMVGVVSFFTQMLQGYAFSKSGELLTRRLRRIGFHAMLGQEIGWFDDHRNSPGALTTRLATDASQVQGATGSQIGMIVNSLTNIGVAVLMSFYFSWKLTLLILCFLPFLALSGGFQAKMLTGFAKQDKQAMETAGRISGEALNNIRTIAGLGKEKNFVEMYEFQLDAPYQAALKKANVYGACYGFAQCVVFMTNSASYRFGGYLVKQ-EGLHFSLVFRVISAIVTSGTALGRASSYTPDYAKAKISAARFFQLLDRIPTISVYSDKGDKWNNFQGNIEFIDCKFTYPTRPDIQVLNGLTVSVKPGQTLAFVGSSGCGKSTSVQLLERFYDPDHGKVLIDGHDSKHVNVPYLRSKIGIVSQEPILFDCSIAENIKYGDNSREISMDEVILAAKKAQLHDFVTALPEQYNTNVGSQGSQLSRGQKQRIAIARAIIRDPKILLLDEATSALDTESEKTVQEALDKAREGRTCIVIAHRLSTIQNSDIIAVMSRGILIEQGSHDQLMGLKGAYYKLV 1356          

HSP 4 Score: 320.857 bits (821), Expect = 1.212e-88
Identity = 209/532 (39.29%), Postives = 300/532 (56.39%), Query Frame = 2
Query: 2465 DIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSH 4048
            ++  + +   GI    F+    Q   +  +  +  +  R + F  +++ +I WFD    ++G L TRLSD+  +I     + +   +    +      I F   W+++LV++A  P+I +G  L    +   +  +  A  ++G +A E + +IRTV+    E   ++ Y   +        +K    GF  G     IF  YA  F     L++    Y    +  VF  FG L+  AM+LG++      F  G+ AA  +FE +DR P I+  S  G  L  E + GDI+  NV F YP RP + IL+ +S  + S +T A VGPSG GKST I L+QRFYD L G + +D + I+ +NIQ LR L  IV QEP LF+ +I ENI YG      + D II AAK +N ++FI++LP +++T VGE G   SGGQKQRIAIARAL+RNPRILLLD ATSALD ESE +VQ+ALDK + GRT + IAHRLSTI+NAD I+ F+ G+  E G H ELL + G+Y  +++LQS 
Sbjct:  169 EMTLFALYYVGIGAGVFLLGYFQISLWVTAAARQIQLIRKLYFTKVMRMEIGWFD--CTSVGELNTRLSDDINKINDAIADQVSIFVQRFTTFVCGFCIGFVKGWKLTLVIVAASPLIGIGAGLMALFVAKLTGMELQAYAKAGAVADEVLSSIRTVAAFGGEIKEVERYDRNLVSAQRWGIRKGLIMGFFTGYMWLIIFLCYALAFWYGSTLVVDTAEYTPGTLLQVF--FGVLV-AAMSLGQASPCLEAFAAGRGAATIIFETIDREPQIDCLSESGYKL--ERVKGDIEFHNVTFHYPSRPEVKILDQLSVQVKSGETTAFVGPSGAGKSTAIQLIQRFYDPLEGMVTLDGHDIRGLNIQWLRSLIGIVEQEPVLFATTIAENIRYGRPG--VSMDDIINAAKEANAYNFIMDLPQKFDTLVGEGGGQMSGGQKQRIAIARALVRNPRILLLDMATSALDNESEAVVQEALDKVRMGRTTISIAHRLSTIKNADVIVGFEHGRAVERGKHNELLERKGVYFTLVTLQSQ 691          
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Match: SMESG000004996.1 (SMESG000004996.1)

HSP 1 Score: 1287.32 bits (3330), Expect = 0.000e+0
Identity = 685/685 (100.00%), Postives = 685/685 (100.00%), Query Frame = 1
Query:   97 MTISKVKVSNDETEKTDIPTRENAIYRAYDLENPGFERSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 2151
            MTISKVKVSNDETEKTDIPTRENAIYRAYDLENPGFERSDSVHSKISKHSIEKIKKSKNKKKAEIKSVGVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICMLMLSKTMMKLTQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSILTGTLLGLVMGLMFGSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK
Sbjct:    1 MTISKVKVSNDETEKTDIPTRENAIYRAYDLENPGFERSDSVHSKISKHSIEKIKKSKNKKKAEIKSVGVGKLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICMLMLSKTMMKLTQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSILTGTLLGLVMGLMFGSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 685          

HSP 2 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 634/635 (99.84%), Postives = 635/635 (100.00%), Query Frame = 2
Query: 2147 KKIDHGQKGEKEEIYVNVDEEIIKESPTKRLSXXXXXXXXXXXXXXXXXSSAGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 4051
            +KIDHGQKGEKEEIYVNVDEEIIKESPTKRLSVAKIEEVIEENKEIVKKSSAGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTLNGNILIDNNKIKDINIQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK
Sbjct:  684 QKIDHGQKGEKEEIYVNVDEEIIKESPTKRLSVAKIEEVIEENKEIVKKSSAGFFKVMGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTLNGNILIDNNKIKDINIQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 1318          

HSP 3 Score: 355.525 bits (911), Expect = 3.731e-100
Identity = 206/522 (39.46%), Postives = 312/522 (59.77%), Query Frame = 1
Query:  610 FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLN--DFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNR 2157
             AGIA+  F+ S +    F  + +      R+  F A+++Q+I WFD  + N GALT +L D+   +    G+ +G ++         + ++F   W+++LV L+  P+I +  ++  + M   +     A  ++G IA E + +IRT+ +   E   +  Y E + +      +K+   G L GL    +F +YA  F     L+   N   + ++ I F + +     +G++     +F + + AAA +FE++DRVP I+  + +G  L+  +  G I  + VKF+YP R +  IL  +S +I   QT+ALVG SGCGKS++I L+QRFYD+  G +LID+  IKD+N+  LR+   +VSQEP LF  SI+ENI YG      TD++I  A   +N   FI  LP++ +T VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD+ESEKIVQDALDK  EGRT +++AHRLST++NA  I   KDGK+ E GTH EL++ NG+Y  ++  Q ++
Sbjct:  798 LAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLY-NMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTLNGNILIDNNKIKDINIQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 1318          

HSP 4 Score: 348.591 bits (893), Expect = 6.279e-98
Identity = 206/519 (39.69%), Postives = 310/519 (59.73%), Query Frame = 2
Query: 2489 LAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLY-NMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
             AGIA+  F+ S +    F  + +      R+  F A+++Q+I WFD  + N GALT +L D+   +    G+ +G ++         + ++F   W+++LV L+  P+I +  ++  + M   +     A  ++G IA E + +IRT+ +   E   +  Y E + +      +K+   G L GL    +F +YA  F     L+   N   + ++ I F + +     +G++     +F + + AAA +FE++DRVP I+  + +G  L+  +  G I  + VKF+YP R +  IL  +S +I   QT+ALVG SGCGKS++I L+QRFYD+  G +LID+  IKD+N+  LR+   +VSQEP LF  SI+ENI YG      TD++I  A   +N   FI  LP++ +T VG++G+  SGGQKQRIAIARAL+RNP+ILLLDEATSALD+ESEKIVQDALDK  EGRT +++AHRLST++NA  I   KDGK+ E GTH EL++ NG+Y  ++  Q
Sbjct:  172 FAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFD--AQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICMLMLSKTMMKLTQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSILTGTLLGLVMGLMFGSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLN--DFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMD--VTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 684          
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Match: SMESG000030111.1 (SMESG000030111.1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 366/366 (100.00%), Postives = 366/366 (100.00%), Query Frame = -1
Query: 6413 MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVHWYEGXXXXXXXXXXXXXXYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKSLIXXXXXXXXXXXXXXXNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITG 7510
            MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKSLIDSENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITG
Sbjct:    1 MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFYENDSLAKSLIDSENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESMFAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVWITICIYLLVWMICITG 366          
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Match: SMESG000030111.1 (SMESG000030111.1)

HSP 1 Score: 408.683 bits (1049), Expect = 9.688e-131
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = -1
Query: 6905 MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVH 7510
            MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVH
Sbjct:    1 MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLSNCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSSLESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIGSALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDELVH 202          
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Match: SMESG000027395.1 (SMESG000027395.1)

HSP 1 Score: 421.394 bits (1082), Expect = 5.474e-129
Identity = 247/615 (40.16%), Postives = 358/615 (58.21%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALD-KVVEG-RTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQ 2148
            +LF +    DI+++   +I SIG+GV  PL +L+F +  + +      +N    F ++   PI                                     FA +A    I S+V      +T + Q    ++ +F A++RQ I WFD Q +G +  +  DDI+++   I DK+ Q +Q  + F   II+A   GWKLTLV     P++II +      + K       AY  AGGIAEE+L S+RT+V+F  ++ EV RY++NL +A  +GI+KSI+ G   G V   +F   +L F+ G  LI   N +  G ++ VF + ++ +  IG A P + +F  A++AA  IFE+IDRVP ID   + G   + F   I F+ V F Y TR    IL   + +I  G+TVA +G SG GKS++I L+QRFYD   GEV++ D N+KD+++ W R  IGVV QEP LF  SI+ENI+ G++D T++EI ++   +NA  FI A     DT +GDRGT  SGGQKQRIAIA AL+R+P++LLLDEATSALD++SEK+VQ  LD  + EG RT ++VAHRL TVRNA +I  +K+GK+ EQG H+ L+A +GLY +++  Q
Sbjct:   54 RLFRFMNSMDILLISLTVISSIGIGVALPLNMLIFKDVVNLLVLPTGNIN----FSSAIRNPI-----------------------------------NYFAILASGALIASFVQSICISVTGKRQSRRYKSNYFAALLRQEISWFDKQQTGQMITRFSDDIDSIEVAISDKLAQFIQQLSLFFSSIIIAATSGWKLTLVGCMAIPIMIIILYSNLHFIKKYVIAQIRAYSVAGGIAEEILSSVRTVVAFNAQESEVNRYSKNLVKAKSLGIKKSIVQGIGSGCVGLSVFSIGSLVFYVGLLLINSEN-YDPGTVIQVFLTIVLGSISIGYAAPLIENFMTAQAAAYSIFEVIDRVPSIDH-RKLGIIPDTFAKDIKFQNVTFQYSTRPGMTILDNFNFTIPYGKTVAFIGPSGSGKSTIIHLLQRFYDPLSGEVILGDQNVKDIDLNWYRSHIGVVQQEPPLFSGSIRENIQMGKLDATEDEIIKSTQYSNAYDFIMATKETFDTKLGDRGTGFSGGQKQRIAIATALIRDPQLLLLDEATSALDNKSEKLVQKTLDTTIAEGKRTIVMVAHRLQTVRNADIIVVMKNGKIVEQGNHSSLLAQHGLYWEMLGTQ 627          

HSP 2 Score: 325.479 bits (833), Expect = 8.223e-96
Identity = 209/581 (35.97%), Postives = 340/581 (58.52%), Query Frame = 2
Query: 2324 LNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDK--AQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            +N+ +   I L  +S+I  G   P   ++F  ++  +  P  NI   SA IR  +   A +A  A ++S +Q++    +G++ ++R +S  F A+L+Q+I+WFD+     G + TR SD+   I     + L   I  +    +++ I+    W+++LV    +PI+ +     +  ++ +  +   A   +G IA E + ++RTV     + + +  Y + + K      KK+  QG   G    ++F   +  F + G LL+    Y+   +  VF++   ++ G++++G +  +  NF   + AA  +FE++DRVP I+     G++ D    + DIK +NV F Y  RP + IL++ +F I   +T+A +GPSG GKSTII LLQRFYD L+G +++ +  +KDI++   R    +V QEP LFS SIRENI  G      T+D+II + + SN +DFI+   + ++TK+G++G+ FSGGQKQRIAIA AL+R+P++LLLDEATSALD +SEK+VQ  LD   A+  RT V++AHRL T++NAD I+V K+GKI E G H  LL+++G+Y +M+  Q
Sbjct:   59 MNSMDILLISLTVISSIGIGVALPLNMLIFKDVVNLLVLPTGNINFSSA-IRNPINYFAILASGALIASFVQSICISVTGKRQSRRYKSNYFAALLRQEISWFDK--QQTGQMITRFSDDIDSIEVAISDKLAQFIQQLSLFFSSIIIAATSGWKLTLVGCMAIPIMIIILYSNLHFIKKYVIAQIRAYSVAGGIAEEILSSVRTVVAFNAQESEVNRYSKNLVKAKSLGIKKSIVQGIGSGCVGLSVFSIGSLVFYV-GLLLINSENYDPGTVIQVFLT---IVLGSISIGYAAPLIENFMTAQAAAYSIFEVIDRVPSIDHRKL-GIIPD--TFAKDIKFQNVTFQYSTRPGMTILDNFNFTIPYGKTVAFIGPSGSGKSTIIHLLQRFYDPLSGEVILGDQNVKDIDLNWYRSHIGVVQQEPPLFSGSIRENIQMGKLDA--TEDEIIKSTQYSNAYDFIMATKETFDTKLGDRGTGFSGGQKQRIAIATALIRDPQLLLLDEATSALDNKSEKLVQKTLDTTIAEGKRTIVMVAHRLQTVRNADIIVVMKNGKIVEQGNHSSLLAQHGLYWEMLGTQ 627          
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Match: SMESG000027395.1 (SMESG000027395.1)

HSP 1 Score: 421.779 bits (1083), Expect = 2.376e-127
Identity = 247/616 (40.10%), Postives = 359/616 (58.28%), Query Frame = 1
Query:  310 KLFSYATCSDIVMMICAIIMSIGMGVTWPLIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNKKYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISAIRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQWYACFIGGIILAFVRGWKLTLVTLSISPLIIICXXXXXXXXXXXXQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSIXXXXXXXXXXXXXXXSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGIGQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVV-EG-RTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQK 2151
            +LF +    DI+++   +I SIG+GV  PL +L+F +  + +      +N    F ++   PI                                     FA +A    I S+V      +T + Q    ++ +F A++RQ I WFD Q +G +  +  DDI+++   I DK+ Q +Q  + F   II+A   GWKLTLV     P++II +      + K       AY  AGGIAEE+L S+RT+V+F  ++ EV RY++NL +A  +GI+KSI+ G   G V   +F   +L F+ G  LI   N +  G ++ VF + ++ +  IG A P + +F  A++AA  IFE+IDRVP ID   + G   + F   I F+ V F Y TR    IL   + +I  G+TVA +G SG GKS++I L+QRFYD   GEV++ D N+KD+++ W R  IGVV QEP LF  SI+ENI+ G++D T++EI ++   +NA  FI A     DT +GDRGT  SGGQKQRIAIA AL+R+P++LLLDEATSALD++SEK+VQ  LD  + EG RT ++VAHRL TVRNA +I  +K+GK+ EQG H+ L+A +GLY +++  Q+
Sbjct:   54 RLFRFMNSMDILLISLTVISSIGIGVALPLNMLIFKDVVNLLVLPTGNIN----FSSAIRNPI-----------------------------------NYFAILASGALIASFVQSICISVTGKRQSRRYKSNYFAALLRQEISWFDKQQTGQMITRFSDDIDSIEVAISDKLAQFIQQLSLFFSSIIIAATSGWKLTLVGCMAIPIMIIILYSNLHFIKKYVIAQIRAYSVAGGIAEEILSSVRTVVAFNAQESEVNRYSKNLVKAKSLGIKKSIVQGIGSGCVGLSVFSIGSLVFYVGLLLINSEN-YDPGTVIQVFLTIVLGSISIGYAAPLIENFMTAQAAAYSIFEVIDRVPSIDH-RKLGIIPDTFAKDIKFQNVTFQYSTRPGMTILDNFNFTIPYGKTVAFIGPSGSGKSTIIHLLQRFYDPLSGEVILGDQNVKDIDLNWYRSHIGVVQQEPPLFSGSIRENIQMGKLDATEDEIIKSTQYSNAYDFIMATKETFDTKLGDRGTGFSGGQKQRIAIATALIRDPQLLLLDEATSALDNKSEKLVQKTLDTTIAEGKRTIVMVAHRLQTVRNADIIVVMKNGKIVEQGNHSSLLAQHGLYWEMLGTQE 628          

HSP 2 Score: 325.094 bits (832), Expect = 3.146e-94
Identity = 209/581 (35.97%), Postives = 340/581 (58.52%), Query Frame = 2
Query: 2324 LNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANP--NIEQQSADIRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDIAWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISFGFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECIENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLL----YNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPNIIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTXXXXXXXXXXXXXXXXXQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDK--AQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQ 4042
            +N+ +   I L  +S+I  G   P   ++F  ++  +  P  NI   SA IR  +   A +A  A ++S +Q++    +G++ ++R +S  F A+L+Q+I+WFD+     G + TR SD+   I     + L   I  +    +++ I+    W+++LV    +PI+ +     +  ++ +  +   A   +G IA E + ++RTV     + + +  Y + + K      KK+  QG   G    ++F   +  F + G LL+    Y+   +  VF++   ++ G++++G +  +  NF   + AA  +FE++DRVP I+     G++ D    + DIK +NV F Y  RP + IL++ +F I   +T+A +GPSG GKSTII LLQRFYD L+G +++ +  +KDI++   R    +V QEP LFS SIRENI  G      T+D+II + + SN +DFI+   + ++TK+G++G+ FSGGQKQRIAIA AL+R+P++LLLDEATSALD +SEK+VQ  LD   A+  RT V++AHRL T++NAD I+V K+GKI E G H  LL+++G+Y +M+  Q
Sbjct:   59 MNSMDILLISLTVISSIGIGVALPLNMLIFKDVVNLLVLPTGNINFSSA-IRNPINYFAILASGALIASFVQSICISVTGKRQSRRYKSNYFAALLRQEISWFDK--QQTGQMITRFSDDIDSIEVAISDKLAQFIQQLSLFFSSIIIAATSGWKLTLVGCMAIPIMIIILYSNLHFIKKYVIAQIRAYSVAGGIAEEILSSVRTVVAFNAQESEVNRYSKNLVKAKSLGIKKSIVQGIGSGCVGLSVFSIGSLVFYV-GLLLINSENYDPGTVIQVFLT---IVLGSISIGYAAPLIENFMTAQAAAYSIFEVIDRVPSIDHRKL-GIIPD--TFAKDIKFQNVTFQYSTRPGMTILDNFNFTIPYGKTVAFIGPSGSGKSTIIHLLQRFYDPLSGEVILGDQNVKDIDLNWYRSHIGVVQQEPPLFSGSIRENIQMGKLDA--TEDEIIKSTQYSNAYDFIMATKETFDTKLGDRGTGFSGGQKQRIAIATALIRDPQLLLLDEATSALDNKSEKLVQKTLDTTIAEGKRTIVMVAHRLQTVRNADIIVVMKNGKIVEQGNHSSLLAQHGLYWEMLGTQ 627          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB18.937e-17048.62ATP binding cassette subfamily B member 1 [Source:... [more]
ABCB18.937e-17048.62ATP binding cassette subfamily B member 1 [Source:... [more]
ABCB12.283e-16746.48ATP binding cassette subfamily B member 1 [Source:... [more]
ABCB45.241e-16748.37ATP binding cassette subfamily B member 4 [Source:... [more]
ABCB45.241e-16748.37ATP binding cassette subfamily B member 4 [Source:... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgp-92.928e-16045.32p-GlycoProtein related [Source:UniProtKB/TrEMBL;A... [more]
pgp-12.693e-14542.95Multidrug resistance protein pgp-1 [Source:UniPro... [more]
pgp-25.944e-13942.13ABC transporter PGP-2; p-GlycoProtein related [So... [more]
pgp-26.656e-13942.13ABC transporter PGP-2; p-GlycoProtein related [So... [more]
pgp-28.121e-13942.13ABC transporter PGP-2; p-GlycoProtein related [So... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mdr509.672e-14143.84gene:FBgn0010241 transcript:FBtr0087537[more]
Mdr653.579e-13141.44gene:FBgn0004513 transcript:FBtr0077011[more]
Mdr497.284e-12739.02gene:FBgn0004512 transcript:FBtr0087801[more]
CG102262.331e-12539.09gene:FBgn0035695 transcript:FBtr0332068[more]
CG102261.702e-12439.09gene:FBgn0035695 transcript:FBtr0077012[more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb42.355e-17648.38ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb51.053e-16847.22ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb51.292e-16847.22ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb11a9.854e-15144.17ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb11a1.995e-15044.17ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000003954.14.091e-10545.22bile salt export pump [Source:NCBI gene;Acc:100489... [more]
mia22.767e-17547.90MIA SH3 domain ER export factor 2 [Source:Xenbase;... [more]
mia23.893e-17448.05MIA SH3 domain ER export factor 2 [Source:Xenbase;... [more]
mia26.048e-17447.59MIA SH3 domain ER export factor 2 [Source:Xenbase;... [more]
mia21.038e-17347.89MIA SH3 domain ER export factor 2 [Source:Xenbase;... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcb1a2.755e-17048.53ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb1b3.311e-17049.19ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb41.647e-16446.43ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb45.928e-16146.48ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb51.263e-14945.06ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21448|MDR1_CRIGR3.938e-17148.86ATP-dependent translocase ABCB1 OS=Cricetulus gris... [more]
sp|P21447|MDR1A_MOUSE1.927e-16948.53ATP-dependent translocase ABCB1 OS=Mus musculus OX... [more]
sp|P06795|MDR1B_MOUSE2.316e-16949.19ATP-dependent translocase ABCB1 OS=Mus musculus OX... [more]
sp|P21449|MDR2_CRIGR2.551e-16949.03Multidrug resistance protein 2 OS=Cricetulus grise... [more]
sp|P08183|MDR1_HUMAN4.292e-16948.62ATP-dependent translocase ABCB1 OS=Homo sapiens OX... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ530.000e+098.08Slc24a-6 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A8WG281.091e-11448.23Zgc:172149 protein OS=Danio rerio OX=7955 GN=abcb4... [more]
A0A4W4E7J02.842e-10946.42ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
A0A4W4E8111.373e-10345.55ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
E9G5N83.135e-10747.10ABC transporter, subfamily ABCB/MDR OS=Daphnia pul... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb54.145e-16546.85ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb45.596e-16246.11multidrug resistance protein 1 [Source:NCBI gene;A... [more]
abcb42.547e-16045.94multidrug resistance protein 1 [Source:NCBI gene;A... [more]
abcb52.723e-15646.47ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb59.057e-15644.35ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB17.324e-17448.01ATP binding cassette subfamily B member 1 [Source:... [more]
abcb11b6.433e-14143.62ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
ENSPMAT00000001786.11.162e-13544.98pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-... [more]
abcb103.491e-9435.74ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb88.639e-9135.93ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MDL11.269e-7233.63Mitochondrial inner membrane half-type ABC transpo... [more]
MDL26.723e-7033.54Mitochondrial inner membrane half-type ABC transpo... [more]
STE62.204e-5526.90Plasma membrane ATP-binding cassette (ABC) transpo... [more]
ATM11.506e-5332.08Mitochondrial inner membrane ATP-binding cassette ... [more]
YCF11.026e-3338.03Vacuolar glutathione S-conjugate transporter; ABC-... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO497371.070e-16152.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488461.135e-14542.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419303.288e-10438.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459261.042e-9839.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391308.164e-8432.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb47.974e-17547.39ATP binding cassette subfamily B member 1 [Source:... [more]
abcb43.033e-16747.55ATP binding cassette subfamily B member 1 [Source:... [more]
abcb11a3.977e-15345.52ATP binding cassette subfamily B member 11 [Source... [more]
ABCB41.080e-14448.15multidrug resistance protein 1-like [Source:NCBI g... [more]
abcb11b1.708e-14144.43bile salt export pump [Source:NCBI gene;Acc:101163... [more]
back to top
BLAST of Multidrug resistance protein 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004996.13.731e-100100.00SMESG000004996.1[more]
SMESG000030111.10.000e+0100.00SMESG000030111.1[more]
SMESG000030111.19.688e-131100.00SMESG000030111.1[more]
SMESG000027395.15.474e-12940.16SMESG000027395.1[more]
SMESG000027395.12.376e-12740.10SMESG000027395.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021731 ID=SMED30021731|Name=Multidrug resistance protein 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7813bp
TTTAAATAATAGACTAAATTTACCTTTTTGGGTTGATTATTTATTAATTA
GAAAAAATATCTTTAAGAAATAAATTTAATTTTTTCTGATTTGAAAATGA
CAATATCAAAAGTGAAAGTTTCAAACGATGAAACTGAGAAAACTGACATT
CCAACACGTGAAAATGCCATCTACCGGGCATACGATTTGGAGAATCCCGG
ATTTGAAAGATCTGACAGTGTTCATTCCAAAATATCCAAGCATTCAATCG
AGAAAATTAAAAAGAGTAAAAATAAAAAGAAAGCAGAAATAAAATCAGTC
GGTGTTGGCAAATTGTTTTCCTATGCAACTTGCAGCGATATTGTGATGAT
GATATGTGCTATTATCATGTCAATTGGAATGGGAGTGACTTGGCCGTTGA
TTATTTTAGTATTCGGAAACACGACAAGTCAAATGGCAACTTATCAGTAT
TACATGAATAGCTTGACTCAATTTTTGACATCACAAAATGAGCCAATCAC
ATCTTCTACCTCAATACCAGATATGGAAGAAATAGTGAGAAACAAAAAAT
ATAATTTCACATTGAGTTCATCAAATATTTTTACACTAATGAGTGGAATG
TCCCAACAGTTTGCAGGAATCGCTCTTGCAATGTTTATCATGTCCTACGT
CTCAGTCACATTCTTTGTTATCACTTCTCAACATCAAATATCTGCAATAC
GGAACGCTTTTTTCAGGGCAGTAATGAGACAGAATATCGGGTGGTTTGAT
GCCCAAAACAGTGGAGCTTTAACAAATAAACTTGTAGATGACATAAATAC
TGTACATGCTGGCATCGGTGATAAAATTGGTCAAATGATGCAATGGTACG
CATGTTTCATTGGTGGTATCATTCTTGCCTTCGTCAGAGGTTGGAAATTA
ACTTTGGTAACATTGTCCATATCGCCATTAATCATAATCTGTATGTTAAT
GTTGTCAAAGACTATGATGAAATTGACACAAAAGGCTTCAGAAGCCTATG
GCAAAGCCGGTGGTATAGCCGAAGAAGTGCTAGGATCAATACGTACAATC
GTGTCATTTAGAGGAGAAAAATATGAAGTTGCTAGATACACAGAAAATTT
AGACGAGGCTTGTAAAATCGGAATTAGAAAAAGTATTCTAACTGGGACTT
TATTGGGATTAGTAATGGGTTTAATGTTCGGCTCTTATGCTTTGGGATTC
TGGTACGGTGCATCATTAATTAGAGAAGGAAATGGTTTCTTAGTCGGAGA
CATGCTAATTGTATTTTTCTCATGTTTAATGGCAACTACTGGTATAGGTC
AAGCAACTCCACATATGGGGTCGTTTAATGAAGCTCGTAGTGCAGCTGCG
GAAATTTTCGAAATAATTGACCGAGTTCCAGAAATAGATAAAATGAATGA
GGAAGGAGATAAATTAAATGATTTTCAAGGAAAAATAACATTCAAATACG
TGAAATTTACCTATCCAACCAGAACTGATTGTCCGATATTGACAGGTTTA
TCCTTATCTATTCAACCGGGTCAAACAGTGGCACTTGTGGGGGCCAGTGG
TTGTGGAAAATCGTCATTAATTCAATTAATGCAGCGATTTTACGATTCAA
ATGAAGGAGAAGTTTTGATTGATGACACCAACATAAAAGACCTAAATGTA
ATGTGGTTACGGGAACAGATTGGTGTAGTGTCGCAAGAACCGGTTTTGTT
TGGCTGCTCAATAAAAGAAAACATTCGTTACGGTAGAATGGACGTTACAG
ATGAAGAAATTGACCAAGCTTTGGTGATGGCTAATGCGAAAACATTTATC
AATGCTTTGCCGAATAAATTGGATACATTAGTTGGTGACAGAGGAACTCA
ACTTAGTGGTGGTCAAAAACAAAGAATTGCGATTGCTCGAGCCTTAGTAA
GGAATCCGAAAATTCTTCTATTGGATGAAGCAACATCTGCTTTGGATTCG
GAAAGTGAAAAAATTGTTCAAGATGCTCTTGATAAAGTTGTTGAAGGTCG
AACCACTATAATTGTAGCACACAGATTATCTACTGTACGCAATGCTCATG
TCATTTTCGGTATTAAAGATGGCAAAGTTCAAGAGCAAGGAACTCATGCC
GAACTCATGGCTCTCAATGGTCTTTATAAAGATTTAGTTGATAGGCAAAA
AAATAGACCATGGACAAAAAGGAGAGAAAGAAGAGATTTATGTTAATGTT
GATGAAGAAATTATCAAAGAAAGTCCTACAAAAAGACTCTCTGTAGCCAA
AATTGAAGAAGTTATTGAAGAAAATAAAGAAATTGTTAAAAAAAGTTCAG
CTGGATTTTTTAAAGTTATGGGACTTAATGCCCCAGAGAAATGTTACATT
TTCCTTGGATGTGTTTCTGCTATATTTAATGGTGCCGTTCAGCCATCATT
TTCTATTCTTTTCGGATTTTTACTTCCTGCAATGGCAAATCCAAACATTG
AGCAACAGTCTGCTGATATCCGAACTTATGTGATAGCGTTAGCTGGAATC
GCTGTTGTGGCATTTGTTTCAAGTGTTTTACAGAACGTAGGATTTGGAAA
TTCTGGAGAACAATTGACCAAAAGATGTCGAAGTATCACATTTGAAGCAA
TGTTAAAACAGGATATTGCATGGTTTGATGAGCCGAGTAACAATATCGGT
GCGTTAACCACGAGATTGTCTGACGAAGCCACACAAATTAGAGGAGTATC
TGGTGAAAGTTTAGGGGCTGTTATCACAGCCATTTGTTCTATGGGTGCCG
CGGTTGCTATTTCATTCGGTTTTTGTTGGCAGATCTCATTAGTGGTATTA
GCGTTTGTGCCTATAATTTTCGTTGGGGGTATTTTGCAAATTCGAATAAT
GCAAGGATTTTCAAATTCTGATAAAGGAGCCTTAGAGGAATCCGGAAAAA
TTGCTGTTGAATGTATTGAAAATATTAGGACGGTATCAAATCTAACTCGA
GAGCATACTTTTATTCAACATTATAAAGAGGCTATAAAAAAACTTGATGG
AGAAGTTTCAAAAAAGGCCCATGCTCAAGGGTTTTTGTATGGTTTAACAC
AGGCAGCAATATTCTGTGCCTATGCAGCTACTTTCATGTTAGCAGGTTAT
TTGCTGCTCTATAATATGTCCAAAATGACTAACGTTTTCATATCTTTTGG
AGCTCTAATTTTTGGAGCAATGAATCTCGGAAAATCCATGGCGATGGCAC
CGAATTTTGGAAAAGGGAAAATTGCGGCAGCTCACATGTTTGAACTGCTT
GACCGAGTCCCTCCGATTAATTCATTTTCTACAGATGGTGTAGTTTTAGA
TGTTGAAAATATGTCGGGTGATATAAAAATAGAAAATGTGAAATTTAGCT
ATCCACTGAGACCAAATATTATTATATTAAATGACGTTAGTTTCAACATA
AACTCCAATCAAACAATCGCTCTGGTCGGTCCTAGTGGATGTGGGAAATC
AACAATCATTGGTTTGCTGCAAAGGTTCTATGACACCTTGAATGGAAATA
TATTGATAGACAACAATAAAATCAAAGACATCAATATACAGAATCTCCGG
CAATTATTCAGCATAGTTTCTCAAGAGCCTACCTTGTTTTCTTACTCCAT
CAGAGAAAATATTGCATATGGAGACTCTGCCAAGATTTTTACTGACGATC
AAATTATTGCAGCGGCTAAAGCTTCGAATATTCATGATTTCATTGTCAAT
TTACCAGATCAATACGAAACAAAGGTTGGAGAGAAAGGAAGCAATTTCAG
TGGAGGTCAAAAACAAAGAATAGCTATCGCTCGTGCCTTATTAAGAAATC
CAAGGATTTTATTGCTAGACGAAGCTACATCGGCTTTAGATACAGAAAGT
GAAAAAATTGTACAGGACGCCCTTGATAAGGCTCAGGAAGGCCGAACCTG
TGTAGTAATAGCTCACCGACTGTCAACGATTCAGAATGCTGACAAAATTC
TAGTATTCAAAGATGGCAAAATTGCCGAAAGTGGAACTCATTTTGAACTT
TTGAGTAAAAATGGTATTTATTCACAAATGATAAGCCTTCAGTCTCACAA
ATGAATTGTTCAATGATTTAAAGAGGGAACTTATTTTTGTCCGTGAATTT
ATTCTTGGCTGTGAATTTTGGGATTTAAATTTTTGACTGGTTGATAATTA
GATTTTTTTTAAAAATATAAAATGTGAATTTTGAAATAACTGTTAATGAT
AAATTTGAACAAATTCAAGGAAATTTTTGATGCGTGTTTACGACTACGTT
ATTTTAATCTATTTCCTTAAGAAATTCAATGATTTATACGAAACGAAGAC
TACAATTTGTAAAAATTCAATTGTAATTATGTAATCTAGAAATTTTTCTT
TCTTGCTTTTACGTTTGCAAAATCGTGAATAACTCATTTTGTTGCTACTT
TATGCAAAATGGATAGCAAAGCGAGATTTCGCAGCCTGCTTTGGCCAATT
GAATTTCTTTTGCACTCCTTTATAATTTTCAGTTTGTTGAATGAGCTTTT
AACACTAGCTACTGAAACCGGAAGTGTCAAGAACAACATTAAATCAGTAT
AGATTTCCGAAAATTCACTTGCTAGACAGCTGTACTTAGTGAGAAGTAAT
TCTGAAAAAGTTTTTATGGACATGCTTTCCTTTAGTTCCTTTTTTACTAG
AGATAATCAAAATGATTATAGTACTTGGCACGCATAAGAAAATTTTCAAT
CCAATAAAATTCCAATCTACTCTGAAAACTGGCTGTTATTATTTTGTTTT
TACTCACAACGTGGTTTTCAGTTAGACTGGTTATTTTTGTTCCATACTGG
ATTACGATTATTTAGGAATACGACGTTCTCTGTATGTTGTTCCTTTGTTT
GTTGTTTTCATCAAAAAATCGTCCCATTACCACTCTGAACATTTTAAAAT
ATTTACAAATTTCATATATTTTCGGTTGTTCATTAAAATTTGCTAACAGC
GTAGTCGCCATATTTTGTGGTCACTCCCTTTTCTGCACTCCTGGTATTTA
TTACGTGCATTATTAATAATTGAGAAATTCGAATAGAGTAAAGTTTATAT
TTTATCATGGCAAAAGTATAAGAAATAGATGGGGAAATAGAAATGGGGAA
AATAAGTTTTTATATACTTTTATAATTTACTTTTATAATTTAATATATTT
TTTCTATTTGCATTTCAATATGCATTTTATTCTGAATTTTACAAATATAT
AAAATTCAAAATAAAATGCATAGTGAAATTCAAATAGAACAATTATATTA
AAGCGATAATAATAATCTGATTAGAGTTTTGCTAAATAATCCCAAGGAAT
TTTGATTTTTACGAATACGATAATGAGATGTTTTTTTTAAATCTATTTCT
TTTTTTTTATTTGAAAATTTTTTAAACTTTCTGTTTCTGAATGTCCTGAC
AAACAATGGTCCCACGATTGCTATCAGAATGGTCACCGTGACAAATAAAC
AAAAATTAGCCCAACATAGTGGGATATATTTGCTAAGTCCTTCGTAAAAT
ACACAAACCACATCTCCTATTGACGGAAAATTGGCCATAAAAATTTCGAC
AAATAAAACAGATAACAGTTTTAACAAATTCAACGCAAAAAAAGGATTCT
TGTGATTTTCTATGTGCAAATACTCACATTCGTTTATATTTACAAATCCT
GTACTTTTTGTGGTGTCATCAACCAATATCAATTCCATATTCGTGTATTC
TTCTGGGATAATTTCATCAAACAGAATTGACAGTTTATTTTCAATGTCAT
ACAAAACTTAATGATACGATTTTCCATATAAATATTGTACTTATAATCAT
AATAAGTGCAATTAATAATTTACACTAGATTGATCATAATCATCATATTT
TTCTTCTGCTTTAATAATTTTCCATATTGGTTTGATTCTGTCCTTGGTTA
CATTGTATCCTTGTATCAGCACAGTTATCATGCACTTTATTGTGCTCATC
TTTTCCTGGTTAGGAATAATGTCCAAATCACATTTGACGAACATTTTGTC
TTCAATAAATTGTATGTCTTCGTGCATTTTGGTAAAAGATTGACTGAGAA
TCTTGTCATCAAACTTTATATTTGAAAATCGAAACATTTTTCTACAGTAA
TCTGATTCTATAAAATAAATAAAAATCAACTTACTTTAAAAATATAAATT
ATTGGAAAGTACAAATAATTTAATTTGTACTGTAAAAATTCTACTGCTTT
CTTTGTATCTACTCAAATGAAGCATAGGTTTTCTAGAGGTAGAGTTCCTT
CTTTACATCATCGTTTGGAGTTTCGTGTTTGTCATCATCATTGGTTTTTC
TTTTTATTATTCCATTATTCTGACGAATCATTATAGTTTTCTTTTGATCC
ATTTAAGTATTCTGGTTACTTAGTTGATCCATTTGAAGTTATATTTTGAA
ATTTTTTCATTCACCTGTTATGCAGATCATCCATACCAAAAGATATATAC
AAATTGTTATCCAGACGAGACTCATAAGGAATGTGAGAAAGAAAAGTTTT
TTATAAATTCCTGGCCGCCTGCAATCAGGAATGGTGAGAAAGCATAAAAC
CGTTACGGGTAACATTGTGACCCAGTGAAGCCGAGAGACAAATGAGTCGG
GAATAGCAAACATTGATTCCAGTTTATCACCCTCAATGGAGTCTTCATTA
TCGCAACCATGAATTCTCTTATTAGTTTGAAAATTCGAATTCAGGTCTTC
TTTTTCTAAATCGTCATCGTTTTCACTATCTATCAAACTTTTTGCCAAAG
AGTCATTTTCATAAAATAGCGGTTTCTTTTCTGGATCTAATTTCCGTTTG
GATATTGGCAATAGTTTTACAACAATTTGGTAGACAGAATCATTTTTATA
CAACAATAAAATATATAATGAATATATTATCAACATTATTAGTCCTTCAT
ACCAGTGCACCAGTTCATCATTTAAGACAATAGTTAGAGTGATTATAGTT
ATACAATATATCATGCAATCTCGAAACACGGGCCACCAGGTAAGTTGAAT
AACCTTTCCTGCAAAGATCCCACAAATCGCTGTGACGCAGAGAACATTGA
ACAGGGCTGATCCAATGATTGTACTCACTCCTACATCGCTGTCAGTTATA
AAAACCGCAATTACGGCAGTACATAGCTCCGGTGCCGAACCGCCTAAGGC
CATAAAGGTAGCACCGGCTACGTCATGTCTCAAATGCAATACTTCACATA
TACTTTCTAAAGACGAAACGAAATAATCATCACACACAATAGCAATTGCC
ATGAAAAGGTAAGCTGACATAACAATATGGAATAAAACTCCTCCGTTCTT
CTTATCAACTCGTGTCATAAAATCATCAGGGAATTCCTCAACAGACCTTT
TAGTACAATTCGATAATGAGAGTAATTTTCGCGATTTGCCATCAAAATTT
GCATCTTTTCCCCCAATATCGTTGACTTTCAAAAAGAAAATTGACCCAAA
AATCAGTGAAAAGTAACACAGGATTATTTTTAAAAAACTTTTATGTTTTT
TCACATTCATTTTTGAATATATTTATTAATATGAAATGTGAAATGTTATT
GAAGAGATTGTCAAATTCCAACCTAGTCCGAAGTGTTGCAAATAGATTAG
AGTGATAATGTCCAACTCTAGTGACACTTAAAGCGATTTAAAGAGAGTAA
TGTAAATATTTAATATTTTCCAAATACTTGAATTTAATAAACTTAATTTA
ACAATAATAAACCGTCTTTTAAAACGCTGTCAAATTGTCTAATTAAAACA
ATTCAAGCTCAAAATATGCAATCTTTTTATTTTGTAAAATGCGAGAGAGT
GTAAAGGACAAAA
back to top

protein sequence of SMED30021731-orf-1

>SMED30021731-orf-1 ID=SMED30021731-orf-1|Name=SMED30021731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MGLNAPEKCYIFLGCVSAIFNGAVQPSFSILFGFLLPAMANPNIEQQSAD
IRTYVIALAGIAVVAFVSSVLQNVGFGNSGEQLTKRCRSITFEAMLKQDI
AWFDEPSNNIGALTTRLSDEATQIRGVSGESLGAVITAICSMGAAVAISF
GFCWQISLVVLAFVPIIFVGGILQIRIMQGFSNSDKGALEESGKIAVECI
ENIRTVSNLTREHTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFC
AYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKG
KIAAAHMFELLDRVPPINSFSTDGVVLDVENMSGDIKIENVKFSYPLRPN
IIILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTLNGNILIDNN
KIKDINIQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAA
KASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLL
DEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDG
KIAESGTHFELLSKNGIYSQMISLQSHK*
back to top

protein sequence of SMED30021731-orf-2

>SMED30021731-orf-2 ID=SMED30021731-orf-2|Name=SMED30021731-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MNVKKHKSFLKIILCYFSLIFGSIFFLKVNDIGGKDANFDGKSRKLLSLS
NCTKRSVEEFPDDFMTRVDKKNGGVLFHIVMSAYLFMAIAIVCDDYFVSS
LESICEVLHLRHDVAGATFMALGGSAPELCTAVIAVFITDSDVGVSTIIG
SALFNVLCVTAICGIFAGKVIQLTWWPVFRDCMIYCITIITLTIVLNDEL
VHWYEGLIMLIIYSLYILLLYKNDSVYQIVVKLLPISKRKLDPEKKPLFY
ENDSLAKSLIDSENDDDLEKEDLNSNFQTNKRIHGCDNEDSIEGDKLESM
FAIPDSFVSRLHWVTMLPVTVLCFLTIPDCRRPGIYKKLFFLTFLMSLVW
ITICIYLLVWMICITGE*
back to top

protein sequence of SMED30021731-orf-3

>SMED30021731-orf-3 ID=SMED30021731-orf-3|Name=SMED30021731-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MELILVDDTTKSTGFVNINECEYLHIENHKNPFFALNLLKLLSVLFVEIF
MANFPSIGDVVCVFYEGLSKYIPLCWANFCLFVTVTILIAIVGPLFVRTF
RNRKFKKFSNKKKEIDLKKTSHYRIRKNQNSLGLFSKTLIRLLLSL*
back to top

protein sequence of SMED30021731-orf-4

>SMED30021731-orf-4 ID=SMED30021731-orf-4|Name=SMED30021731-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=700bp
MTISKVKVSNDETEKTDIPTRENAIYRAYDLENPGFERSDSVHSKISKHS
IEKIKKSKNKKKAEIKSVGVGKLFSYATCSDIVMMICAIIMSIGMGVTWP
LIILVFGNTTSQMATYQYYMNSLTQFLTSQNEPITSSTSIPDMEEIVRNK
KYNFTLSSSNIFTLMSGMSQQFAGIALAMFIMSYVSVTFFVITSQHQISA
IRNAFFRAVMRQNIGWFDAQNSGALTNKLVDDINTVHAGIGDKIGQMMQW
YACFIGGIILAFVRGWKLTLVTLSISPLIIICMLMLSKTMMKLTQKASEA
YGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLDEACKIGIRKSILTG
TLLGLVMGLMFGSYALGFWYGASLIREGNGFLVGDMLIVFFSCLMATTGI
GQATPHMGSFNEARSAAAEIFEIIDRVPEIDKMNEEGDKLNDFQGKITFK
YVKFTYPTRTDCPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYD
SNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDV
TDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARAL
VRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNA
HVIFGIKDGKVQEQGTHAELMALNGLYKDLVDRQKNRPWTKRRERRDLC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
IPR003593AAA+_ATPase
IPR011527ABC1_TM_dom
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
IPR004837NaCa_Exmemb
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0008559xenobiotic-transporting ATPase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006855drug transmembrane transport
GO:0042908xenobiotic transport