Cystinosin
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30021721 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Homology
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518]) HSP 1 Score: 55.0694 bits (131), Expect = 1.037e-9 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 130 HVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 154 SVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 205
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518]) HSP 1 Score: 54.299 bits (129), Expect = 1.310e-9 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 130 HVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 7 SVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 58
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518]) HSP 1 Score: 54.299 bits (129), Expect = 1.464e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 155 VIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 205
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518]) HSP 1 Score: 54.299 bits (129), Expect = 1.464e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 155 VIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 205
BLAST of Cystinosin vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518]) HSP 1 Score: 53.5286 bits (127), Expect = 2.195e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 8 VIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 58
BLAST of Cystinosin vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500]) HSP 1 Score: 53.1434 bits (126), Expect = 1.886e-9 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N +GF +Y++FN+ +++ +KN + NPR PV LND Sbjct: 157 VVGLNFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLND 207
BLAST of Cystinosin vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500]) HSP 1 Score: 52.7582 bits (125), Expect = 2.378e-9 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N +GF +Y++FN+ +++ +KN + NPR PV LND Sbjct: 157 VVGLNFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLND 207
BLAST of Cystinosin vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0084357) HSP 1 Score: 53.5286 bits (127), Expect = 1.730e-9 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V GLNFDFL N +GF YS+FN GL++I+ ++N ++ P NPV LND Sbjct: 160 VEGLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNEYEVRYPLGVNPVMLND 210
BLAST of Cystinosin vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0344299) HSP 1 Score: 53.5286 bits (127), Expect = 1.730e-9 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V GLNFDFL N +GF YS+FN GL++I+ ++N ++ P NPV LND Sbjct: 160 VEGLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNEYEVRYPLGVNPVMLND 210
BLAST of Cystinosin vs. Ensembl Zebrafish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:ZFIN;Acc:ZDB-GENE-050522-352]) HSP 1 Score: 57.3806 bits (137), Expect = 7.946e-11 Identity = 28/51 (54.90%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N GF +YSVFN+GLFW+ I+ F +P PV ND Sbjct: 160 VVGLNFDFLALNLTGFIAYSVFNVGLFWVTYIQEEFLKKDPNGVIPVDAND 210
BLAST of Cystinosin vs. Ensembl Xenopus
Match: klhl24 (kelch like family member 24 [Source:Xenbase;Acc:XB-GENE-1000313]) HSP 1 Score: 51.2174 bits (121), Expect = 1.684e-8 Identity = 26/51 (50.98%), Postives = 31/51 (60.78%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGL+FDFL N G +Y VFN+GLFWI +K F P PV+ ND Sbjct: 256 VVGLSFDFLALNLTGHIAYGVFNLGLFWIPYVKEQFLELYPNGVFPVEAND 306
BLAST of Cystinosin vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872]) HSP 1 Score: 54.299 bits (129), Expect = 1.210e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDFL N GF +YSVFNIGL W+ I+ F P NPV ND Sbjct: 155 VIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNGVNPVDSND 205
BLAST of Cystinosin vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872]) HSP 1 Score: 54.299 bits (129), Expect = 1.210e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDFL N GF +YSVFNIGL W+ I+ F P NPV ND Sbjct: 155 VIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNGVNPVDSND 205
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|A7MB63|CTNS_BOVIN (Cystinosin OS=Bos taurus OX=9913 GN=CTNS PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 1.652e-11 Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGL+FDF++ N +GF +YSVFNIGLFW+ SIK F P NPV ND Sbjct: 155 VVGLSFDFVVLNLMGFVAYSVFNIGLFWVPSIKEQFLLKYPNGVNPVDSND 205
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|A8WN56|CTNS_CAEBR (Cystinosin homolog OS=Caenorhabditis briggsae OX=6238 GN=ctns-1 PE=3 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 5.185e-9 Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N +GF +Y++FN+ +++ +KN++ NPR PV LND Sbjct: 156 VVGLNFDFLSLNLVGFGAYAMFNLLMYYNSHVKNIYSMENPRSPPPVLLND 206
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|O60931|CTNS_HUMAN (Cystinosin OS=Homo sapiens OX=9606 GN=CTNS PE=1 SV=2) HSP 1 Score: 54.299 bits (129), Expect = 7.032e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDF+ N GF +YSVFNIGL W+ IK F P NPV ND Sbjct: 155 VIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSND 205
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|P57757|CTNS_MOUSE (Cystinosin OS=Mus musculus OX=10090 GN=Ctns PE=1 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 8.467e-9 Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GL+FDFL N GF +YSVFNIGL W+ I+ F P NPV ND Sbjct: 155 VIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNGVNPVDSND 205
BLAST of Cystinosin vs. UniProt/SwissProt
Match: sp|Q9VCR7|CTNS_DROME (Cystinosin homolog OS=Drosophila melanogaster OX=7227 GN=CG17119 PE=1 SV=2) HSP 1 Score: 53.5286 bits (127), Expect = 1.734e-8 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V GLNFDFL N +GF YS+FN GL++I+ ++N ++ P NPV LND Sbjct: 160 VEGLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNEYEVRYPLGVNPVMLND 210
BLAST of Cystinosin vs. TrEMBL
Match: V3ZZQ3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_219532 PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 2.430e-13 Identity = 36/67 (53.73%), Postives = 48/67 (71.64%), Query Frame = 1 Query: 85 VTFRNVIFNAYPFNLHVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+F +F+ Y F VVGLNFD++ YN +GF +Y FN+GL+WI S+KN +K +PR NPVQLND Sbjct: 38 VSFYPQVFSNY-FRKSVVGLNFDYIAYNLLGFLAYGFFNVGLYWIGSVKNEYKRQHPRGINPVQLND 103
BLAST of Cystinosin vs. TrEMBL
Match: W4YIC8 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.714e-12 Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 130 HVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GLNFDFL YN GF +Y VFN+G++WI+ IK+ +K NP NPV LND Sbjct: 152 SVIGLNFDFLAYNITGFVAYGVFNVGMYWIEPIKDAYKAKNPYGVNPVLLND 203
BLAST of Cystinosin vs. TrEMBL
Match: A0A210R5V9 (Cystinosin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08272 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 8.351e-12 Identity = 32/51 (62.75%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GLNFDFL YN GF +YS FN+GL+WI SI++ +K +PR NPVQLND Sbjct: 164 VIGLNFDFLAYNITGFIAYSFFNVGLYWIKSIEDDYKSLHPRGINPVQLND 214
BLAST of Cystinosin vs. TrEMBL
Match: A0A1S3IZU2 (cystinosin OS=Lingula unguis OX=7574 GN=LOC106168859 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.139e-11 Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GLNFDFL YN GF +Y VFN+G+FWI SI+ +K +PR NPVQLND Sbjct: 174 VIGLNFDFLSYNITGFVAYGVFNVGMFWIPSIEAEYKDLHPRGVNPVQLND 224
BLAST of Cystinosin vs. TrEMBL
Match: A0A0D2WRH9 (Cystinosin-like protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_004575 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.623e-11 Identity = 32/51 (62.75%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL YN GF YS FNIGLFW+ SI++L+ ++P NPVQ ND Sbjct: 155 VVGLNFDFLAYNITGFLCYSAFNIGLFWVTSIQDLYFADHPDGVNPVQAND 205
BLAST of Cystinosin vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999]) HSP 1 Score: 63.1586 bits (152), Expect = 6.698e-13 Identity = 32/52 (61.54%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 130 HVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N+ GF +YSVFNIGLFWI IK F P NPV ND Sbjct: 159 SVVGLNFDFLALNFTGFIAYSVFNIGLFWIPYIKEEFIQTEPNGVNPVDAND 210
BLAST of Cystinosin vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999]) HSP 1 Score: 63.1586 bits (152), Expect = 6.698e-13 Identity = 32/52 (61.54%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 130 HVVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N+ GF +YSVFNIGLFWI IK F P NPV ND Sbjct: 159 SVVGLNFDFLALNFTGFIAYSVFNIGLFWIPYIKEEFIQTEPNGVNPVDAND 210
BLAST of Cystinosin vs. Ensembl Nematostella
Match: EDO46894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ1]) HSP 1 Score: 60.077 bits (144), Expect = 1.860e-12 Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GLNFDF+ YN GF +Y +FNIG+FWI ++ ++ +P NPVQ ND Sbjct: 50 VIGLNFDFVCYNLTGFVAYGLFNIGMFWIPLVQQQYEAKHPNGVNPVQTND 100
BLAST of Cystinosin vs. Ensembl Medaka
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:101155673]) HSP 1 Score: 64.3142 bits (155), Expect = 2.634e-13 Identity = 30/51 (58.82%), Postives = 34/51 (66.67%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFL N GF +YSVFNIGLFW+ ++ F NP NPV ND Sbjct: 284 VVGLNFDFLALNLTGFIAYSVFNIGLFWVPYVQEEFLKTNPNGINPVNSND 334
BLAST of Cystinosin vs. Planmine SMEST
Match: SMESG000079054.1 (SMESG000079054.1) HSP 1 Score: 107.842 bits (268), Expect = 1.538e-29 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND Sbjct: 120 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 170
BLAST of Cystinosin vs. Planmine SMEST
Match: SMESG000016911.1 (SMESG000016911.1) HSP 1 Score: 46.2098 bits (108), Expect = 4.042e-7 Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 133 VVGLNFDFLIYNWIGFFSYSVFNIGLFWIDSIKNLFKYNNPRVANPVQLND 285 V+GLNFDFL YN GF +YS+FN L++ +++ F NPVQLND Sbjct: 38 VIGLNFDFLGYNITGFIAYSIFNSALYFNKNLQQEFYKTYKGKFNPVQLND 88 The following BLAST results are available for this feature:
BLAST of Cystinosin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Cystinosin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 2
BLAST of Cystinosin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 2
BLAST of Cystinosin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 1
BLAST of Cystinosin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of Cystinosin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 2
BLAST of Cystinosin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of Cystinosin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Cystinosin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 2
BLAST of Cystinosin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Cystinosin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Cystinosin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of Cystinosin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of Cystinosin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021721 ID=SMED30021721|Name=Cystinosin|organism=Schmidtea mediterranea sexual|type=transcript|length=285bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|