Protein-tyrosine phosphatase mitochondrial 1-like protein

Overview
NameProtein-tyrosine phosphatase mitochondrial 1-like protein
Smed IDSMED30021722
Length (bp)928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein-tyrosine phosphatase mitochondrial 1-like protein (SMED30021722) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein-tyrosine phosphatase mitochondrial 1-like protein (SMED30021722) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein-tyrosine phosphatase mitochondrial 1-like protein (SMED30021722) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein-tyrosine phosphatase mitochondrial 1-like protein (SMED30021722) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021722

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021722SMESG000010568.1 Contig2508GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021722SMESG000010568.1 dd_Smed_v4_6276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021722SMESG000010568.1 dd_Smed_v4_6276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30021722SMESG000010568.1 dd_Smed_v4_6276_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Match: PTPMT1 (protein tyrosine phosphatase mitochondrial 1 [Source:HGNC Symbol;Acc:HGNC:26965])

HSP 1 Score: 101.293 bits (251), Expect = 3.627e-25
Identity = 54/178 (30.34%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + L + K+     RD Y+RI   +LLG+LP+ S    + + EN++G++ + E +E +    S ++ K   +  L L   D    P+LD ++ GV F    +S    VYVHCKAGRSRSA +V  Y+++    +PE+A++ + + RS + +    +  + +++  I 
Sbjct:   10 GLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQIT 187          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Match: PTPMT1 (protein tyrosine phosphatase mitochondrial 1 [Source:HGNC Symbol;Acc:HGNC:26965])

HSP 1 Score: 101.293 bits (251), Expect = 3.627e-25
Identity = 54/178 (30.34%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + L + K+     RD Y+RI   +LLG+LP+ S    + + EN++G++ + E +E +    S ++ K   +  L L   D    P+LD ++ GV F    +S    VYVHCKAGRSRSA +V  Y+++    +PE+A++ + + RS + +    +  + +++  I 
Sbjct:   10 GLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQIT 187          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 60.4622 bits (145), Expect = 1.604e-9
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +PV D F    L  +   V FIE   +  G V VHC AG SRSA I + Y+MK M+++ ++A ++VKE+R  +
Sbjct:  206 FLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTI 281          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 60.4622 bits (145), Expect = 1.604e-9
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +PV D F    L  +   V FIE   +  G V VHC AG SRSA I + Y+MK M+++ ++A ++VKE+R  +
Sbjct:  206 FLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTI 281          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 53.5286 bits (127), Expect = 6.134e-8
Identity = 38/131 (29.01%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  103 RITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVR 486
            +IT  L LG   V S    +Q     +GI  +V +       + I         Y+ +P+ D  ++P     D +   +  +    G   VHC AG SRSA + + Y+MK  N+   +A  +VK RR V+R
Sbjct:   29 QITSSLFLGRGSVASNRHLLQA----RGITCIVNA------TIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIR 149          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Celegans
Match: F28C6.8 (pep chromosome:WBcel235:II:8606849:8607749:1 gene:WBGene00009207.1 transcript:F28C6.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.8)

HSP 1 Score: 110.153 bits (274), Expect = 5.718e-29
Identity = 59/173 (34.10%), Postives = 95/173 (54.91%), Query Frame = 1
Query:   25 IKELSFYTSFAWGLLQT--KLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRN--ILYLHLPVKDFFYSPSLDQIKSGVGFIESCPG---TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            +  L FY S  + L +   +      YNR+ + L+LG++P  S  D + + EN+ G++   E FELK    ++ +   +N  + +  +P+KDF  +    +I   V FIES      TVYVHCKAGR+RSA +  CY+MK+ N     A +++K++R  V L   H + +N+Y
Sbjct:    2 LTSLIFYPSLGYNLFRNYVQPNRWAWYNRVDETLILGAMPFRSMKDELIQKENVGGVVCCTEEFELKAAMNAMREVDWKNEGVEFFAVPMKDFTGTAPRAEINEAVEFIESVASKGKTVYVHCKAGRTRSATVATCYLMKSRNWMSNVAWEFLKDKRHQVLLRNAHWRTVNEY 174          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Celegans
Match: F28C6.8 (pep chromosome:WBcel235:II:8606849:8607749:1 gene:WBGene00009207.1 transcript:F28C6.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.8)

HSP 1 Score: 94.3597 bits (233), Expect = 1.672e-23
Identity = 48/135 (35.56%), Postives = 76/135 (56.30%), Query Frame = 1
Query:  133 LPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRN--ILYLHLPVKDFFYSPSLDQIKSGVGFIESCPG---TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            +P  S  D + + EN+ G++   E FELK    ++ +   +N  + +  +P+KDF  +    +I   V FIES      TVYVHCKAGR+RSA +  CY+MK+ N     A +++K++R  V L   H + +N+Y
Sbjct:    1 MPFRSMKDELIQKENVGGVVCCTEEFELKAAMNAMREVDWKNEGVEFFAVPMKDFTGTAPRAEINEAVEFIESVASKGKTVYVHCKAGRTRSATVATCYLMKSRNWMSNVAWEFLKDKRHQVLLRNAHWRTVNEY 135          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Celegans
Match: T12B3.1 (pep chromosome:WBcel235:IV:7382415:7384752:1 gene:WBGene00020444.1 transcript:T12B3.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12B3.1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.331e-7
Identity = 42/155 (27.10%), Postives = 77/155 (49.68%), Query Frame = 1
Query:  109 TDKLLLGSLPVESKWDAIQ-----KSENIKGILALVESFE---------LKKFAMSIEKAKLRNILYLHLPVKDF-FYSPS--LDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            +D L +  L VE  +D++      K+  I+ ++ L ES E            F+   E      I + + P+ DF   +P+  LD +K  V F  S  G + VHC AG  R+ +++  ++M A+ ++P QA+  V+ RR+    + E +K ++++
Sbjct:   76 SDILAMARLQVE-HFDSLGIVEKFKTNGIQSVINLQESGEHSFCGSGNLTSGFSYDPENLMRNGIYHYNFPLPDFQACTPNRLLDIVKV-VDFALS-HGKIAVHCHAGHGRTGMVIAAWMMYALGMSPSQAVDTVRSRRAKAVQSKEQVKTLHEF 227          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Celegans
Match: Y54F10BM.13 (pep chromosome:WBcel235:III:2329577:2331183:-1 gene:WBGene00021867.1 transcript:Y54F10BM.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10BM.13)

HSP 1 Score: 49.2914 bits (116), Expect = 9.804e-7
Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESC---PGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTG 495
            YL + + D   +  +D  +    FI+      G V++HC AG SRSA  VV Y+MK + ++  +A+   +E RS+   TG
Sbjct:  129 YLQIDILDLPETRIIDYFERVFEFIDKVRQNEGIVFIHCNAGISRSATFVVAYLMKNLKISCREAMDKCRETRSIRPNTG 208          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Match: PTPMT1 (gene:FBgn0039111 transcript:FBtr0084454)

HSP 1 Score: 108.227 bits (269), Expect = 4.202e-28
Identity = 58/184 (31.52%), Postives = 101/184 (54.89%), Query Frame = 1
Query:   34 LSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIES-CP-----------------GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAH 531
            +SFY +  + +L  K   R+ Y+RI + ++LG+LP  S+ + + + EN+K ++++ E +EL  F+ + EK +   I +L L   D F SP+ +++  GV FI    P                 G+VYVHCKAGR+RSA +V CY+M      P+QA+ ++++ R  + L  +    +  +Y +
Sbjct:    5 VSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTN 188          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Match: PTPMT1 (gene:FBgn0039111 transcript:FBtr0084453)

HSP 1 Score: 108.227 bits (269), Expect = 4.790e-28
Identity = 58/184 (31.52%), Postives = 101/184 (54.89%), Query Frame = 1
Query:   34 LSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIES-CP-----------------GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAH 531
            +SFY +  + +L  K   R+ Y+RI + ++LG+LP  S+ + + + EN+K ++++ E +EL  F+ + EK +   I +L L   D F SP+ +++  GV FI    P                 G+VYVHCKAGR+RSA +V CY+M      P+QA+ ++++ R  + L  +    +  +Y +
Sbjct:   11 VSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTN 194          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0301612)

HSP 1 Score: 50.8322 bits (120), Expect = 1.056e-6
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  358 VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            V VHCK G SRSA +V+ Y MKA     +QA+++VK+RRS ++    +  F+NQ
Sbjct:  465 VLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIK---PNKNFLNQ 515          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0301613)

HSP 1 Score: 50.8322 bits (120), Expect = 1.133e-6
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  358 VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            V VHCK G SRSA +V+ Y MKA     +QA+++VK+RRS ++    +  F+NQ
Sbjct:  464 VLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIK---PNKNFLNQ 514          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0084800)

HSP 1 Score: 50.8322 bits (120), Expect = 1.170e-6
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  358 VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            V VHCK G SRSA +V+ Y MKA     +QA+++VK+RRS ++    +  F+NQ
Sbjct:  465 VLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIK---PNKNFLNQ 515          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Match: ptpmt1 (protein tyrosine phosphatase mitochondrial 1 [Source:ZFIN;Acc:ZDB-GENE-070112-272])

HSP 1 Score: 102.834 bits (255), Expect = 4.181e-26
Identity = 51/168 (30.36%), Postives = 91/168 (54.17%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
            FY + A+ ++  K+ +R  +NR+   ++LG+LP  S  + + ++E ++G++ + E +E K F  S E+ +   +  + L   D    PSL+ I  GV F         +VY+HCKAGRSRSA I   Y+++    +PE+A K +   R  V +    ++ + +YY  +
Sbjct:   10 FYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVITMNEEYETKYFCNSAEEWQSVGVEQIRLDTVDLTGVPSLEHIHKGVDFALRHREQGSSVYIHCKAGRSRSATIAAAYLIRLHCWSPEEACKMLASVRPHVLIRSSQLEMLQKYYKQV 177          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Match: ptpmt1 (protein tyrosine phosphatase mitochondrial 1 [Source:ZFIN;Acc:ZDB-GENE-070112-272])

HSP 1 Score: 89.7373 bits (221), Expect = 1.838e-21
Identity = 43/131 (32.82%), Postives = 74/131 (56.49%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMK 423
            FY + A+ ++  K+ +R  +NR+   ++LG+LP  S  + + ++E ++G++ + E +E K F  S E+ +   +  + L   D    PSL+ I  GV F         +VY+HCKAGRSRSA I   Y+++
Sbjct:   10 FYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVITMNEEYETKYFCNSAEEWQSVGVEQIRLDTVDLTGVPSLEHIHKGVDFALRHREQGSSVYIHCKAGRSRSATIAAAYLIR 140          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Match: dusp16 (dual specificity phosphatase 16 [Source:ZFIN;Acc:ZDB-GENE-040426-2360])

HSP 1 Score: 57.3806 bits (137), Expect = 8.057e-9
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCPGT---VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            +L +PV D F    L  +   V FIE    +   V VHC AG SRSA I + Y+MK M++  ++A ++VKE+R  +     +  F+ Q
Sbjct:  206 FLRVPVNDSFCEKILPWLDRSVEFIEKAKASNARVLVHCLAGISRSATIAIAYIMKRMDMTLDEAYRFVKEKRPTI---SPNFNFLGQ 290          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Match: dusp1 (dual specificity phosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2018])

HSP 1 Score: 54.6842 bits (130), Expect = 5.078e-8
Identity = 32/95 (33.68%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESC---PGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV----RLTGEHMKFINQYYA 528
            Y  +PV+D   +         + FI+S     G V+VHC+AG SRSA I + Y+M+   +  E+A ++VK+RRS++       G+ ++F +Q  A
Sbjct:  231 YKSIPVEDNHKANISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLA 325          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 53.5286 bits (127), Expect = 5.231e-8
Identity = 43/144 (29.86%), Postives = 67/144 (46.53%), Query Frame = 1
Query:  103 RITDKLLLGSLPVESKWDAIQKSENIKGILALVE-SFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            +IT  L LG   V S    +      KGI  +V  + EL  F          ++ Y+ +P+ D  +SP     D +   +  +    G V VHC AG SRSA + + Y+MK   ++  +A  +VK RR V+R  G   + + +Y
Sbjct:   52 QITPSLFLGRGNVASNRSLLLS----KGITCVVNATIELPNF-------NWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEY 184          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Match: pnpt1 (polyribonucleotide nucleotidyltransferase 1 [Source:Xenbase;Acc:XB-GENE-967251])

HSP 1 Score: 58.5362 bits (140), Expect = 5.050e-9
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCPGT---VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +PV D F    L  +   V FIE    +   V VHC AG SRSA I + Y+MK M+++ ++A ++VKE+R  +
Sbjct:  208 FLRIPVNDSFCEKILPWLDKSVDFIEKAKASNDRVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTI 283          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Match: pnpt1 (polyribonucleotide nucleotidyltransferase 1 [Source:Xenbase;Acc:XB-GENE-967251])

HSP 1 Score: 58.151 bits (139), Expect = 8.409e-9
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCPGT---VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +PV D F    L  +   V FIE    +   V VHC AG SRSA I + Y+MK M+++ ++A ++VKE+R  +
Sbjct:  201 FLRIPVNDSFCEKILPWLDKSVDFIEKAKASNDRVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTI 276          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Match: tor2a (torsin family 2, member A [Source:Xenbase;Acc:XB-GENE-5806617])

HSP 1 Score: 56.6102 bits (135), Expect = 1.832e-8
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIES---CPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHINP*KLL 552
            Y  +PV+D   +      +  + FI++     G V VHC+AG SRS  I + Y+MK      E+A +Y+K+RRS++      M  +  Y + I P K+L
Sbjct:  218 YKWIPVEDNHTADISSHFQEAIDFIDTIKRAGGRVLVHCEAGISRSPTICMAYLMKTRRFRLEEAFEYIKQRRSLISPNFSFMGQLLHYESEIFPSKVL 316          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Match: dusp8 (dual specificity phosphatase 8 [Source:NCBI gene;Acc:100036671])

HSP 1 Score: 56.6102 bits (135), Expect = 2.067e-8
Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCP---GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +P+ D +    L  + + V FIE      G V VHC AG SRSA + + Y+M++M L+ + A ++VKE+R  +
Sbjct:  196 FLRIPINDSYCEKILPWLTAAVEFIEKVELVNGKVLVHCLAGISRSAAVAIAYIMRSMGLSLDDAYRFVKEKRPSI 271          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Match: ibtk (inhibitor of Bruton tyrosine kinase [Source:Xenbase;Acc:XB-GENE-5755983])

HSP 1 Score: 54.299 bits (129), Expect = 1.049e-7
Identity = 31/95 (32.63%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCP---GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV----RLTGEHMKFINQYYA 528
            Y  +PV+D   +         + FI+S     G V+VHC+AG SRSA I + Y+M+   +  ++A ++VK+RRS++       G+ ++F +Q  A
Sbjct:  222 YKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLA 316          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Match: Ptpmt1 (protein tyrosine phosphatase, mitochondrial 1 [Source:NCBI gene;Acc:66461])

HSP 1 Score: 91.6633 bits (226), Expect = 3.490e-21
Identity = 50/178 (28.09%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + + + ++     RD Y+RI   +LLG+LP+++    +   EN++G++ + E +E +    + ++ K   +  L L   D    P+L  +  GV F    ++    VYVHCKAGRSRSA +V  Y+++  N +PE+AI+ + + RS + +    ++ + +++  I 
Sbjct:   78 GLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEIT 255          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Match: Ptpmt1 (protein tyrosine phosphatase, mitochondrial 1 [Source:NCBI gene;Acc:66461])

HSP 1 Score: 91.6633 bits (226), Expect = 3.490e-21
Identity = 50/178 (28.09%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + + + ++     RD Y+RI   +LLG+LP+++    +   EN++G++ + E +E +    + ++ K   +  L L   D    P+L  +  GV F    ++    VYVHCKAGRSRSA +V  Y+++  N +PE+AI+ + + RS + +    ++ + +++  I 
Sbjct:   78 GLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEIT 255          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Match: Ptpmt1 (protein tyrosine phosphatase, mitochondrial 1 [Source:MGI Symbol;Acc:MGI:1913711])

HSP 1 Score: 90.1225 bits (222), Expect = 1.215e-20
Identity = 47/153 (30.72%), Postives = 86/153 (56.21%), Query Frame = 1
Query:   88 RDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            RD Y+RI   +LLG+LP+++    +   EN++G++ + E +E +    + ++ K   +  L L   D    P+L  +  GV F    ++    VYVHCKAGRSRSA +V  Y+++  N +PE+AI+ + + RS + +    ++ + +++  I 
Sbjct:  102 RDWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEIT 254          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 60.8474 bits (146), Expect = 1.261e-10
Identity = 39/131 (29.77%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  103 RITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVR 486
            +IT  L LG   V S W  +Q     +GI  ++ +       + I         Y+ +P+ D  ++P     D +   +  +    G   VHC AG SRSA + + Y+MK  NL   +A  +VK RR V+R
Sbjct:   29 QITSSLFLGRASVASNWHLLQA----RGITCVINA------TIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIR 149          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 60.8474 bits (146), Expect = 1.261e-10
Identity = 39/131 (29.77%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  103 RITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVR 486
            +IT  L LG   V S W  +Q     +GI  ++ +       + I         Y+ +P+ D  ++P     D +   +  +    G   VHC AG SRSA + + Y+MK  NL   +A  +VK RR V+R
Sbjct:   29 QITSSLFLGRASVASNWHLLQA----RGITCVINA------TIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIR 149          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Match: sp|Q86BN8|PTPM1_DROME (Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster OX=7227 GN=PTPMT1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.801e-27
Identity = 58/184 (31.52%), Postives = 101/184 (54.89%), Query Frame = 1
Query:   34 LSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIES-CP-----------------GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAH 531
            +SFY +  + +L  K   R+ Y+RI + ++LG+LP  S+ + + + EN+K ++++ E +EL  F+ + EK +   I +L L   D F SP+ +++  GV FI    P                 G+VYVHCKAGR+RSA +V CY+M      P+QA+ ++++ R  + L  +    +  +Y +
Sbjct:   11 VSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTN 194          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Match: sp|Q8WUK0|PTPM1_HUMAN (Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Homo sapiens OX=9606 GN=PTPMT1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.742e-24
Identity = 54/178 (30.34%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + L + K+     RD Y+RI   +LLG+LP+ S    + + EN++G++ + E +E +    S ++ K   +  L L   D    P+LD ++ GV F    +S    VYVHCKAGRSRSA +V  Y+++    +PE+A++ + + RS + +    +  + +++  I 
Sbjct:   10 GLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQIT 187          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Match: sp|P0C089|PTPM1_RAT (Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Ptpmt1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.115e-23
Identity = 53/177 (29.94%), Postives = 97/177 (54.80%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKLG---FRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
            G+  + FY +  + + + ++G    RD Y+RI   +LLG+LP+ S    +   EN++G++ + E +E +    + ++ K   +  L L   D    P+L  +  GV F    +S    VYVHCKAGRSRSA +V  Y+++  N +PE+AI+ + + RS + +    ++ + +++  I
Sbjct:   10 GLARVLFYPTLLYTVFRGRVGGPAHRDWYHRIDHTVLLGALPLRSMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEILKEFHKEI 186          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Match: sp|Q66GT5|PTPM1_MOUSE (Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Mus musculus OX=10090 GN=Ptpmt1 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.576e-21
Identity = 50/178 (28.09%), Postives = 97/178 (54.49%), Query Frame = 1
Query:   22 GIKELSFYTSFAWGLLQTKL---GFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            G+  + FY +  + + + ++     RD Y+RI   +LLG+LP+++    +   EN++G++ + E +E +    + ++ K   +  L L   D    P+L  +  GV F    ++    VYVHCKAGRSRSA +V  Y+++  N +PE+AI+ + + RS + +    ++ + +++  I 
Sbjct:   10 GLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEIT 187          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Match: sp|Q9ZQP1|DSP8_ARATH (Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana OX=3702 GN=DSP8 PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 6.621e-18
Identity = 58/168 (34.52%), Postives = 92/168 (54.76%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLG--FRDAYNRITDKLLLGSLPVESKWDAIQKSE-NIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYY 525
            FY +  + +++ KL   FR  ++R+ + +LLG++P  S  D  Q  E  + G++ L E +E      S+ K+    I +L +  +D+ ++PS++ I   V FI    S   T YVHCKAGR RS  IV+CY+++  N+ PE A  YV+  R  V L     K + +YY
Sbjct:   54 FYPTLVYNVVRNKLESEFR-WWDRVAEFILLGAVPFPS--DVPQLKELGVCGVITLNEPYE-TLVPSSLYKSYC--IDHLVIATRDYCFAPSMEAICQAVEFIHRNASLGKTTYVHCKAGRGRSTTIVICYLVQHKNMTPEAAYSYVRSIRPRVLLAAAQWKAVVEYY 215          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Match: A0A0R3WV03 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS4578 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.108e-47
Identity = 79/179 (44.13%), Postives = 116/179 (64.80%), Query Frame = 1
Query:   10 MVINGIKELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESC--PG-TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            M+ + +KE+ FY S A+G L  KLG R  Y+RI DKL+LG+LP+  +WD I+  E I  ++++VE FE+K F +   +A  R I YL LPVKDF   P+ DQ+ +G+ FI+SC  PG +VY+HCKAGR+RSA IV CY M A +L PE+A+  ++ RR  +       + +  Y+  ++
Sbjct:    1 MMSSLMKEMKFYISLAYGALACKLGARTWYDRINDKLVLGALPILPEWDTIRLKEGISHVISMVEPFEIKSFVLGPGEAADRGIRYLSLPVKDFVGVPTNDQVDAGLDFIDSCQRPGDSVYIHCKAGRTRSAFIVTCYFMSAFDLPPEEAVAQIQSRRPHITFNSTQWRGLRNYFEFVH 179          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Match: A0A0R3UH32 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6595 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 9.764e-46
Identity = 81/169 (47.93%), Postives = 114/169 (67.46%), Query Frame = 1
Query:   25 IKELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESC--PG-TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            +KE+ FYTS A+G L   LG R  YNRI DK++LG+LP+ S WD IQ  E I  ++++VE FE+K F +   +A  + I YL LPV+DF   P+ DQ+ + + FI+SC  PG +VY+HCKAGR+RSA IVVCY M A +L+P++A+ +V+ RR  V  T  H + +  Y
Sbjct:  290 VKEVKFYTSLAYGALAWSLGSRSWYNRINDKVVLGALPILSAWDNIQAEEKISHVISMVEPFEIKAFVLGPREAAEKGISYLSLPVEDFVGVPTNDQVDAALDFIDSCREPGNSVYIHCKAGRTRSAFIVVCYFMSAFDLSPKEAVAWVQSRRPNVVFTSAHWQGLTNY 458          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Match: A0A0R3TT83 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10900 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.611e-45
Identity = 73/173 (42.20%), Postives = 117/173 (67.63%), Query Frame = 1
Query:   28 KELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESCPGT---VYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            KEL FY + A+G +  +LG R+ Y+RI DK++LG LP+   +D+ +  ENI  +++++E  E+K F +   +A  R + Y++LPV+DF   PS++Q+ +G+ FI+SC GT   VY+HCKAGR+RSA IVVCY M A +LN E+AI++V+  R  ++   + M+ +  Y+ H+ 
Sbjct:    7 KELKFYVTLAYGSVVCRLGLRNWYDRINDKIVLGGLPMLPDFDSTRTKENITHVISMIEPHEVKGFVLGPSEAAFRGLKYINLPVQDFVGVPSIEQVDAGLSFIDSCRGTDTSVYIHCKAGRTRSAYIVVCYFMHAFDLNMEKAIEHVRIFRPSIKFNRDQMQGLQDYFDHLT 179          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Match: A0A564YFF2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5816 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 8.832e-44
Identity = 70/173 (40.46%), Postives = 115/173 (66.47%), Query Frame = 1
Query:   28 KELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESCPG---TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            KE+ FY + A+G +  +LG R+ Y+RI DK++LG LP+  ++D  +  ENI  +++++ES E+K F +   +A  R + Y++LPV DF   PS+DQ+ +G+ FI+SC G   +VY+HCKAGR+RSA I VCY M+  +LN E AI++V+  R  +    + ++ +  Y+ H++
Sbjct:    7 KEIKFYVTLAYGSVVCRLGLRNWYDRINDKIVLGGLPMLPEFDNTRTKENITHVISMIESHEVKGFVLGPSEAATRGLQYINLPVLDFVGVPSVDQVDAGLSFIDSCQGPDNSVYIHCKAGRTRSAYIAVCYFMQTFDLNVENAIEHVRFFRPSITFNEDQLQGLQDYFNHLS 179          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Match: A0A068WDU6 (Protein tyrosine phosphatase mitochondrial OS=Echinococcus granulosus OX=6210 GN=EgrG_000822500 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.998e-43
Identity = 76/172 (44.19%), Postives = 110/172 (63.95%), Query Frame = 1
Query:   19 NGIKELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESC--PG-TVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYY 525
            N +KE+ FY S A+G L  KLG R  Y+RI DKLLLG+LP+  +WD I+  E I  ++++VE FE+K F +   +A  R I YL LPV+DF   P+ +Q+ + + FI+SC  PG  VY+HCKAGR+RSA IV CY M A +L PE+A+  ++  R  +       + ++ Y+
Sbjct:    3 NLMKEIKFYISLAYGALAYKLGARTWYDRINDKLLLGALPILPEWDTIRLKEGISHVISMVEPFEIKSFVLGPREAAERGISYLSLPVEDFVGVPTNEQVDASLDFIDSCQRPGDNVYIHCKAGRTRSAFIVTCYFMSAFDLPPEEAVAQIQSCRPHIIFNSVQWRGLHNYF 174          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Match: ptpmt1 (protein tyrosine phosphatase mitochondrial 1 [Source:ZFIN;Acc:ZDB-GENE-070112-272])

HSP 1 Score: 93.9745 bits (232), Expect = 2.668e-22
Identity = 48/168 (28.57%), Postives = 87/168 (51.79%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
            FY + A+ ++  ++  R  +NR+   ++LG+LP  S    +   EN+KG++ + E +E K F  S  + +   +  + L   D    PSL+ I  GV F+        +VY+HCKAGRSRSA +   Y+++    +PE+A   + E R  + +    +  + +Y+  +
Sbjct:   64 FYPTLAYNVVMERVSSRWWFNRVDQTVILGALPFRSMTQELVNMENVKGVITMNEEYETKFFCNSEAEWRAAGVEQIRLSTVDLTGVPSLEHIHQGVDFVMKHRENGTSVYIHCKAGRSRSATMAAAYLIRIHCWSPEKACSMLAEVRPHILVRSAQLDILKKYHQQV 231          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Match: ptpmt1 (protein tyrosine phosphatase mitochondrial 1 [Source:ZFIN;Acc:ZDB-GENE-070112-272])

HSP 1 Score: 93.5893 bits (231), Expect = 1.031e-21
Identity = 48/168 (28.57%), Postives = 87/168 (51.79%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
            FY + A+ ++  ++  R  +NR+   ++LG+LP  S    +   EN+KG++ + E +E K F  S  + +   +  + L   D    PSL+ I  GV F+        +VY+HCKAGRSRSA +   Y+++    +PE+A   + E R  + +    +  + +Y+  +
Sbjct:  115 FYPTLAYNVVMERVSSRWWFNRVDQTVILGALPFRSMTQELVNMENVKGVITMNEEYETKFFCNSEAEWRAAGVEQIRLSTVDLTGVPSLEHIHQGVDFVMKHRENGTSVYIHCKAGRSRSATMAAAYLIRIHCWSPEKACSMLAEVRPHILVRSAQLDILKKYHQQV 282          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:103024574])

HSP 1 Score: 61.6178 bits (148), Expect = 3.771e-10
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +L +PV D F    L  +   V FIE   +C   V VHC AG SRSA I + Y+MK M+++ ++A ++VKE+R  +
Sbjct:  211 FLRVPVNDSFCEKILPWLDKSVEFIEKAKACNARVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTI 286          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 53.1434 bits (126), Expect = 4.941e-8
Identity = 36/118 (30.51%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  181 KGILALVE-SFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            KGI  +V  + EL  F          ++ Y+ +P+ D  +SP     D +   +  +    G V VHC AG SRSA + + Y+MK   ++  +A  +VK RR V+R  G   + + +Y
Sbjct:   46 KGITCVVNATIELPNFNWP-------HVEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEY 156          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Match: ssh2b (protein phosphatase Slingshot homolog 2-like [Source:NCBI gene;Acc:103031360])

HSP 1 Score: 54.299 bits (129), Expect = 1.040e-7
Identity = 25/53 (47.17%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  364 VHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            VHCK G SRSA  V+ Y MK    + EQA +YVKERR+V +     M+ + +Y
Sbjct:  392 VHCKMGVSRSASTVIAYAMKEYGWDLEQAFEYVKERRAVTKPNPSFMRQLEEY 444          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Match: ptpmt1 (protein tyrosine phosphatase mitochondrial 1 [Source:ZFIN;Acc:ZDB-GENE-070112-272])

HSP 1 Score: 77.411 bits (189), Expect = 2.195e-17
Identity = 43/152 (28.29%), Postives = 81/152 (53.29%), Query Frame = 1
Query:   88 RDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
            R  ++R+   ++LG+LP+    + + K EN++G++ + E +E +    S+E+ +   +  L L   DF   PS  Q+  GV F     +   +VYVHCKAGRSRSA +V  Y+++    + ++A  ++   R  V +     + + ++ A +
Sbjct:   33 RRWFDRVDATVVLGALPLRGMTEQLVKQENVRGVITMNEPYETRLLCNSLEEWRDAGVEQLTLSTVDFTGVPSPQQLHDGVAFALKYAALGHSVYVHCKAGRSRSATMVA-YLIQVHGWDVQEACNHLHSLRQHVLIRPTQREALARFAAEV 183          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010335.1 (pep scaffold:Pmarinus_7.0:GL478432:36168:44847:-1 gene:ENSPMAG00000009361.1 transcript:ENSPMAT00000010335.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.280e-8
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIES---CPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            +L +PV D +    L  +   V FIE        V VHC AG SRSA + + YVMK++ L  ++A ++VKE+R  +     +  F+ Q
Sbjct:   89 FLRVPVNDSYCEKILPWLDRSVDFIEQVKVSDARVLVHCLAGISRSATVAIAYVMKSLGLGSDEAYRFVKEKRPSI---SPNFNFLGQ 173          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 53.5286 bits (127), Expect = 1.989e-8
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESC---PGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            Y  +PV+D   +         + FI+S     G V+VHC AG SRSA I + Y+MK   L  ++A ++V++RRSV+     +  F+ Q
Sbjct:  241 YKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVI---SPNFNFLGQ 325          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007279.1 (pep scaffold:Pmarinus_7.0:GL479270:10846:13215:-1 gene:ENSPMAG00000006578.1 transcript:ENSPMAT00000007279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.489e-7
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 1
Query:  364 VHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            VHCK G SRSA  V+ Y MK      E A  YVK RR VV+     M+ + +Y
Sbjct:   67 VHCKMGVSRSASTVIAYAMKEYGWTLEHAYSYVKSRRGVVKPNSGFMRQLEEY 119          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 48.521 bits (114), Expect = 3.505e-7
Identity = 29/104 (27.88%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  181 KGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            +GI  +V +      ++ +  A+L  + Y+ +PV D  ++P     D +   +       G   VHC AG SRSA + + Y+M+   L    A ++V+ RR  V
Sbjct:   41 RGITCVVNA------SLEVADARLPGVRYVRVPVPDCPHAPISRYFDPVAERIAGEARRGGRTLVHCAAGVSRSASLCIAYLMRGEGLVLRDAFRWVRARRPAV 138          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Match: EDO40641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M3])

HSP 1 Score: 116.316 bits (290), Expect = 8.298e-32
Identity = 65/171 (38.01%), Postives = 98/171 (57.31%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQK--SENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            F+ S  W ++ T+   R  ++RI   ++LG+LP +S+    QK   EN+KG++ L E FE K    S ++     +  L L   DF  +PS  Q+  GV FIE   S   +VYVHCKAGR RS  +V CY+MK  NLNPE+A  ++K +R  +RL  +    + Q++ H++
Sbjct:    5 FFPSLLW-IVATESRSRRWFDRIDSTVILGALPFKSQ---TQKLIDENVKGVITLNEEFETKHLCNSKQEWFAWGVTQLRLATVDFGNAPSFAQLLEGVKFIEDMRSKGDSVYVHCKAGRGRSTTLVACYLMKNKNLNPEEAHLFIKSKRPQIRLASQQWIALQQFHDHLH 171          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Match: EDO45204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF4])

HSP 1 Score: 98.5969 bits (244), Expect = 2.251e-25
Identity = 53/131 (40.46%), Postives = 75/131 (57.25%), Query Frame = 1
Query:   40 FYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMK 423
            FY +  W ++    G R  Y+RI   ++LG+LP +S    + + EN++ ++ L E FE K F  + E+     +  L L   DF  +PSLD +  GV FIE   S   +VYVHCKAGR RSA +V CY+MK
Sbjct:   23 FYPTLLWNVVMEG-GSRRWYDRIDSTVILGALPFKSLTQKLVEEENVRAVVTLNEEFETKHFCNTSEEWSEWGVKQLRLATVDFGNAPSLDNLSEGVKFIEEIRSKGDSVYVHCKAGRGRSATLVACYLMK 152          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 56.225 bits (134), Expect = 4.250e-9
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIESCP---GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
            Y  +PV D + +      +   GFI+S     G V VHC+AG SRSA I + Y++  +N   ++A +YVK+RRSV+
Sbjct:  218 YKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVI 293          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 52.373 bits (124), Expect = 1.650e-8
Identity = 26/80 (32.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  253 RNILYLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV 483
             +I+Y  + + D +           + FI+   S   +V VHC AG SRSA + V YVM+ + L+  +A ++VKE+R  +
Sbjct:   42 EDIIYKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTI 121          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Match: EDO29666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T302])

HSP 1 Score: 53.1434 bits (126), Expect = 1.688e-8
Identity = 35/102 (34.31%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  259 ILYLHLPVKDFF-------YSPSLDQIKSGVGFIESCP--GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY--YAH 531
            I++  +P  D F       +  + D I S VG  ++CP  G VYVHCK G SRSA +V+ Y++K   +    A++ V+ +R V      +M F+ Q   Y+H
Sbjct:   86 IIFHGIPATDVFMFKLNKYFDEAADFIASAVG-TKNCPKNGRVYVHCKEGISRSATLVLAYLIKHQQMGLTNALRTVRSKRMVY----PNMGFMEQLIDYSH 182          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000044613.1 (protein tyrosine phosphatase mitochondrial 1 [Source:NCBI gene;Acc:101170650])

HSP 1 Score: 92.8189 bits (229), Expect = 2.218e-22
Identity = 50/175 (28.57%), Postives = 90/175 (51.43%), Query Frame = 1
Query:   19 NGIKELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFI---ESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHI 534
              +  L FY + ++ ++  KL  R  ++R+ + ++LG+LP  S   A    +N++G++ + E +E K    S ++ +   +  L L   D    PSL  +  GV F+       G VYVHCKAGRSRSA +V  Y+++     PE+A   ++  R  + +    +  + +YY+ +
Sbjct:    3 GALARLFFYPTLSYNVIMEKLSSRRWFDRVDETVILGALPFRSM-TAQLLEQNVRGVITMNEEYETKLLCNSAQEWRAVGVEQLRLSTVDLTGVPSLQHLHRGVEFVLQHRERGGCVYVHCKAGRSRSATLVAAYLIRLHCWTPEEACHKLRSVRPHILVRPAQLDVLRKYYSQV 176          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:111946967])

HSP 1 Score: 59.3066 bits (142), Expect = 1.807e-9
Identity = 34/88 (38.64%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  265 YLHLPVKDFFYSPSLDQIKSGVGFIE---SCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQ 519
            +L +PV D F    L  +   V FIE   +  G V VHC AG SRSA I + Y+MK M+L+ ++A ++VKE+R  +     +  F+ Q
Sbjct:  202 FLRVPVNDSFCEKILPWLDRSVEFIERAKASNGRVLVHCLAGISRSATIAIAYIMKRMDLSLDEAYRFVKEKRPTI---SPNFNFLGQ 286          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:101173794])

HSP 1 Score: 56.225 bits (134), Expect = 1.164e-8
Identity = 32/98 (32.65%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  256 NILYLHLPVKDFFYSPSLDQIKSGVGFIESC---PGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVV----RLTGEHMKFINQYYA 528
            + LY  +PV+D + +         + FI+S     G V+VHC+AG SRSA I + Y+M+   +  ++A ++VK+RRS++       G+ ++F +Q  A
Sbjct:  216 SFLYKSIPVEDNYKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKKRRSIISPNFSFMGQLLQFESQVLA 313          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Match: ENSORLT00000042431.1 (dual specificity protein phosphatase 14 [Source:NCBI gene;Acc:101159168])

HSP 1 Score: 52.373 bits (124), Expect = 6.977e-8
Identity = 32/101 (31.68%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  217 KKFAMSIEKAKLRNILY--------LHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVR 486
            +   + I  + L+N+ Y        LH+PV+D  ++P     DQ+   +   ++  G+  VHC AGRSRS  +V+ Y+M+   L+  QA + V E+R  +R
Sbjct:   27 RGVTLVINASGLQNLSYPALEGLQLLHVPVQDRPHAPLKDHFDQVAERIQ--QNRTGSTLVHCTAGRSRSPTLVMAYLMRCEGLSLCQAHEQVLEQRPFIR 125          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 52.7582 bits (125), Expect = 7.066e-8
Identity = 45/157 (28.66%), Postives = 69/157 (43.95%), Query Frame = 1
Query:   64 LLQTKLGFRDAYNRITDKLLLGSLPVESKWDAIQKSENIKGILALVE-SFELKKFAMSIEKAKLRNILYLHLPVKDFFYSP---SLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            LLQ          +IT  L L    V S    +      KGI  +V  + EL  F          ++ Y+ +P+ D  +SP     D +   +  +    G V VHC AG SRSA + + Y+MK   ++  +A  +VK RR V+R  G   + + +Y
Sbjct:   18 LLQENGNLLGGIAQITPNLFLSRGNVASNRSLLLS----KGITCVVNATIELPNF-------NWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEY 163          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Planmine SMEST
Match: SMESG000010568.1 (SMESG000010568.1)

HSP 1 Score: 216.083 bits (549), Expect = 2.326e-71
Identity = 102/103 (99.03%), Postives = 103/103 (100.00%), Query Frame = 1
Query:  229 MSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 537
            MSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCY+MKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN
Sbjct:    1 MSIEKAKLRNILYLHLPVKDFFYSPSLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYLMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYYAHIN 103          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Planmine SMEST
Match: SMESG000014789.1 (SMESG000014789.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.476e-7
Identity = 45/143 (31.47%), Postives = 70/143 (48.95%), Query Frame = 1
Query:  103 RITDKLLLGSLPVESKWDAIQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDF--FYSPSLDQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQYY 525
             I   L LGS    S  D + KS  IK IL +++S  L K    +E    + I    +P +D   ++  + + I++G  F     G V +HC AG SRS  I+  Y+MK   ++P  AI+ +KE+  +    G  MK +  Y+
Sbjct:    3 EIISNLWLGSYEDASNVDLL-KSLQIKYILTVMDSPLLHK----MEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKF-----GGVLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFICPNDG-FMKQLKIYF 134          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Planmine SMEST
Match: SMESG000070817.1 (SMESG000070817.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.914e-6
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  352 GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSVVRLTGEHMKFINQY 522
            G   VHC+ G SRSA IV+ Y+MK  N+  E+A+++VK +R  ++     M+ +  Y
Sbjct:  383 GVCLVHCQRGISRSASIVISYIMKEFNMTFEKALEFVKGKRDCIKPNDGFMQQLKTY 439          
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Planmine SMEST
Match: SMESG000030100.1 (SMESG000030100.1)

HSP 1 Score: 47.3654 bits (111), Expect = 7.242e-6
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 1
Query:  352 GTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKYVKERRSV 480
            G +++HC AG SRS+ IV+ Y+MK   L+  + +KYV+E R +
Sbjct:  274 GRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPI 316          
The following BLAST results are available for this feature:
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPMT13.627e-2530.34protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
PTPMT13.627e-2530.34protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
DUSP161.604e-940.79dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP161.604e-940.79dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP146.134e-829.01dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F28C6.85.718e-2934.10pep chromosome:WBcel235:II:8606849:8607749:1 gene:... [more]
F28C6.81.672e-2335.56pep chromosome:WBcel235:II:8606849:8607749:1 gene:... [more]
T12B3.13.331e-727.10pep chromosome:WBcel235:IV:7382415:7384752:1 gene:... [more]
Y54F10BM.139.804e-733.75pep chromosome:WBcel235:III:2329577:2331183:-1 gen... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPMT14.202e-2831.52gene:FBgn0039111 transcript:FBtr0084454[more]
PTPMT14.790e-2831.52gene:FBgn0039111 transcript:FBtr0084453[more]
ssh1.056e-646.30gene:FBgn0029157 transcript:FBtr0301612[more]
ssh1.133e-646.30gene:FBgn0029157 transcript:FBtr0301613[more]
ssh1.170e-646.30gene:FBgn0029157 transcript:FBtr0084800[more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpmt14.181e-2630.36protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
ptpmt11.838e-2132.82protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
dusp168.057e-936.36dual specificity phosphatase 16 [Source:ZFIN;Acc:Z... [more]
dusp15.078e-833.68dual specificity phosphatase 1 [Source:ZFIN;Acc:ZD... [more]
dusp145.231e-829.86dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnpt15.050e-939.47polyribonucleotide nucleotidyltransferase 1 [Sourc... [more]
pnpt18.409e-939.47polyribonucleotide nucleotidyltransferase 1 [Sourc... [more]
tor2a1.832e-833.33torsin family 2, member A [Source:Xenbase;Acc:XB-G... [more]
dusp82.067e-836.84dual specificity phosphatase 8 [Source:NCBI gene;A... [more]
ibtk1.049e-732.63inhibitor of Bruton tyrosine kinase [Source:Xenbas... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpmt13.490e-2128.09protein tyrosine phosphatase, mitochondrial 1 [Sou... [more]
Ptpmt13.490e-2128.09protein tyrosine phosphatase, mitochondrial 1 [Sou... [more]
Ptpmt11.215e-2030.72protein tyrosine phosphatase, mitochondrial 1 [Sou... [more]
Dusp141.261e-1029.77dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp141.261e-1029.77dual specificity phosphatase 14 [Source:MGI Symbol... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86BN8|PTPM1_DROME4.801e-2731.52Phosphatidylglycerophosphatase and protein-tyrosin... [more]
sp|Q8WUK0|PTPM1_HUMAN1.742e-2430.34Phosphatidylglycerophosphatase and protein-tyrosin... [more]
sp|P0C089|PTPM1_RAT6.115e-2329.94Phosphatidylglycerophosphatase and protein-tyrosin... [more]
sp|Q66GT5|PTPM1_MOUSE1.576e-2128.09Phosphatidylglycerophosphatase and protein-tyrosin... [more]
sp|Q9ZQP1|DSP8_ARATH6.621e-1834.52Putative dual specificity protein phosphatase DSP8... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WV033.108e-4744.13Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3UH329.764e-4647.93Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TT831.611e-4542.20Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A564YFF28.832e-4440.46Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068WDU62.998e-4344.19Protein tyrosine phosphatase mitochondrial OS=Echi... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpmt12.668e-2228.57protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
ptpmt11.031e-2128.57protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
dusp163.771e-1040.79dual specificity phosphatase 16 [Source:NCBI gene;... [more]
dusp144.941e-830.51dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
ssh2b1.040e-747.17protein phosphatase Slingshot homolog 2-like [Sour... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpmt12.195e-1728.29protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
ENSPMAT00000010335.11.280e-835.23pep scaffold:Pmarinus_7.0:GL478432:36168:44847:-1 ... [more]
dusp41.989e-835.23dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000007279.11.489e-745.28pep scaffold:Pmarinus_7.0:GL479270:10846:13215:-1 ... [more]
dusp143.505e-727.88dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406418.298e-3238.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452042.251e-2540.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492504.250e-939.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.650e-832.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296661.688e-834.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044613.12.218e-2228.57protein tyrosine phosphatase mitochondrial 1 [Sour... [more]
dusp161.807e-938.64dual specificity phosphatase 16 [Source:NCBI gene;... [more]
dusp11.164e-832.65dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
ENSORLT00000042431.16.977e-831.68dual specificity protein phosphatase 14 [Source:NC... [more]
dusp147.066e-828.66dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein-tyrosine phosphatase mitochondrial 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000010568.12.326e-7199.03SMESG000010568.1[more]
SMESG000014789.11.476e-731.47SMESG000014789.1[more]
SMESG000070817.11.914e-638.60SMESG000070817.1[more]
SMESG000030100.17.242e-644.19SMESG000030100.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021722 ID=SMED30021722|Name=Protein-tyrosine phosphatase mitochondrial 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=928bp
TAAAATTGAATGGTTATTAACGGAATAAAAGAATTATCATTTTATACCTC
TTTCGCTTGGGGTTTACTTCAAACGAAATTAGGGTTTCGCGATGCTTATA
ATCGAATAACAGATAAACTATTGCTCGGCTCACTGCCAGTCGAATCGAAA
TGGGATGCAATTCAAAAATCAGAAAACATTAAAGGCATTCTAGCACTGGT
GGAAAGTTTTGAATTGAAAAAATTCGCCATGTCAATTGAAAAAGCAAAAT
TGAGAAATATTCTTTATTTACATTTACCAGTGAAAGATTTTTTCTATTCG
CCTTCACTAGATCAGATTAAATCTGGCGTCGGATTCATTGAGAGTTGCCC
GGGAACCGTATATGTCCATTGTAAGGCAGGCCGGTCTAGGTCGGCAGTTA
TCGTCGTGTGTTACGTCATGAAAGCGATGAATCTCAACCCAGAACAAGCA
ATTAAGTATGTCAAGGAGCGAAGGTCGGTGGTCCGCCTCACTGGAGAACA
CATGAAATTCATCAATCAATATTATGCTCACATAAATCCGTGAAAATTAT
TATTTATAATAATAATCAATACTCGGAGGAATGAATAAATATATTTGTTT
TGGCTTTAGTTTTTGTCTGTTGGGCTGTTGCTATGGAAATGTGTGCTGGA
ATGTTTGGTTGCTAGGTTGTGATTATTAATAAATCAAATTGAATTTACAT
TTTATTAATATCAGTTGATTAATTTTGATTGGATTTCATTTATTTTCAAT
TTTGCATATCGACCAATCACGGTTTCAGCGCTCCCATTGGTGGCAAATGC
CGAGAGGCGTTGAAGAAATTATTAACATGTTTATATGATAGCAAAGACTT
TTAAGGAGGCCTCATTGCATGGAGTAATATCTAGTTTGGCATATTCCTAA
TAATTCTACACAATTTCAACGAACGAGC
back to top

protein sequence of SMED30021722-orf-1

>SMED30021722-orf-1 ID=SMED30021722-orf-1|Name=SMED30021722-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MVINGIKELSFYTSFAWGLLQTKLGFRDAYNRITDKLLLGSLPVESKWDA
IQKSENIKGILALVESFELKKFAMSIEKAKLRNILYLHLPVKDFFYSPSL
DQIKSGVGFIESCPGTVYVHCKAGRSRSAVIVVCYVMKAMNLNPEQAIKY
VKERRSVVRLTGEHMKFINQYYAHINP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042165PTPMT1
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 28..173
e-value: 6.1E-14
score: 62.3
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 28..176
score: 19.723
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 28..176
e-value: 5.1E-37
score: 129.0
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 19..174
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 50..171
e-value: 1.1E-21
score: 77.1
IPR042165Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1PANTHERPTHR46712Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1coord: 7..173
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 118..128
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 116..165
score: 12.943
NoneNo IPR availableCDDcd14524PTPMT1coord: 29..171
e-value: 2.93301E-50
score: 157.038