COesterase domain-containing protein

Overview
NameCOesterase domain-containing protein
Smed IDSMED30021718
Length (bp)2193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COesterase domain-containing protein (SMED30021718) t-SNE clustered cells

Violin plots show distribution of expression levels for COesterase domain-containing protein (SMED30021718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COesterase domain-containing protein (SMED30021718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COesterase domain-containing protein (SMED30021718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021718SMESG000027379.1 SmedASXL_014313SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30021718SMESG000027379.1 dd_Smed_v4_6180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021718SMESG000027379.1 dd_Smed_v4_6180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30021718SMESG000027379.1 dd_Smed_v4_6180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021718SMESG000027379.1 dd_Smed_v6_6180_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021718SMESG000027379.1 OX_Smed_1.0.21367ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: NLGN4Y (neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC:15529])

HSP 1 Score: 95.9005 bits (237), Expect = 1.005e-19
Identity = 71/250 (28.40%), Postives = 116/250 (46.40%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDS---HKII-----------------GSENCLYLNVYVPSK----AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            KI+    P+   I   + ++LG+PYA PP   RRF   +      G     RN      A  + + C Q+  +    H ++                  +E+CLYLN+YVP +      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +N+ AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   54 KIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI----RN------ATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN 290          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: NLGN4Y (neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC:15529])

HSP 1 Score: 95.9005 bits (237), Expect = 1.005e-19
Identity = 71/250 (28.40%), Postives = 116/250 (46.40%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDS---HKII-----------------GSENCLYLNVYVPSK----AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            KI+    P+   I   + ++LG+PYA PP   RRF   +      G     RN      A  + + C Q+  +    H ++                  +E+CLYLN+YVP +      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +N+ AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   54 KIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGI----RN------ATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN 290          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 94.3597 bits (233), Expect = 2.888e-19
Identity = 71/245 (28.98%), Postives = 115/245 (46.94%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY------------RNLNH---PYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSK----AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            KI     P+   I   + ++LG+PYA PP   RRF   +      G +               R+L H   P    +     + Y +D      +E+CLYLN+YVP++      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +N+ AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   54 KIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQ-----NEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN 290          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 94.3597 bits (233), Expect = 2.888e-19
Identity = 71/245 (28.98%), Postives = 115/245 (46.94%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY------------RNLNH---PYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSK----AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            KI     P+   I   + ++LG+PYA PP   RRF   +      G +               R+L H   P    +     + Y +D      +E+CLYLN+YVP++      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +N+ AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   54 KIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQ-----NEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN 290          
BLAST of COesterase domain-containing protein vs. Ensembl Human
Match: NLGN4X (neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC:14287])

HSP 1 Score: 94.3597 bits (233), Expect = 2.888e-19
Identity = 71/245 (28.98%), Postives = 115/245 (46.94%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY------------RNLNH---PYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSK----AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            KI     P+   I   + ++LG+PYA PP   RRF   +      G +               R+L H   P    +     + Y +D      +E+CLYLN+YVP++      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +N+ AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   54 KIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQ-----NEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN 290          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: K07C11.4 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:Q21266])

HSP 1 Score: 97.0561 bits (240), Expect = 1.010e-20
Identity = 69/222 (31.08%), Postives = 106/222 (47.75%), Query Frame = 3
Query:  474 AKQKIETKCGPIEGNINDGILE------FLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDS--HKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +K K+ T  GPI G  +   +       FLGI Y  PP    RF   + +       E + ++NH   A  +++ C+   +     ++  SE+CL+LN+  P  A +KKLPV+  + G  F +G  +M G+    D       I V+  YRLGP+       +    N GL D+ LAL ++H+ +  FGGD   I L G  +G+    AL  S  +  LFS+
Sbjct:   20 SKPKVTTPYGPIVGFEHKSTVTGSKYHVFLGIRYGNPPDHIYRFQKPEPV-------EKWPHINHD--ATHFRASCIPSLRSELEEQVNYSEDCLFLNIVTPPDAKEKKLPVLVFIHGGGFQFGDTSMIGYQKAADNFVSKDIIFVSIQYRLGPLGFFTTGDSEIPGNMGLWDQTLALQFLHEVLPDFGGDPDRITLAGHSAGAASVSALLYSPHSDHLFSQ 232          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: B0238.7 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:O16490])

HSP 1 Score: 95.9005 bits (237), Expect = 2.371e-20
Identity = 87/278 (31.29%), Postives = 123/278 (44.24%), Query Frame = 3
Query:  480 QKIETKCGPIEGNI---NDG---ILEFLGIPYAFPPIDRRRF---THAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEK------DSHKIIGSENCLYLNVYVPS---KAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS------IHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK-IWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLD 1235
            Q +   CGPI GNI    +G   +  +LGIP+A  P+   +F     A++  + + C E             Y   C Q  +       S      ENCL LNV+ P        K LPV      L + YG G   GFT   D   +T +      I VT NYRLGP+  + I       N+GL D+ LAL W+  NIA+FGG+  ++ L G  +G+T    LS S  + +LF + I +S      T   N A++ +   +G  K+   FQ     D
Sbjct:   32 QILNAPCGPIRGNIYKHKNGTKIVDGYLGIPFAKAPVGALKFKKPVAAEKWTEPRDCYE-------------YGPGCPQTGRFAALTAKSTAAFAEENCLTLNVFAPRWKLAEFPKGLPV------LVYIYGGGYEIGFTSYMDDYSLTGTLPLKDVIVVTMNYRLGPLGFLTIADGIANGNYGLWDQTLALQWVQDNIASFGGNPESVTLSGTSAGATSTDFLSLSPHSNQLFQRSISMSG-----TAFCNFAIRPKDVEVGVCKEFAQFQGYTGTD 285          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ace-2 (Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:G5EDV9])

HSP 1 Score: 95.1301 bits (235), Expect = 4.893e-20
Identity = 75/221 (33.94%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  486 IETKCGPIEG--NINDG--ILEFLGIPYAFPPIDRRRFTHAQ-------EIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII--NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYG--VGSGSTVA-LALSNSIKAIR 1100
            + T  G I G     DG  +  FLG+PYA PPI  RRF  A+       E+  +   +  Y  ++  +P    + P  +       I  SE+CL +N++VP       +  ++I  G FFS G+ +++ ++ +    K   +I V  NYRLGP   +   +    + N GL D+ LAL W+H+NI AFGGD+S + L+G   GS ST A L   NS K  R
Sbjct:   41 VHTPLGTIRGVGQTFDGAKVSAFLGVPYAKPPIGSRRFKMAEMIDRWSGELEARTLAKTCYLTIDSAFP----QFPGAEMWNPPGAI--SEDCLNMNIWVPEDHDGSVM--VWIYGGGFFS-GTPSLDLYSGSVFAAK-EHTIVVNVNYRLGPFGFLYFGDDSPIQGNMGLMDQQLALRWVHENIGAFGGDRSRVTLFGESAGSASTTAHLFAPNSHKYFR 251          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: glit-1 (GLIoTactin (Drosophila neuroligin-like) homolog [Source:UniProtKB/TrEMBL;Acc:Q20826])

HSP 1 Score: 95.1301 bits (235), Expect = 6.595e-20
Identity = 78/256 (30.47%), Postives = 110/256 (42.97%), Query Frame = 3
Query:  504 PIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDS--------HKIIGSENCLYLNVYVP--SKAIDKKLPVIFIVSGLFFSYGSGN---MEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKL 1232
            P++   N  +  FLG+PYA PP  +RRF   Q++    G Q        PY A +Y + C Q  + S        +  +  E+CLYLN++ P  SK      PVI    G  F  GS N     G      VV       VT NYRLG    +    +   N+GL D+ LAL ++  NI  FGGD   + + G  +G+        S  +  LF              T++ A     SY+G  K +  F +T+KL
Sbjct:   97 PLKPKNNITVFTFLGVPYAEPPTSQRRFKPPQQLTVFPGKQ--------PYLAFNYAASCAQDVEKSPSPFVDHPYPFMVDEDCLYLNIFSPDISKNAQTTYPVIVFFHGGNFQTGSANEWPAHGLASRGMVV-------VTVNYRLGAFGFMSMGDSETGNYGLQDQRLALEFVKNNIVTFGGDPQAVTVVGHDAGAASIGFHMQSPYSRHLFRS----------AATMSGAEVSYHSYIG--KTALAFNNTMKL 325          
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Match: ges-1 (Gut esterase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q04457])

HSP 1 Score: 93.9745 bits (232), Expect = 8.906e-20
Identity = 68/227 (29.96%), Postives = 106/227 (46.70%), Query Frame = 3
Query:  471 FAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEK--DSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLV 1142
            +A   +ET  G +EG   +G   FL IP+A PP+D  RF       +K    + + ++   YPA  Y++ C  + +          E+CL LN+  P KA  +KLPV+F + G  +  GS +  G+            I  T  YRLG M       ++ + N GL D+  AL ++  NI  FGGD + I ++G  +G+     L+ S      +SK  I +  + V
Sbjct:   15 WAGPIVETNYGKVEGIEYEGAEVFLAIPFAKPPVDDLRF-------EKPVAPDPWEDV---YPATQYRNDCTPHYRLVAQFSSYSGEDCLTLNIIKPKKA--EKLPVLFWIHGGGYEIGSASQHGYEFFAKRYASQGVIVATVQYRLGFMGFFSEGTSDVQGNWGLFDQAAALEFVKSNIENFGGDPNQITIWGYSAGAASVSQLTMSPYTRDSYSKAIIMSASSFV 229          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Nrt (gene:FBgn0004108 transcript:FBtr0075322)

HSP 1 Score: 115.931 bits (289), Expect = 2.806e-26
Identity = 104/412 (25.24%), Postives = 186/412 (45.15%), Query Frame = 3
Query:  492 TKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS-------IHVTSNYRLG--------PMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVT-KTLNDALKVQQSYLGDIKKSEI---FQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDND--FINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIK--LKMKPFGRV-VNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPL 1655
            T CGP+EG   DG   F GIPYA PP+DR R+  A+ I D   C       N      +    C Q   +    +G E+CLYL+V  P    +  LPV+ ++       G+ ++ G   +P +++ +         I V  N+RLG         +    +P T+  N+ L+D +  L WI  NI  FGGD  ++ L G  +G+T+   L NS K   L+++ W S+   ++  K L+++ K  +  +  ++ ++I    + + +      P  W +          + P P +A  +     +L++D D  F +  +  KR + N    +V+G  A+E         +R   A++  + ++  L+    G + + D  ++ +  +    S+++I       ++DIR  CPL
Sbjct:  365 TGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMC------WNDTLQTHNSSVVCTQRLGNG-TTVGDEDCLYLDVVTPHVRYNNPLPVVVLI-------GAESLAG--PSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTS-GNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFP-------VDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHT----EKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYA-SLVSI-------ISDIRSVCPL 740          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Nrt (gene:FBgn0004108 transcript:FBtr0075323)

HSP 1 Score: 115.931 bits (289), Expect = 2.806e-26
Identity = 104/412 (25.24%), Postives = 186/412 (45.15%), Query Frame = 3
Query:  492 TKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS-------IHVTSNYRLG--------PMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVT-KTLNDALKVQQSYLGDIKKSEI---FQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDND--FINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIK--LKMKPFGRV-VNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPL 1655
            T CGP+EG   DG   F GIPYA PP+DR R+  A+ I D   C       N      +    C Q   +    +G E+CLYL+V  P    +  LPV+ ++       G+ ++ G   +P +++ +         I V  N+RLG         +    +P T+  N+ L+D +  L WI  NI  FGGD  ++ L G  +G+T+   L NS K   L+++ W S+   ++  K L+++ K  +  +  ++ ++I    + + +      P  W +          + P P +A  +     +L++D D  F +  +  KR + N    +V+G  A+E         +R   A++  + ++  L+    G + + D  ++ +  +    S+++I       ++DIR  CPL
Sbjct:  365 TGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMC------WNDTLQTHNSSVVCTQRLGNG-TTVGDEDCLYLDVVTPHVRYNNPLPVVVLI-------GAESLAG--PSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTS-GNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFP-------VDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHT----EKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYA-SLVSI-------ISDIRSVCPL 740          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: Nrt (gene:FBgn0004108 transcript:FBtr0304018)

HSP 1 Score: 115.931 bits (289), Expect = 2.806e-26
Identity = 104/412 (25.24%), Postives = 186/412 (45.15%), Query Frame = 3
Query:  492 TKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS-------IHVTSNYRLG--------PMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVT-KTLNDALKVQQSYLGDIKKSEI---FQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDND--FINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIK--LKMKPFGRV-VNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPL 1655
            T CGP+EG   DG   F GIPYA PP+DR R+  A+ I D   C       N      +    C Q   +    +G E+CLYL+V  P    +  LPV+ ++       G+ ++ G   +P +++ +         I V  N+RLG         +    +P T+  N+ L+D +  L WI  NI  FGGD  ++ L G  +G+T+   L NS K   L+++ W S+   ++  K L+++ K  +  +  ++ ++I    + + +      P  W +          + P P +A  +     +L++D D  F +  +  KR + N    +V+G  A+E         +R   A++  + ++  L+    G + + D  ++ +  +    S+++I       ++DIR  CPL
Sbjct:  365 TGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMC------WNDTLQTHNSSVVCTQRLGNG-TTVGDEDCLYLDVVTPHVRYNNPLPVVVLI-------GAESLAG--PSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTS-GNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFP-------VDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHT----EKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYA-SLVSI-------ISDIRSVCPL 740          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: alpha-Est10 (gene:FBgn0015569 transcript:FBtr0289953)

HSP 1 Score: 103.605 bits (257), Expect = 9.086e-23
Identity = 88/264 (33.33%), Postives = 123/264 (46.59%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGI-----LEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMN--SIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYG--VGSGSTVALALSNSI-----KAIRLFSKI---WISNPMTLVTKTLNDALKVQQ--SYLGDIKKSEIFQ 1217
            I+TK GP+ G   + I       F  IP+A PP+   RF   + +      +   + L+   PA       +Q      K  GSE+CLYLNVYV     DK  PV+  + G  +  G  + + ++  PD       + VT  YRLG +   S+ +PQ N   N GL D+++AL W+ +NI AFGGD +NI L+G   G  ST  LALS        KAI +   +   W   P        N A ++ Q   Y GD K   IF+
Sbjct:   37 IKTKSGPVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFKAPEAV------EPWDQELDCTSPADK----PLQTHMFFRKYAGSEDCLYLNVYVKDLQPDKLRPVMVWIYGGGYQVGEASRDMYS--PDFFMSKDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALSPQTEGLIHKAIVMSGSVLCPWTQPPRN------NWAYRLAQKLGYTGDNKDKAIFE 282          
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Match: alpha-Est10 (gene:FBgn0015569 transcript:FBtr0305910)

HSP 1 Score: 103.605 bits (257), Expect = 9.343e-23
Identity = 88/264 (33.33%), Postives = 123/264 (46.59%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGI-----LEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMN--SIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYG--VGSGSTVALALSNSI-----KAIRLFSKI---WISNPMTLVTKTLNDALKVQQ--SYLGDIKKSEIFQ 1217
            I+TK GP+ G   + I       F  IP+A PP+   RF   + +      +   + L+   PA       +Q      K  GSE+CLYLNVYV     DK  PV+  + G  +  G  + + ++  PD       + VT  YRLG +   S+ +PQ N   N GL D+++AL W+ +NI AFGGD +NI L+G   G  ST  LALS        KAI +   +   W   P        N A ++ Q   Y GD K   IF+
Sbjct:   51 IKTKSGPVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFKAPEAV------EPWDQELDCTSPADK----PLQTHMFFRKYAGSEDCLYLNVYVKDLQPDKLRPVMVWIYGGGYQVGEASRDMYS--PDFFMSKDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALSPQTEGLIHKAIVMSGSVLCPWTQPPRN------NWAYRLAQKLGYTGDNKDKAIFE 296          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-71n6.4 (si:ch211-71n6.4 [Source:ZFIN;Acc:ZDB-GENE-091204-213])

HSP 1 Score: 177.178 bits (448), Expect = 6.546e-47
Identity = 136/549 (24.77%), Postives = 237/549 (43.17%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYE--KDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIK-KSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNIL---------KRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNY-VTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFN----MKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEEFSWI 2057
            +++T+CG + G   DG   F GIPYA PP+D  R+   + +VD   C E        Y A  ++S C Q +  +   K++G E+CL+L+V+ PS    K LPV+  + G +    SG  +G++ T ++ + TQ ++V+ NYRL     +        +P  +  N+G  D++ AL W+ +NI  FGGD   + ++G  SG T    L  S  A  LF      +   +   +L  A K    +L     K  +    L +  + Q   W    S   +   + P              + +    + DG++L         KR   N ++P V+G    E D  P   ++  W  + +   +K K+ PFG  V    L  +  +     S    E  +T  V+D++ +CP N + K+        P+YRY++   + P    N    + + +  A +  D++ +F G +  L  G     +I   +++ K    FA  G + +   +    V + L KN    +   + +  C  WE+       ++W+
Sbjct:   75 EVQTECGWLHGQWKDGAYSFKGIPYAVPPVDELRWKPPENLVDAGKCWE------GKYDATHFRSICAQVQPLQKDGKVMGEEDCLHLSVWTPSLHPAKPLPVMVWIHGGYLHMLSGQEKGYSPTEELAERTQMVYVSLNYRLNAFGFMALEMFREGSPTNSSGNYGFMDQIQALQWVQRNIHHFGGDPGRVTIFGQSSGGTSVWTLMMSPLAKGLFHGAIDMSGSYVYNASLESAEKDNLEFLRRTGCKDALCLRRLNIAQVLQAIPWQQYPSWAADDLVDLPVKG-----------VFVGPVAVIDGHVLEAPPFESWEKRGAFN-DVPFVVGTTEQETDFGPPYKNISAWIWEDYRWIVKSKLSPFGENVTSQALKLYNSSAPCPTSDRCPERLFTTMVSDMKASCPRNDLAKRAAGALK-SPVYRYLV--TYTPSKQANPSSWLPFPSRFAFHLLDSLAFFRGLEMAL--GTLSPADIDFQEMITKYFVYFAKEGRMPEEWPAFPARVAL-LDKNVSFVKS--YSSERCELWEEN--GFYSYAWV 595          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-89b15.3 (si:ch73-89b15.3 [Source:ZFIN;Acc:ZDB-GENE-141212-224])

HSP 1 Score: 95.5153 bits (236), Expect = 5.397e-20
Identity = 71/244 (29.10%), Postives = 122/244 (50.00%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVP-----SKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQ----TNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGS-TVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSY 1184
            K+  K G ++G + D    F GIP+A PP+   R+   + +   KG   VY   +  +P  +    C+    D      SE+CLYLNV+VP     +  + + LPV+  + G  F  GS +   +     +   TQ++ V+  YRLG    +++ +    T   N+G+ D+  AL W+ +NIAAFGGD S + ++G  +G+ +V+L L            ++ S P ++  KT  ++LK+ + +
Sbjct:   51 KLLIKDGLVQGLLLDKSYVFYGIPFADPPVGTSRWKAPRPVTPWKG---VY---DASFPRAACMQACIGPIADDCPKKVSEDCLYLNVFVPLSVDLATPLLQPLPVMLWIHGGDFIAGSASKPLYDGR-FISNYTQTVIVSIAYRLGAFGFLVSGKDPKSTAVGNYGILDQQAALIWVQQNIAAFGGDPSRVTIFGESAGAQSVSLHLMIQSSKPLFKQAVFQSLPFSIPLKTRRESLKLGKHF 287          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn4xa (neuroligin 4 X-linked a [Source:ZFIN;Acc:ZDB-GENE-100309-2])

HSP 1 Score: 93.9745 bits (232), Expect = 2.765e-19
Identity = 72/238 (30.25%), Postives = 112/238 (47.06%), Query Frame = 3
Query:  504 PIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKG----------CQEVYRN---LNHPYPA--KSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKA----IDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            P+   I   + ++LGIPYA PP   RRF   +  +   G          C +   +   LN   P    +     V Y +D      SE+CLYLN+YVP++      +   PV+  + G  +  G+GNM   ++   +      I VT NYRLG +  +    Q  + N+GL D++ AL WI +NI AF GD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   58 PLPNEILGPVEQYLGIPYALPPTGERRFQPPEPPMSWPGIRNATQFAPVCPQFLEDRFLLNDMLPVWFTANLDTVVTYVQDQ-----SEDCLYLNIYVPTEDDIHDENGLRPVMVYIHGGSYMEGTGNMIDGSI---LASYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVN 287          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: cel.1 (carboxyl ester lipase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1201])

HSP 1 Score: 92.8189 bits (229), Expect = 3.580e-19
Identity = 59/181 (32.60%), Postives = 92/181 (50.83%), Query Frame = 3
Query:  540 FLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVP-SKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVT-----PDVVKITQSIHVTSNYRLGPMNSIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGST 1061
            F GIP+A PP   +RF   ++ V   G + V +  +       Y+  C+Q    +  +IGSE+CLYLN++VP  + +   LPV+  + G  F  G G    F         ++      I VT NYR+G +  +         N+GL D+  A++W+H+NI AFGG+  NI L+G  +G+ 
Sbjct:   50 FKGIPFAAPP---KRF---EKPVAHPGWEGVLKTTD-------YRKRCLQLNLLATDVIGSEDCLYLNIWVPQGRTVSSNLPVMVFIYGGAFLLGGGQGANFLDNYLYDGEEMADRGNVIVVTFNYRVGALGFMSTGDDGIPGNYGLWDQHAAISWVHRNIKAFGGNPDNITLFGESAGAA 217          
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Match: nlgn2a (neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2])

HSP 1 Score: 92.8189 bits (229), Expect = 5.968e-19
Identity = 72/223 (32.29%), Postives = 109/223 (48.88%), Query Frame = 3
Query:  507 IEGNINDGIL----EFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYE-------KDSHKIIG------SENCLYLNVYVPSK---AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            I+  +N+ IL    ++LG+PYA  PI  RRF    +  +  G  +  RN     P        V  E        DS  +        SE+CLYLNVYVP++      +K PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q+ + N+GL D++ AL W+++NI  FGGD   I ++G G+G++    L  S  +  LF +
Sbjct:   59 IKKELNNEILGPVEQYLGVPYATAPIGDRRF----QPPEAPGSWQEVRNATQFAPVCPQNVHGVLPEIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGTGNMFDASV---LAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQR 274          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:Xenbase;Acc:XB-GENE-855484])

HSP 1 Score: 166.007 bits (419), Expect = 6.426e-43
Identity = 139/536 (25.93%), Postives = 223/536 (41.60%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSH--KIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGD--IKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILK---------RLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYIL----EDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWE 2021
            +E  CG + G     +  F GIPYA PP    R+   +E              N+   A  +KS C Q    S   K +GSE+CLY+NV+  S   D KLPV+  + G +    SG+  G+  T D+ +   ++HV+ NYRL     +        +P     N+G  D++ AL W+ KNI  FGGD   + +YG  SG T   A+  S  A  LF +    +   + T +++DA K   ++L       +E  +  L +D I Q   W              P   K           LI    I DG ++          +L    ++P VIG    E D  P   ++  W  + +  F+K K    G +  D         Y T     IE+ +T  V+D+R TCP N + ++  A S   P+YRY++        +P D   + Y +  A +  D + +F      L  G     + +  +++ K    FA  G++ D       Y     + +  +  E  +++ +C+ W+
Sbjct:   76 VEISCGKVRGKHCGKVYNFKGIPYASPPTGSLRWRPPKEPT----------CWNNTLDAIEFKSMCAQVRPLSKDGKAMGSEDCLYVNVWTTSIDHDSKLPVMVWIHGGYLHMLSGSEPGYGPTSDLAEHGPAVHVSFNYRLNAFGFMALHLLREGSPTNTSGNYGFMDQVAALRWVKKNIMKFGGDPDKVTIYGQSSGGTSVWAMMVSPLAKGLFHRAIDISGSAVFTASMDDAEKDNLAFLDQTGCNDAECLRK-LSMDKILQSIPWQGYPDWAAEDLCELPQKGK-----------LIGPVAIVDGYVVPAPPLEVWKNKLEGYSDVPFVIGTTLQETDFAPPYANLSQWSEEDYQWFVKGKSS-LG-LTKDALSLYPTSEYCTQPHRCIEKAFTTMVSDVRETCPKNEVAEQ-AAGSLTSPVYRYVVTYIPSGPAQPSDL--LPYPSRFAFHMLDTLGFFGTLD--LALGTTTADDRTFQRLMRKYFLHFAAEGKMPD---DWPQYPNKTALLSTTLSAESDYRSKQCSLWQ 579          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:Xenbase;Acc:XB-GENE-855484])

HSP 1 Score: 155.606 bits (392), Expect = 2.020e-39
Identity = 136/551 (24.68%), Postives = 225/551 (40.83%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSH--KIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGD--IKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILK---------RLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTF-RKNYVTDSILTIEE---GYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYIL----EDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEEFSW 2054
            +E  CG + G     +  F GIPYA PP    R+   +E              N+   A  +KS C Q    S   K +GSE+CLY+NV+  S   D KLPV+  + G +    SG+  G+  T D+ +   ++HV+ NYRL     +        +P     N+G  D++ AL W+ KNI  FGGD   + +YG  SG T   A+  S  A  LF +    +   + T +++DA K   ++L       +E  +  L +D I Q   W              P   K           LI    I DG ++          +L    ++P VIG    E D  P   ++  W  + +  F+K+ +  FG  +    L  +    Y T     IE+   G+   ++ + I  P       L A S   P+YRY++        +P D   + Y +  A +  D + +F      L  G     + +  +++ K    FA  G++ D       Y     + +  +  E  +++ +C+ W+     + +++W
Sbjct:   77 VEISCGKVRGKHCGKVYNFKGIPYASPPTGSLRWRPPKEPT----------CWNNTLDAIEFKSMCAQVRPLSKDGKAMGSEDCLYVNVWTTSIDHDSKLPVMVWIHGGYLHMLSGSEPGYGPTSDLAEHGPAVHVSFNYRLNAFGFMALHLLREGSPTNTSGNYGFMDQVAALRWVKKNIMKFGGDPDKVTIYGQSSGGTSVWAMMVSPLAKGLFHRAIDISGSAVFTASMDDAEKDNLAFLDQTGCNDAECLRK-LSMDKILQSIPWQGYPDWAAEDLCELPQKGK-----------LIGPVAIVDGYVVPAPPLEVWKNKLEGYSDVPFVIGTTLQETDFAPPYANLSQWSEEDYQWFVKVHLDTFGGSLTKDALSLYPTSEYCTQPHRCIEKSKSGFVLGLSIVSINGPTCQRRLYLFAGSLTSPVYRYVVTYIPSGPAQPSDL--LPYPSRFAFHMLDTLGFFGTLD--LALGTTTADDRTFQRLMRKYFLHFAAEGKMPD---DWPQYPNKTALLSTTLSAESDYRSKQCSLWQNN--GMFQYAW 596          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: nlgn4x (neuroligin 4 X-linked [Source:NCBI gene;Acc:100329189])

HSP 1 Score: 93.5893 bits (231), Expect = 4.539e-19
Identity = 78/273 (28.57%), Postives = 122/273 (44.69%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKG----------CQEVYRN---LNHPYPA--KSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKA----IDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDMI 1241
            KI     P+   I   + ++LG+PYA PP   RRF   +      G          C +       LN   P    +     V Y +D      +E+CLYLN+YVP++      + K PV+  + G  +  G+GNM   ++   +      I +T NYRLG +  +    Q  + N+GL D++ AL WI +NI AFGGD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N             K + I  D +  DM+
Sbjct:   54 KIRGTRTPLPIEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIKNATQFAPVCPQFLDERSLLNDMLPIWFTANLDTVVSYVQDQ-----NEDCLYLNIYVPTEDDIHDPNNKKPVMVYIHGGSYMEGTGNMIDGSI---LASHGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVN---------YQPAKYTRILADKVGCDML 309          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ACHE (acetylcholinesterase (Cartwright blood group) [Source:NCBI gene;Acc:100490673])

HSP 1 Score: 90.8929 bits (224), Expect = 2.577e-18
Identity = 135/568 (23.77%), Postives = 233/568 (41.02%), Query Frame = 3
Query:  486 IETKCGPIEG----NINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQY-----------EKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWI--SNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDM--IFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFIND-GNILKRLRVNHNIPIVIGNCANEVDIF-----P--SPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYV--TDSILTIE--EGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGA-------YGEKEISMSKVLNKAMREFAWNGELKD-----------FSASRDGYVMMNLIKNGQVYRECY-FKTNECNFWEKEL 2030
            + T+ G + G     ++  +  FLGIP+A PP+D+ RF  ++    KK   +V+        A +Y + C QY           E  +     SE+CLYLN++VP         +++I  G F+S  S +++ +     +      I V+ NYR+G    + + P + +   N GL D+ LAL W+  NIA FGGD   + ++G  +G+        S  +  LFSK  +   +P T          + +   LG      +  DT  L+   + QP      + +ID+ +   P P+  ++     +  + D DF  +   IL  +      P+++G   NE   F     P  S N+      + F   +K+ +       ND+ L+     Y    D    ++  E   + V D  + CPL     K+    N   +Y Y          +F+ + SN LA   W  +   HGY+    +G        Y  +E ++S+ + +    FA  G+  +           ++AS   Y+ +    N + Y+E    +   C FW + L
Sbjct:   31 VSTRSGKVRGLRQPVLSTHVSAFLGIPFAEPPVDKMRFRRSEP---KKPWTDVWD-------ATAYPNACYQYFDTLYPGFPGMEMWNPNRPMSEDCLYLNIWVPHPRPSNATVMVWIYGGGFYSGSS-SLDVYDGR-YLCHAENVIVVSMNYRVGAFGFLTLTPGSVDAPGNVGLFDQRLALQWVQDNIAFFGGDPRTVTIFGESAGAVSVGMHVLSPGSHHLFSKAALQSGSPNTPWATITPQEARRRTELLGKFLDCRMGNDTELLNCLRVKQP------QELIDHEFSVLPAPSVFRFA----FVPVPDADFFPEPPEILMNMGRFKPCPLIMGVNQNEGSYFLLYGAPGFSKNNESLITREEFLGGVKMSVP----QANDIALEAVVMQYTDWADEHAGVKNREAMDQLVGDHNVICPLTYFAGKVAETGN--RVYTY----------FFDHRASN-LAWPQWMGVP--HGYEIEFVFGLPLDANLNYTPQEEALSRRMMRYWANFARTGDPNEGNDAHQPRWPLYTASEQRYMAL----NNKPYQELQGIRVQTCMFWNRFL 553          
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 90.8929 bits (224), Expect = 3.512e-18
Identity = 67/235 (28.51%), Postives = 114/235 (48.51%), Query Frame = 3
Query:  504 PIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNH--PYPAKSYKSPC------VQYEKDSHKIIG-----SENCLYLNVYVPSKAIDKKL---PVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            P+   I   + ++LG+PYA PP+  +RF   +      G     RN  H  P   ++ ++        V +  +   + G     SE+CLYLN+YVP++   +     PV+  + G  +  GSGNM   +V   +      + +T NYR+G +  +    Q  + N+GL D++ AL W+ +N+A FGGD   I ++G G G++    L+ S  +  LF +  I +   L +  +N
Sbjct:   51 PLPSEILGPVDQYLGVPYAAPPVGEKRFLPPEPPPSWSGI----RNATHFSPVCPQNIQNAVPDIMMPVWFTSNLDTVTGYLQEQSEDCLYLNIYVPTEDDIRDTGAKPVMVYIHGGSYMEGSGNMIDGSV---LASYGNVVVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENVAFFGGDPHRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVN 278          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Nlgn2 (neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835])

HSP 1 Score: 93.9745 bits (232), Expect = 8.279e-21
Identity = 68/212 (32.08%), Postives = 103/212 (48.58%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY-------RNLNHPYPA-------KSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSK---AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +++FLG+PYA PP+  RRF   +      G +          +NL+   PA                Y ++      SE+CLYLN+YVP++       K PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q  + N+GL D++ AL W+ +NIA FGGD   I ++G G+G++    L  S  +  LF K
Sbjct:    7 VVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQ-----SEDCLYLNLYVPTEDDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSV---LAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQK 210          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ache (acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87876])

HSP 1 Score: 88.5817 bits (218), Expect = 7.108e-18
Identity = 61/223 (27.35%), Postives = 103/223 (46.19%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIG-----------SENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +++   GP+          FLGIP+A PP+  RRF   +      G  +          A ++++ C QY    +               SE+CLYLNV+ P        PV+  + G  F  G+ +++ +     + ++  ++ V+ NYR+G    +  P + E   N GL D+ LAL W+ +NIAAFGGD  ++ L+G  +G+        S+ +  LF +
Sbjct:   52 RLKAPGGPVSA--------FLGIPFAEPPVGSRRFMPPEPKRPWSGVLD----------ATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGR-FLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHR 255          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Nlgn2 (neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835])

HSP 1 Score: 88.9669 bits (219), Expect = 9.287e-18
Identity = 70/229 (30.57%), Postives = 105/229 (45.85%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY-------RNLNHPYPA-------KSYKSPCVQYEKDSHKIIGSENCLYLNVYVP------SKAIDK--------------KLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +++FLG+PYA PP+  RRF   +      G +          +NL+   PA                Y ++      SE+CLYLN+YVP      +K  D+              K PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q  + N+GL D++ AL W+ +NIA FGGD   I ++G G+G++    L  S  +  LF K
Sbjct:   66 VVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQ-----SEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSV---LAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQK 286          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Nlgn2 (neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835])

HSP 1 Score: 88.9669 bits (219), Expect = 9.287e-18
Identity = 70/229 (30.57%), Postives = 105/229 (45.85%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY-------RNLNHPYPA-------KSYKSPCVQYEKDSHKIIGSENCLYLNVYVP------SKAIDK--------------KLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +++FLG+PYA PP+  RRF   +      G +          +NL+   PA                Y ++      SE+CLYLN+YVP      +K  D+              K PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q  + N+GL D++ AL W+ +NIA FGGD   I ++G G+G++    L  S  +  LF K
Sbjct:   66 VVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQ-----SEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSV---LAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQK 286          
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Match: Ache (acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87876])

HSP 1 Score: 88.5817 bits (218), Expect = 1.081e-17
Identity = 61/223 (27.35%), Postives = 103/223 (46.19%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIG-----------SENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            +++   GP+          FLGIP+A PP+  RRF   +      G  +          A ++++ C QY    +               SE+CLYLNV+ P        PV+  + G  F  G+ +++ +     + ++  ++ V+ NYR+G    +  P + E   N GL D+ LAL W+ +NIAAFGGD  ++ L+G  +G+        S+ +  LF +
Sbjct:   52 RLKAPGGPVSA--------FLGIPFAEPPVGSRRFMPPEPKRPWSGVLD----------ATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGR-FLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHR 255          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|P23654|NRT_DROME (Neurotactin OS=Drosophila melanogaster OX=7227 GN=Nrt PE=1 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 2.812e-25
Identity = 104/412 (25.24%), Postives = 186/412 (45.15%), Query Frame = 3
Query:  492 TKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS-------IHVTSNYRLG--------PMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVT-KTLNDALKVQQSYLGDIKKSEI---FQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDND--FINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIK--LKMKPFGRV-VNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPL 1655
            T CGP+EG   DG   F GIPYA PP+DR R+  A+ I D   C       N      +    C Q   +    +G E+CLYL+V  P    +  LPV+ ++       G+ ++ G   +P +++ +         I V  N+RLG         +    +P T+  N+ L+D +  L WI  NI  FGGD  ++ L G  +G+T+   L NS K   L+++ W S+   ++  K L+++ K  +  +  ++ ++I    + + +      P  W +          + P P +A  +     +L++D D  F +  +  KR + N    +V+G  A+E         +R   A++  + ++  L+    G + + D  ++ +  +    S+++I       ++DIR  CPL
Sbjct:  365 TGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMC------WNDTLQTHNSSVVCTQRLGNG-TTVGDEDCLYLDVVTPHVRYNNPLPVVVLI-------GAESLAG--PSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTS-GNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFP-------VDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHT----EKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYA-SLVSI-------ISDIRSVCPL 740          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|P37967|PNBA_BACSU (Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) OX=224308 GN=pnbA PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.482e-20
Identity = 73/222 (32.88%), Postives = 108/222 (48.65%), Query Frame = 3
Query:  480 QKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQ--------YEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET---NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            Q + T+ G ++G   +G+ ++ GIPYA PP+ + RF   +         EV+ ++     A +Y S C Q        Y +   +   SE+CLY+NV+ P     K LPV+  + G  F  G+G+ E       +    + I VT NYRLGP   +     NE    N GL D+  AL W+ +NI+AFGGD  N+ ++G  +G     AL     A  LF K
Sbjct:    4 QIVTTQYGKVKGTTENGVHKWKGIPYAKPPVGQWRFKAPE-------PPEVWEDV---LDATAYGSICPQPSDLLSLSYTELPRQ---SEDCLYVNVFAPDTP-SKNLPVMVWIHGGAFYLGAGS-EPLYDGSKLAAQGEVIVVTLNYRLGPFGFLHLSSFNEAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKGLFQK 210          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q04456|EST1_CAEBR (Gut esterase 1 OS=Caenorhabditis briggsae OX=6238 GN=ges-1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.669e-20
Identity = 72/227 (31.72%), Postives = 108/227 (47.58%), Query Frame = 3
Query:  471 FAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEK--DSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNE-TNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLV 1142
            +A   + T  G +EG        FL IP+A PP+D  RF       +K    E + ++   Y A  +++ C  + +          E+CL LNV  P K I+KKLPV+F V G  +  GSG+  G+    D       I VT  YRLG M       ++   N+GL D+  AL ++ +NI  FGGD  +I ++G  +G+     L+ S     L+SK  I +  + V
Sbjct:   15 WAGPVVNTNYGKVEGFEYGAAEVFLAIPFAKPPVDNLRF-------EKPEAPEPWEDV---YQATQFRNDCTPHYRLVAQFSSYSGEDCLTLNVIKP-KTIEKKLPVLFWVHGGGYEIGSGSQHGYEFFADRYTSQGVIVVTIQYRLGFMGFFSEGTSDAPGNYGLFDQAAALRFVKENIGNFGGDPDDITIWGYSAGAASVSQLTMSPYTHDLYSKAIIMSASSFV 230          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01470|PCD_PSEOX (Phenmedipham hydrolase OS=Pseudarthrobacter oxydans OX=1671 GN=pcd PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.587e-19
Identity = 64/215 (29.77%), Postives = 103/215 (47.91%), Query Frame = 3
Query:  489 ETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYR-NLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNP 1130
             T  G + G + DG+  F G+PYA PP+   R+  A+      G ++      + P P +   SP +    D       E+CL LN++ P+     + PV+  + G     GSGN+  +  T    +    + ++ NYRLGP+  +      + N  L+D++ AL WI  N+AAFGGD + I L G   G+    AL+    A +LF +  + +P
Sbjct:    8 HTTAGDLGGCLEDGLYVFRGVPYAEPPVGDLRWRAARPHAGWTGVRDASAYGPSAPQPVEPGGSPILGTHGDPPF---DEDCLTLNLWTPNLDGGSR-PVLVWIHGGGLLTGSGNLPNY-ATDTFARDGDLVGISINYRLGPLGFLAG--MGDENVWLTDQVEALRWIADNVAAFGGDPNRITLVGQSGGAYSIAALAQHPVARQLFHRAILQSP 215          
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Match: sp|P18142|D2_DICDI (cAMP-regulated D2 protein OS=Dictyostelium discoideum OX=44689 GN=D2 PE=2 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 2.553e-19
Identity = 73/229 (31.88%), Postives = 118/229 (51.53%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKI---IG-SENCLYLNVYVPSKAI-DKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQS--IHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGS-TVALALSNSIKAIRLFSKIWISNPMTLVTK 1148
            + T+ G I+G + D    F G+P+A PP+++ R+   +  +D K  + V   L         KS C Q       +   IG SE+CLYL+V+ P  A  + K PVI  + G  FS GSG++  +    D  K  QS  I V  NYRLG +   +       N+G  D++ AL W++ NI +FGG++  I ++G  +G+ +V+  L+++       + I  S+P+T+  K
Sbjct:   34 VVTQFGAIKGIVEDTHRVFYGVPFAQPPVNQLRW---ENPIDLKPWENVRETLTQ-------KSQCAQKCNLGPGVCSPIGTSEDCLYLDVFTPKDATPNSKYPVIVYIPGGAFSVGSGSVPLY----DATKFAQSSVIVVNINYRLGVL-GFMGTDLMHGNYGFLDQIKALEWVYNNIGSFGGNKEMITIWGESAGAFSVSAHLTSTYSRQYFNAAISSSSPLTVGLK 247          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A183AIC9 (COesterase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6714 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 6.105e-94
Identity = 191/574 (33.28%), Postives = 298/574 (51.92%), Query Frame = 3
Query:  474 AKQKIETKCGPIEGNIN-DGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY-RNLNHP-YPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKA----IDKKLPVIFIVSGLFFSYGSGNMEGFTVTP------DVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNP-MTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLD---MIFQPWNWTNIESIIDNRYFNFP--TPNKAKYTNDSIYFLLIDNDFINDGNILKRLR---VNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNY-VTDSILT----------IEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGAYG---------EKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEE---FSWII 2060
            A+  + T CG ++G ++ DGI+ FLGIPYA PPI + RF    E+  ++ C++ +  N + P +P   YK PC+Q E  + K++G E+CLY+NV+VPS       D   PVI  +SGLFF YG G+  G +V          ++   +IHVT NYR+GP+  + +P+  + N GL D+L  L WI  N+ AFGGD + + L+G GSG+T ALALS S+    LF ++W++ P + L   TL +A+   +        S    D   L+    + + W WTN+ES +    F+ P  T + AK  +++      D   ++DGN++   R     + +P VIG   +E  ++ +P +V +W   ++  ++       GR+      D+ +  + +TD   +          +E   T  +TD R TCPL  +++  + L    PIYRY L   H+  D + +     LA +GWD +LY  GY +H +Y   G         E+ + MS VLNKAM EFA +G ++ +  S   +  +NLI  GQV R   F    C  WE  L N ++   F+W +
Sbjct:   80 AQTIVNTFCGTVQGFLDSDGIVSFLGIPYALPPIGQYRFKRPVELTTRELCKQAWSENGSEPVHPVTHYKPPCMQLEPLTDKLVGEEDCLYVNVFVPSSGQSSTSDTARPVIVQLSGLFFLYG-GSASGLSVAAGQQPHAQTIRSVDAIHVTFNYRIGPLGFLTHPRVKQPNLGLYDQLALLRWIRNNVGAFGGDPTRVTLFGYGSGATCALALSQSLLGHSLFDRLWVTAPALGLPKLTLKEAITHSEKLFQCSSSSGASCDAGYLNDAPSVVRLWKWTNVESWLKKGLFSLPDLTSSNAKTVDEASPGF--DRILVDDGNLVDTRRWYNPTYAVPTVIGQTGHEAALYLAPVTVPFWDETFYQQYL------LGRLAQG---DSSKTRFALTDPTCSNRSQPKQAFDVEAHLTALITDARYTCPLTQVVR--LWLGQGQPIYRYYLISTHRRFDPYALSSFVSLAFHGWDGMLYLRGYLTHPDYRNSGLIASGVDEMEELVQMSHVLNKAMHEFARSGRIRQWKQSEPDWDHVNLIDQGQVCRPWKFLEQRCKVWE-HLSNSDDLLHFAWPV 638          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A2H1CPF2 (Carboxylesterase OS=Fasciola hepatica OX=6192 GN=D915_001769 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.410e-88
Identity = 187/569 (32.86%), Postives = 289/569 (50.79%), Query Frame = 3
Query:  474 AKQKIETKCGPIEGNIN-DGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY--RNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKL------PVIFIVSGLFFSYGSGNMEGFTVTPD------VVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNP-MTLVTKTLNDALKVQQ------SYLGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILKRLR---VNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVND----VFLDTFRKNYVTD----------SILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGAYG-----EKEI----SMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGN 2036
            A+  + T CG ++G +N DGI+ FLGIPYA  P+   RF    E+  ++ C++ +   + +  +    YKSPC+Q E  + K++G+E+CLY NV+VP    D+ L      PVI  +SGLFF YG G+  G +VT         V+   +IHVT N+R+GP+  + +P+T + N GL D+L  L WI  NI AFGGD + + L+G GSG+T ALALS S+    LF ++WIS P + L   +L +A+   +      S L    ++    D      I + W+W ++E  +    F+ P         D       D   ++DGN++   R     + +P VIG   +E  ++ +P +V +W   ++  ++       GR+  D    + L T  +  +TD           I  +E   T  +TD R TCPL  +++K        PIYRY L   H+  D + +     LA +GWD +LY  GY SH +Y + G     E+E+     MS++LN+AM EF+  G ++ +  S   +  +NLI  GQV R   F    C  WE  +G+
Sbjct:   80 AQTVVNTLCGTLQGFVNSDGIITFLGIPYALAPVGVNRFKRPVELTTQELCKQAWGTNSSDMVHLVTQYKSPCMQLEPITDKLVGNEDCLYANVFVPVS--DQPLTPSTARPVIVQISGLFFLYG-GSAAGLSVTAGQQPHARTVRTVDAIHVTFNHRIGPLGFLTHPRTKQPNLGLYDQLALLRWIRSNIGAFGGDPTRVTLFGYGSGATCALALSQSLLGHSLFDRLWISAPALGLPKLSLEEAVTHSEQLFECNSSLNASCEAGYLNDG---PSILRLWSWFHMEPWLKQGLFSLPDLTSDSMNLDKSTRSWFDRILVDDGNLVDARRWYNPTYTVPTVIGQTGHEAALYLAPVTVPFWDETFYQQYL------LGRLAQDESSKMDLITQLRFALTDPTCSNRSQPKQITDVEAHLTSLITDARYTCPLTQVVRKWTEQG--QPIYRYYLISTHRRFDPYALSSFVSLAFHGWDGMLYLRGYLSHPDYISSGLVFSNEQEVDDLLQMSQLLNRAMHEFSRTGRIRQWKPSESDWDHVNLIDEGQVCRPWKFLEQRCKVWEHLIGS 634          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A4S2LNX4 (COesterase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005891 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 4.131e-81
Identity = 173/566 (30.57%), Postives = 290/566 (51.24%), Query Frame = 3
Query:  477 KQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHP-----YPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKK----LPVIFIVSGLFFSYGSGN----MEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTK-TLNDAL-KVQQSYLGDIKKSEIFQDTLKLDM--IFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIY---FLLIDNDFINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDV----FLDTFRKNYVTDSI------LTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEY---------GAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKEL-GNIEEFSW 2054
            K  + T CG ++G  ++G++ FLG+PYA PP+ + RF    E+     C + + N N       Y A +YKSPC+Q    + K+IG+E+CLYLNV+VP+ A+        PVI +++GLFF+YG  +     +G    P  V++  +IHVT NYR+GP+  +++P+T E N GL D+L AL W+  NI AFGGD + + L+G GSG+T ALAL+ S     LF  +W+S P       +L +A+   ++ Y  +   +    + L  D   I + WNW  IES + +  F+ P+  + +   +  +    L++D + I+     +  R  +++  V+G  A+E  +F SP +V +W   ++  ++   +    ++  D+     + + +  Y +           +E   T  +TD R TCPL   +++L A S+ + +Y Y L  +H+  D ++      L+ +GWD ++Y  GY +H +Y           + E     S +LN AM EF+  G +  ++    G   +NLI+NG V     F    C  W+    GN  + +W
Sbjct:   84 KSVVSTFCGIVQGTESNGVVSFLGLPYALPPLGQYRFKRPVELTTTHLCAQAWANNNSSANTDSYNATAYKSPCLQLSPVTDKVIGNEDCLYLNVFVPAMALTSSKTELRPVIVVLNGLFFTYGGASGLPVSQGQQPQPRTVELVDAIHVTLNYRIGPLGFLMHPETKEANIGLYDQLAALRWVRNNIGAFGGDAARVTLFGYGSGATCALALAFSSLGQNLFDNLWVSAPAVRKPHCSLQEAVDNSRRLYSCEPGNTRPCSNGLLADPKDIVRLWNWARIESWMKDSLFSLPSFAQIQGGAEQDWVDRILIVDYEMIDPK---RWYRPIYHLSTVLGQTAHETALFVSPITVPFWDESFYRRYLINTLTSGTKIGQDIIDQYLIVSNKTTYCSHPRSGNSFGFDVEARMTGLITDARCTCPLVETVQQL-ASSHGNFVYHYYLFGQHRRFDPYSFTSFVSLSFHGWDGMVYLRGYTTHPDYIQSMLDQNDHDHMEDLGRQSDLLNTAMHEFSRTGRILSWNPVEPGNTPVNLIENGAVCNPPKFVEERCRLWKLVTNGNPLDLAW 645          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A075A2P4 (Carboxylesterase OS=Opisthorchis viverrini OX=6198 GN=T265_03625 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 7.859e-80
Identity = 175/564 (31.03%), Postives = 288/564 (51.06%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLN-----HPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKK----LPVIFIVSGLFFSYGSGN----MEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTK-TLNDALK-VQQSYLGDIKKSEIFQDTLKLDM--IFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIY---FLLIDNDFINDGNILKR-LRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDV----FLDTFRKNYVT------DSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEY---------GAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKEL-GNIEEFSW 2054
            + T CG ++G  + G++ FLG+PYA PP+ + RF    E+     C + + N N       Y A  YKS C+Q    + KIIG+E+CLYLNV+VP+ A+        PVI +++GLFF+YG  +     +G    P  V++  +IHVT NYR+GP+  +I+P+T E N GL D+L AL W+  NI AFGGD + + L+G GSG+T ALAL+ S     LF  +WIS P       +L +A++  ++ Y  +   +    + L  D   I + WNW  IES + +  F+ P+  + +   +  +    L++D++ I+     KR  R  +++  V+G  A+E  +F SP +V +W   ++  ++   +    ++  D+     + + +  Y +           +E   T  +TD R TCPL   +++L A S+ + +Y Y L  +H+  D ++      L+ +GWD ++Y  GY +H +Y           + E     S +LN  M EF+  G +  ++    G   +NLI+NG V     F    C  W+    GN  + +W
Sbjct:   86 VSTFCGIVQGTESKGVVSFLGLPYALPPLGQYRFKRPVELTTTHLCAQAWTNNNFSANTDSYNATVYKSSCLQLSPVTDKIIGNEDCLYLNVFVPAMALTSSKTELRPVIVVLNGLFFTYGGASGLPVSQGQQPQPRTVELVDAIHVTLNYRIGPLGFLIHPETKEANIGLYDQLAALRWVRNNIGAFGGDAARVTLFGYGSGATCALALAFSSLGQNLFDNLWISAPAVRKPHCSLQEAVENSRRLYSCEPGSTRPCSNGLLTDPKDIVRLWNWARIESWMKDSLFSLPSSAQIQGGAEQDWVDRILIVDHEMIDP----KRWYRPIYHLSTVLGQTAHETALFVSPITVPFWDESFYRRYLINTLTSGTKIGQDIIDQYLIVSNKTTYCSYPRSGNSFGFDVEARMTGLITDARCTCPLAETVQQL-ASSHGNFVYHYYLLGQHRRFDPYSFTSFVSLSFHGWDGMVYLRGYTTHPDYIQSMLDQNDHDHLEDLGRQSDLLNTVMHEFSRTGRILSWNPVEPGNTPVNLIENGAVCTPPKFVEERCLLWKLMTNGNPLDLAW 644          
BLAST of COesterase domain-containing protein vs. TrEMBL
Match: A0A3R7GHI9 (Para-nitrobenzyl esterase OS=Clonorchis sinensis OX=79923 GN=pnbA PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 8.381e-80
Identity = 173/567 (30.51%), Postives = 292/567 (51.50%), Query Frame = 3
Query:  477 KQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLN-----HPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKK----LPVIFIVSGLFFSYGSGN----MEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTK-TLNDALK-VQQSYLGDIKKSEIFQDTLKLDM--IFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIY---FLLIDNDFINDGNILKR-LRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDV----FLDTFRKNYVTDSILT------IEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEY---------GAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKEL-GNIEEFSW 2054
            K  + T CG ++G  ++G++ FLG+PYA PP+ + RF    E+   + C + +   N     + Y A  YKS C+Q    + K+IG+E+CLYLNV+VP+ A+        PVI +++GLFF+YG  +     +G    P  V++  +IHVT NYR+GP+  +++P+T E N GL D+L AL W+  NI AFGGD + + L+G GSG+T ALAL+ S     LF  +WIS P       +L +A++  ++ Y  +   +    + L  D   I + WNW  IES + +  F+ P+  + +   +  +    L++D++ I+     KR  R  +++  V+G  A+E  +F SP +V +W   ++  ++   +    ++  D+     + + +  Y +    +      +E   T  +TD R TCPL   +++L A S+ + +Y Y L  +H+  D ++      L+ +GWD ++Y  GY +H +Y           + E     S +LN  M EF+  G +  ++    G   +NLI+NG V     F    C  W+    GN  + +W
Sbjct:   84 KSVVSTFCGIVQGTESNGVVSFLGLPYALPPLGQYRFKRPVELTTTRLCAQAWATNNFSANTNSYNATVYKSSCLQLSPVTDKVIGNEDCLYLNVFVPAMALTSSKTELRPVIVVLNGLFFTYGGASGLPVSQGQQPQPRTVELVDAIHVTLNYRIGPLGFLMHPETKEANIGLYDQLAALRWVRNNIGAFGGDAARVTLFGYGSGATCALALAFSSLGQNLFDNLWISAPAVRKPHCSLQEAVENSRRLYSCEPGSTRPCSNGLLADPKDIVRLWNWARIESWMKDSLFSLPSFAQIQGGAEQDWVDRILIVDHEMIDP----KRWYRPIYHLSTVLGQTAHETALFVSPITVPFWDESFYRRYLINTLTSGTKIGQDMIDQYLIVSNKTTYCSHPSSSNSFGFDVEARMTGLITDARCTCPLAETVQQL-ASSHGNFVYHYYLFGQHRRFDPYSFTSFVSLSFHGWDGMVYLRGYTTHPDYIQSMLDQNDHDHMEDLGRQSDLLNTVMHEFSRTGRILSWNPVEPGNAPVNLIENGAVCTPPKFVEERCRLWKLVTNGNPLDLAW 645          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-71n6.4 (para-nitrobenzyl esterase-like [Source:NCBI gene;Acc:103038331])

HSP 1 Score: 145.206 bits (365), Expect = 4.036e-36
Identity = 138/564 (24.47%), Postives = 246/564 (43.62%), Query Frame = 3
Query:  462 PIDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYE--KDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALK-----VQQSYLGDIKKSEIFQDTLKLDMIFQPWN---WTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNIL--------KRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNY---VTDSILTIEEGYTRAVTDIRITCPLNSILKKLM-ALSNWHPIYRYILE-DKHKPIDYFN-MKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGEL-KDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEEFSWI 2057
            P  FA+  + T  G + G    G   F GIPYA PP+   R+   +++     C       +  Y A   ++ C Q +  + +  + G E+CL+L+V+ PS    ++LPV+    G +    SG  +G++ T ++   T ++ V+ NYRL     +        +P     N+G  D++LAL W+ +NI  FGGD   + ++G  SG T    L  S  A  LF +    +   +   +L  A K     ++++   D         T  L  I  PW    +   E + D        P K ++              + DG++L        K+    +++P V+G    E D  P   ++  W    +  F++ K+ PFG V     L  +  +    + D     E  YT  V+D+R+TCP N + K+   ALS+  P+YRYI+     K +D+   M + +  +    D++ +F   +  L  G    ++ +   +L K    FA  G++  D+     G  +++  K+ +  R+ +  +  C  WE++  +  +++WI
Sbjct:   70 PPGFAE--VVTDFGWLRGRHQGGAYSFSGIPYAVPPVGELRWKPPEDLKHAGKC------WHGVYDATYVRNVCAQIQPLERNGSVTGKEDCLHLSVFTPSLRPAERLPVMVWFHGGYLHMLSGQEKGYSPT-ELAAQTNTVFVSLNYRLNAFGFMALEVLREGSPTNTSGNYGFMDQILALQWVQRNIHVFGGDPGKVTIFGQSSGGTSVWTLMMSPLAKNLFHRAIDMSGSYVYNASLESAEKDNLVFLRKTGCRDAACLRKLSATQVLQAI--PWEEYPYWAAEDLTD-------IPVKGRFCGPVA---------VVDGHVLPLPPFEAWKKPGQFNDVPFVVGTTQQEADYSPIMKNISQWTWADYEWFVREKLSPFGNVSVSEALRLYNSSAPCPINDRC--PERLYTTLVSDMRVTCPNNDLAKRAKDALSS--PVYRYIVTYTPSKAVDFAPWMPFPSRFSFRLLDSLAFFSSLEMVL--GTMSPEDKAFQDLLTKYFIYFAKEGKMPADWPEFVSGTALLD--KSLRAERDPF--SERCRLWEEQ--DFYKYAWI 594          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-30c15.17 (cAMP-regulated D2 protein-like [Source:NCBI gene;Acc:103030643])

HSP 1 Score: 103.99 bits (258), Expect = 1.277e-22
Identity = 79/250 (31.60%), Postives = 122/250 (48.80%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQY------EKDSHKIIGSENCLYLNVYVP-----SKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII---NPQTNET-NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGS-TVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYL 1187
            + T  GP+ G   D    F GIPYA PP+  +R+T  + +               PY A   +  C+Q       E    KI  SE+CLYLNV+VP     SK   K LPV+  + G  F  GS +   +     +   + ++ V   YRLG    ++   +PQ++   N+G+ D+  AL W+H+NIAAFGGD + + L+G  +G+ +V+L L   I           S P ++  KT  DA+K+ + ++
Sbjct:  169 VLTHSGPVRGLTLDKAHVFYGIPYAAPPVGPKRWTAPKPV----------SPWTQPYDATFPRPACMQVCAGEFSEMCPPKI--SEDCLYLNVFVPLSVDLSKPKTKALPVMVWIHGGDFIAGSASKPLYDGR-FISNYSNTLVVNMEYRLGAFGFLVTGKDPQSSAVGNYGILDQQAALQWVHQNIAAFGGDPAKVTLFGESAGAQSVSLHLMMQISEPLFRHAAVQSQPFSIPLKTRFDAMKLGRDFV 405          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006974.2 (cholinesterase [Source:NCBI gene;Acc:103037776])

HSP 1 Score: 95.1301 bits (235), Expect = 5.734e-20
Identity = 65/198 (32.83%), Postives = 104/198 (52.53%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYK-SPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKK----LPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYG--VGSGSTVALALSNSIKAI 1097
            ++ FLGIPYA PP+   RF+  + +    G ++  +  N  + +   K       E  +     SE+CLYLNV+ PS  +       +PV+  + G  FS G+ +++ +     + +  + + V+ NYRLGP+  +  P + E   N  L D+ LALTW+ +NIAAFGGD S++ L+G   G+GS     LS    A+
Sbjct:   58 VVGFLGIPYAKPPLGALRFSRPEPVEAWSGVRDTSQFSNSCWQSVDTKFQGFAGAEMWNPNTKLSEDCLYLNVWTPSGRLQDPHQALVPVMVWIYGGGFSSGTASLDVYDGR-YLSRSEEVVVVSMNYRLGPLGFLSLPGSEEVKGNAALFDQRLALTWVAENIAAFGGDPSSVTLFGESAGAGSIGHHVLSVGSHAL 254          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: nlgn4xb (neuroligin-4, X-linked-like [Source:NCBI gene;Acc:103022054])

HSP 1 Score: 93.9745 bits (232), Expect = 2.000e-19
Identity = 75/263 (28.52%), Postives = 118/263 (44.87%), Query Frame = 3
Query:  465 IDFAKQKIETKCGPIEG-------NINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKD--------------------SHKIIGSENCLYLNVYVP----SKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            ++F    + T  G + G        I   + ++LG+PYA PP   RRF   +      G     RN      A  + + C QY +D                    ++    +E+CLYLNVYVP    ++  D   PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q  + N+GL D++ AL W+ +NI AF GD   + ++G G+G++    L+ S  +  LF K  I +   L +  +N
Sbjct:   22 LNFQYTTVTTNYGKLRGFRALLPSEILAPVEQYLGVPYALPPTGERRFQAPEPPNSWPGI----RN------ATQFAAVCPQYLEDRLLLSDMLPVWFTANLDTVATYVQDQNEDCLYLNVYVPTEEDTQEDDGLKPVMVYIHGGSYVEGTGNMIDGSV---LASYGNVIVVTINYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWVKENIQAFNGDPRRVTIFGSGAGASCVSLLTLSHYSEDLFQKAIIQSGTALSSWAVN 271          
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Match: nlgn2a (neuroligin 2 [Source:NCBI gene;Acc:103033407])

HSP 1 Score: 93.9745 bits (232), Expect = 2.025e-19
Identity = 73/229 (31.88%), Postives = 112/229 (48.91%), Query Frame = 3
Query:  507 IEGNINDGIL----EFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQ-------------YEKDSHKIIG------SENCLYLNVYVPSK---AIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            I+ ++N+ IL    ++LG+PYA  PI  RRF    +  +  G  +  RN      A  +   C Q             +  DS  +        SE+CLYLNVYVP++      +K PV+  + G  +  G+GNM   +V   +      I VT NYRLG +  +    Q+ + N+GL D++ AL W+++NI  FGGD   I ++G G+G+T    L  S  +  LF +
Sbjct:   59 IKKDLNNEILGPVEQYLGVPYATAPIGDRRF----QPPEAPGSWQEVRN------ATQFAPVCPQNLHGVLPEIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDDIRDRRKKPVMLFIHGGSYMEGTGNMFDASV---LAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGATCINLLILSHHSEGLFQR 274          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002735.1 (pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 gene:ENSPMAG00000002501.1 transcript:ENSPMAT00000002735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.177e-20
Identity = 66/237 (27.85%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVY-RNLNHPYPAKSYKSPCVQ--YEKDSHKIIG------SENCLYLNVYVPSK---AIDKKLP----VIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTN--ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYL 1187
            + +FLG+PYA  P   RRF+ A+      G +E   R    P P  +++   +   +E  + ++        SE CL L+VY+P +   +I  + P    ++F+  G F     G  +G  +          I V   YRLG + S  +   +    N+GL D+++AL W+ +N+  FGGDQ  + L G G+G+  A  L+ S  A  LF ++   +   L +  LN   ++  + L
Sbjct:    1 VTQFLGVPYARAPRGERRFSAAEPPAVWSGEREAATRGPPCPQPVPNHRGWGMLPVWEAGNERLATWLSSKQSEECLNLDVYIPGRDGESIPGERPPLAVMVFLHGGSFLDGAGGLYDGSALAAH----GDVIVVIVTYRLGVLGSFFSTGDSLARGNYGLLDQVMALRWVRENVGHFGGDQGRVTLVGAGTGAACASLLALSHHAEGLFQRVIAQSGTALSSWALNHRPELSAAAL 233          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007813.1 (pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1 gene:ENSPMAG00000007070.1 transcript:ENSPMAT00000007813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 5.719e-16
Identity = 61/196 (31.12%), Postives = 92/196 (46.94%), Query Frame = 3
Query:  501 GPIEG---NINDGIL--EFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQ---------YEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGN-MEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILY 1040
            G ++G   N+  GI    F+GIPYA PPI   RF     +    G           Y A ++   C Q         + K  H     E+CLYLNV++P  + + K+ V+  + G  + YG+    EG  +    V     I VT NYRLGP+  +    + +  N+GL D+  AL W+  NI +FGGD + + ++
Sbjct:   49 GKLQGLRINLGQGISVEAFVGIPYAKPPIGDLRFRKPVPLEKWDGV----------YNATTFSPACYQKPWFLEEISFGKFDHF---DEDCLYLNVFIPEVS-ENKMAVMVWIHGGAYRYGTAEEYEGRFLAAAGV-----ILVTVNYRLGPLGWLSTGDEQSRGNYGLWDQHAALMWVKHNIESFGGDANRVTIF 225          
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 69.707 bits (169), Expect = 2.216e-12
Identity = 54/171 (31.58%), Postives = 80/171 (46.78%), Query Frame = 3
Query:  540 FLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKS--PCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYG 1043
            FLG+PYA PP+D  RF+  Q              +N  + A  YK+   C+Q +      + SE+CLYLN++VP K       V+    G   S+G G+ +G      +  +   I VT+NYRLG    +    +    N GL D+  AL W+  + A FGG    + + G
Sbjct: 2235 FLGVPYAAPPLDANRFSGPQPPRPLA--------VNETWDADRYKTRPDCLQPDGQRGTSL-SEDCLYLNIFVP-KVKPHNASVLVFFHGGDNSFG-GSAQGPLDPSYLAALGDIIVVTANYRLGLFGFLSTGDEAAAGNWGLLDQQAALRWVRDHAALFGGSAGAVTVAG 2394          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO38887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBL2])

HSP 1 Score: 109.383 bits (272), Expect = 1.706e-27
Identity = 71/197 (36.04%), Postives = 100/197 (50.76%), Query Frame = 3
Query:  486 IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGP-----MNSIINPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSG 1055
            I T  G I G  N     F GIPYA PPI+  R+            Q  +        A  Y   C Q   +  ++IGSE+CLYLNV+ PS  +D K PV+  + G   +YGSG+  G   TP+ V     + ++ NYRL       ++++ +   + T  N+G  D+++AL+WIH NIA FGGD   +IL G  SG
Sbjct:    1 IATDGGTIRGTRNSNAWVFKGIPYAKPPINDMRWKPPFPCGHNHCWQGTFN-------AAFYGKVCPQLNSED-QVIGSEDCLYLNVWTPS--VDIKQPVLVFIHGGELTYGSGHDSGIHPTPEFVSNLGVVGISFNYRLNAFGFLSLDALSDGSKSNTSGNYGFMDQIMALSWIHTNIARFGGDPDRVILLGQSSG 187          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO35390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM1])

HSP 1 Score: 96.6709 bits (239), Expect = 5.838e-21
Identity = 70/218 (32.11%), Postives = 112/218 (51.38%), Query Frame = 3
Query:  465 IDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQ------YEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTN-ETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSG-STVALALSNSIKA 1094
            I   + KI+    P+ G     I  FLGIPYA  P+   RF   Q  ++  G ++          AKSY++ C Q      ++  +     SE+CL+LNVY P+K  + KLPV+  + G  + + + N    +V   +      I VT NYRL  +  +  P T    N+G+ D++ AL W+ +NIA+FGG+ S++ L+G  SG ++V L + + + A
Sbjct:   29 ITLEQGKIQGMREPVPGGYEVEI--FLGIPYARAPVGELRFADPQPPLEWTGIRD----------AKSYRAVCPQAPFLPNFQPLTENDTISEDCLFLNVYRPTK-FNHKLPVMVWIHGGGYYHATANWFDGSV---LASHNNVIVVTINYRLALLGFLHIPGTQLRGNYGMLDQVQALKWVQQNIASFGGNPSHVTLFGESSGAASVTLHILSPLSA 230          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO35372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM2])

HSP 1 Score: 94.3597 bits (233), Expect = 3.674e-20
Identity = 83/261 (31.80%), Postives = 123/261 (47.13%), Query Frame = 3
Query:  540 FLGIPYAFPPIDRRRFTHAQEI--------VDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKA-IDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET-NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPM-------TLVTKTLNDALK---------VQQSYLGDIKKSEIFQDTLKLDMIF 1244
            F GIP+A PPI   RF  ++            K G + VY  +  P  AK   SP      DS     SE+CL+LNV+ P+     K LPV+  + G  +  GSG++  +  TP +      I VT NYRLG +  +    T+ T N+ + D++LAL W+ ++I  FGGD S + L+G  +G    L L+ S  +  LF +  + +P        T  TK   D L          +Q   L +I K++   D L L ++F
Sbjct:   56 FYGIPFAEPPIGDLRFVPSKPAKGWSGVRNARKPGARCVYGRVMPPMAAKP-ASP------DSM----SEDCLFLNVFRPAGTKATKDLPVMVFIHGGGYYRGSGDV--YDGTP-LAAYNDVIVVTMNYRLGLLGFLHVAGTDVTGNYAMYDQILALKWVQQHIGCFGGDPSQVTLFGQSAGGASVLLLTLSPLSKGLFKRAILESPTETYGTYPTNNTKVYIDRLGCHGEKVLACLQSKSLEEILKAQGIADFLLLGIVF 302          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO32226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVM7])

HSP 1 Score: 88.1965 bits (217), Expect = 4.537e-20
Identity = 64/200 (32.00%), Postives = 96/200 (48.00%), Query Frame = 3
Query:  537 EFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQY---EKDSHKII-GSENCLYLNVYVP---SKAIDKKLPVIFIVSGLFFSYGSG-NMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK 1112
            EFLGIPYA       RF + Q+                   A  +  PC Q     K +  +   +ENCL LN++VP    K     L V+  ++GLF+SYG+   M+G  +  +     + I VT N RLG +  +        N+G++D+++AL WI  NI  FGGD  ++ L G  +G+  A  L  S +A+ LF +
Sbjct:    3 EFLGIPYA----KAERFAYPQKY-----------KWEETLEATQFTKPCPQLVIPSKGAKTLYETTENCLNLNIFVPVKEGKTWKDSLAVVVWIAGLFYSYGNAVEMDGRFLASN----EEVIVVTLNNRLGVLGYLKYGDVFRGNYGVADQIMALKWIRANIERFGGDPRHVTLLGQSAGAMSAGLLLTSPQALGLFDR 183          
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Match: EDO46992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV3])

HSP 1 Score: 87.4261 bits (215), Expect = 7.218e-18
Identity = 76/264 (28.79%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  486 IETKCGPIEG---NINDG--ILEFLGIPYAFP-----PIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPV-IFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHV-TSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVT----KTLNDALKVQQSYLGDIKKSEIFQDTLK 1229
            I T+ GP+ G   ++ +G   ++FLGIPYA       P +  ++T   + V+ K C +                        + + +  ENCL LNVY PS   +  LPV +FI  G F  + +   +     P ++   Q I V T NYRLG +  + +    E N GL D++ AL W+  NI  FGGD+S + + G+ +G   A  L  S  A  LF+ ++  +   + T    K +  A +     LG I   +   D L+
Sbjct:   34 ISTEYGPVRGLRHSLKNGNIAVKFLGIPYATASRFERPRNPAKWTQTLDAVNPKVCPQ------------------------TGEQVVDENCLTLNVYKPSATRNSSLPVLVFIHGGAFMRFSAHEDD-----PSLLATEQGIMVVTINYRLGILGFLCSGDIKE-NLGLLDQIYALKWVQNNIERFGGDRSQVTIGGLSAGGESASILMLSPLATGLFTGVFAMSGTPVPTLEGRKDVETAARRVAEVLGCIDVGQRITDCLR 267          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-71n6.4 (para-nitrobenzyl esterase [Source:NCBI gene;Acc:101162337])

HSP 1 Score: 160.999 bits (406), Expect = 1.763e-41
Identity = 130/555 (23.42%), Postives = 235/555 (42.34%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSH--KIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSE-IFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILK--------RLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSI-LTIEEGYTRAVTDIRITCPLNSIL-KKLMALSNWHPIYRYILEDKHKPIDYFN-----MKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGEL-KDFSASRDGYVMMN----LIKNGQVYRECYFKTNECNFWEKELGNIEEFSWI 2057
            ++ T+CG   G   +G   F GIPYA PP+   R+    E   + G  E  R          ++S C Q    S   K+ G E+CL++NV+ P+   D  LPV+  + G +    SG  +G++ T ++   T  ++V+ NYRL     +        +P+    N+G  D++ AL W+ +NI AFGGD + + ++G  SG T    L  S  A  LF      +   +   +L  A      +L     ++      L +  + Q   W    S       + PT  +           L     + DG +L+        R    +++P V+G    E D  P   ++  W    +  F+  K++ FG  +    L+ +  +    +     E  YT  V+DIR+TCP N +  + + ALS+  P+YRY++   + P    N     + + +  A +  D + +F G +  L+     +++ S   +L + +  F   G +  D+S   +   +++    L++N        +    C+ W      + +++W+
Sbjct:   83 QVLTQCGEFRGRHKNGAYSFKGIPYAAPPVGALRWAPPAEPACRSGVAEAGR----------FRSVCPQVMPMSGEGKVTGQEDCLFINVWTPTLRPDALLPVMVWIHGGYLQALSGGEQGYSPTEELAAATGVVYVSFNYRLNAFGFMALELLREGSPRNTSGNYGFLDQIAALKWVQRNIRAFGGDPAKVTIFGQSSGGTSVWTLMMSPLAKGLFRGAVDLSGSYVYNASLEQAEADNLVFLKKTGCADAACLRALSIKQVLQAVPWQEYPSWAAQEATDLPTRGQ-----------LFGPVAVVDGYVLEAPPFELWDRRSGYNDVPFVVGTTEQEADFSPPAENISMWTWGDYRWFVTEKLQSFGPDLPKKALELYPSSAPCPTQDRCPERAYTTMVSDIRVTCPNNDLAWRAVAALSS--PVYRYVV--TYTPSGPMNGSRSLVPFPSRFAFHCLDVVAFFGGLE-DLQGKPLSDRDRSFQDLLRRHLVSFIKTGRMASDWSVYPESTALLSDSLELVQN--------YSQARCDLWRSS--GLFDYAWM 601          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-71n6.4 (para-nitrobenzyl esterase [Source:NCBI gene;Acc:101162337])

HSP 1 Score: 160.999 bits (406), Expect = 2.468e-41
Identity = 130/555 (23.42%), Postives = 235/555 (42.34%), Query Frame = 3
Query:  483 KIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSH--KIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSII-------NPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSE-IFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILK--------RLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSI-LTIEEGYTRAVTDIRITCPLNSIL-KKLMALSNWHPIYRYILEDKHKPIDYFN-----MKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGEL-KDFSASRDGYVMMN----LIKNGQVYRECYFKTNECNFWEKELGNIEEFSWI 2057
            ++ T+CG   G   +G   F GIPYA PP+   R+    E   + G  E  R          ++S C Q    S   K+ G E+CL++NV+ P+   D  LPV+  + G +    SG  +G++ T ++   T  ++V+ NYRL     +        +P+    N+G  D++ AL W+ +NI AFGGD + + ++G  SG T    L  S  A  LF      +   +   +L  A      +L     ++      L +  + Q   W    S       + PT  +           L     + DG +L+        R    +++P V+G    E D  P   ++  W    +  F+  K++ FG  +    L+ +  +    +     E  YT  V+DIR+TCP N +  + + ALS+  P+YRY++   + P    N     + + +  A +  D + +F G +  L+     +++ S   +L + +  F   G +  D+S   +   +++    L++N        +    C+ W      + +++W+
Sbjct:  101 QVLTQCGEFRGRHKNGAYSFKGIPYAAPPVGALRWAPPAEPACRSGVAEAGR----------FRSVCPQVMPMSGEGKVTGQEDCLFINVWTPTLRPDALLPVMVWIHGGYLQALSGGEQGYSPTEELAAATGVVYVSFNYRLNAFGFMALELLREGSPRNTSGNYGFLDQIAALKWVQRNIRAFGGDPAKVTIFGQSSGGTSVWTLMMSPLAKGLFRGAVDLSGSYVYNASLEQAEADNLVFLKKTGCADAACLRALSIKQVLQAVPWQEYPSWAAQEATDLPTRGQ-----------LFGPVAVVDGYVLEAPPFELWDRRSGYNDVPFVVGTTEQEADFSPPAENISMWTWGDYRWFVTEKLQSFGPDLPKKALELYPSSAPCPTQDRCPERAYTTMVSDIRVTCPNNDLAWRAVAALSS--PVYRYVV--TYTPSGPMNGSRSLVPFPSRFAFHCLDVVAFFGGLED-LQGKPLSDRDRSFQDLLRRHLVSFIKTGRMASDWSVYPESTALLSDSLELVQN--------YSQARCDLWRSS--GLFDYAWM 619          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020295.2 (neuroligin-4, X-linked [Source:NCBI gene;Acc:101168332])

HSP 1 Score: 103.219 bits (256), Expect = 2.382e-22
Identity = 72/256 (28.12%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  465 IDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIG--------------------SENCLYLNVYVPSKA----IDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLN 1157
            I  A+ +I     P+  ++   ++++LG+PYA PP   RRF   +  +   G + V +          +   C Q   +   ++                     SE+CLYLN+YVP++        + PV+  V G  ++ G+GNM   +V   +      I +T NYRLG +  +    QT + N+GL D++ AL W+ +NIAAFGGD S + ++G G+G++    L+ S  +  LF +  I +   L +  +N
Sbjct:   41 ISTAQGRIRGILTPLPSDLLGPVIQYLGVPYARPPTGDRRFQPPEPPLPWPGIRNVTQ----------FAPVCPQSLDERSMLVDMMPSWLTANLDIAATYLTHQSEDCLYLNIYVPTEEDIHEEGGQRPVMVYVHGGSYTEGTGNMMDGSV---LASYGNVIVITLNYRLGVLGFLSTGDQTAKGNYGLLDQIQALRWVKENIAAFGGDPSRVTVFGSGAGASCVSLLTLSHYSEDLFHRAIIQSGSALASWAVN 283          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: si:ch73-89b15.3 (cAMP-regulated D2 protein-like [Source:NCBI gene;Acc:101169010])

HSP 1 Score: 98.9821 bits (245), Expect = 3.534e-21
Identity = 74/258 (28.68%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  459 KPIDFAKQK---IETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVP-----SKAIDKKLPVIFIVSGLFFSYGSGN---MEGFTVTPDVVKITQSIHVTSNYRLGPMNSII---NPQTNET-NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGS-TVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSY 1184
            +P+    Q+   + TKCG + G   +    F G+PYA PP+   R+   + +      QEVY      +P  +    C     D    + SE+CL+LN++VP     S+ + + LPV+  + G  F  GS +    +G  ++      T ++ V   YRLG    ++   +P T+ T N+G+ D+ +AL W+ +NIA FGG+ S + + G  +G+ +V+L L            +  S P ++  KT +DALK+ + +
Sbjct:   77 QPVSEGAQEAPVVFTKCGQVRGVTVEKAHIFYGVPYADPPVGAYRWKPPRPL---SSWQEVYEAT---FPRAACMQVCSGPITDECPKMVSEDCLFLNIFVPRSVDFSEPVRRPLPVMVWIHGGDFIAGSASKPIYDGRFIS----NFTNTVVVNLEYRLGAFGFLVSGKDPHTSATGNYGILDQQMALLWVQQNIAMFGGNPSKVTIVGESAGAQSVSLHLMIQSSQPLFTQAVLQSLPFSIPLKTRHDALKLGKHF 324          
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Match: ces3 (carboxylesterase 5A-like [Source:NCBI gene;Acc:101159009])

HSP 1 Score: 91.6633 bits (226), Expect = 5.755e-19
Identity = 109/408 (26.72%), Postives = 176/408 (43.14%), Query Frame = 3
Query:  531 ILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSP-CVQYEKDSHKII-----GSENCLYLNVYVPSKAI-DKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSK-IWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFIND-GNILKRLRVNHNIPIVIGNCANEVD-IFPSPNSVRYWQADYFNDFIKLKMKPFGRVV---NDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRY 1712
            + ++LGIPYA PP+   R    Q     +G     +N  H  PA   + P  V     +  +       SE+CLYLNVY P++A    KLPV+  + G   + G+ +   F  +P +      + V   YRLG +  +    +    N GL D+L AL W+ +NI AFGGD   + + G  +G   A  L+ S  A  LF + I+ S    L T T ND L   +        S+   DT +L    +     + E ++        T  K K    ++    +DNDF++D    L R +    +P+++G   +E   I P   +   W+     + +   +  F   V   ND+  D + K+  T     I + +T  + D+ +T  L++I      +    P+Y Y
Sbjct:   41 VKQYLGIPYARPPVGPLRLAAPQNAEPWEG----EKNCTH-QPAMCIQDPQLVVIVAQAMSVTFTPPEMSEDCLYLNVYTPAEATKGDKLPVMVWIHGGGLTMGAASQ--FDGSP-LAAYENIVVVVIQYRLGILGFLSTGDEHARGNWGLLDQLAALRWVKENIEAFGGDPQAVTIAGESAGGISASILTLSPHADGLFQRAIFQSGVAILGTYTTNDPLSHARVVANITGCSD--SDTAELVRCIKG---KSQEELV-------ATTKKMKIFLGAV----VDNDFLHDTAEALLRRKEVLKVPVMMGITNHEFGWILPQNFAPPGWEKGMSRESVLAVINLFNPGVPSANDLIADEYLKDAKTPE--EIRDAFTEVIGDLLMT--LSTIKVAGYHIDAGVPVYLY 420          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000027379.1 (SMESG000027379.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 589/592 (99.49%), Postives = 591/592 (99.83%), Query Frame = 3
Query:  285 MSQSVLYNKSINSDIPILEIKVFKRKLRIYXXXXXXXXXXXXXXXXXXXXXXXXXXNKKPIDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASRDGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEEFSWII 2060
            MSQSVLYNKSINSDIPILEIKVFKRKLRIYIGVSLLLFFVLIVICIVLILLWLGIINKKPIDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHL+YGAYGEKEISMSKVLNKAMREFAWNGELKDFSAS+DGYVMMNLIKNGQVYRECY KTNECNFWEKELGNIEEFSWII
Sbjct:    1 MSQSVLYNKSINSDIPILEIKVFKRKLRIYIGVSLLLFFVLIVICIVLILLWLGIINKKPIDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSYLGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTNDSIYFLLIDNDFINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYWQADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSILTIEEGYTRAVTDIRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYGWDNILYFHGYKSHLDYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASKDGYVMMNLIKNGQVYRECYLKTNECNFWEKELGNIEEFSWII 592          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000009084.1 (SMESG000009084.1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.654e-20
Identity = 72/252 (28.57%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  468 DFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPI----------------DRRRFTHAQEIVDKKGC------QEVYRNLNHPYPAKSYKSPCVQY--EKDSHKIIG----SENCLYLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEG----FTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWISN 1127
            D    ++ T C    G + D    F GIP++  P+                   R+  + ++   + C      Q ++ N        + +  C+ +  E+ S +I      SE+CLYL++ +P +   K +PV+  V+G+++S    N  G    F  + D V    +I VT NYRLGP  +  N      N  L+D L+ L WI  NI  FGGD++ I L   GSG+T  L LS  ++   LF   W+S+
Sbjct:   62 DVKDFQVTTFCTKYLGQLIDENFVFNGIPFSVSPLLLKLSVKDILGRQLSKSSLRWMESIKLKSIETCFASHSNQCIFNNSVWTCTKNAPRKRCISFTGEQSSEQITNKTSFSEDCLYLSIRIPKRR-PKNIPVVVFVAGVYYSNDISNKMGLNYPFEPSGDFVNEMDAIFVTLNYRLGPFGTFYNHNLTLENFSLTDLLVGLDWIQTNIEKFGGDKNKITLLAHGSGAT--LGLSILLQKSHLFRSAWLSS 310          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000034751.1 (SMESG000034751.1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.652e-19
Identity = 69/213 (32.39%), Postives = 102/213 (47.89%), Query Frame = 3
Query:  492 TKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIG-----SENCLYLNVYVPSKAIDK---KLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQ-TNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSG-STVALALSNSIKAIR 1100
            T   P+EG +   +  FLGIP+A PP+   RF         K     Y +  + + AK+YK  C+Q +    K        SE+CLYLN++ P++  D    K PV+  + G  F  GS ++         +  T  + VT NYRLGP   +      +  N+GL D++L L W+  NI  F GD S I + G  +G ++V L L + I   R
Sbjct:   88 TSWPPLEGRL---VNVFLGIPFAAPPVGDLRF---------KRPIAAYLDSRYLWFAKNYKPACLQKKDFLQKQFSNFNDFSEDCLYLNIFYPNRTWDSQTVKYPVVVHIYGGSFVIGSSHL----YPGHALASTGVVVVTFNYRLGPFGFLATGDFASMGNYGLWDQVLVLEWVRDNIHWFRGDSSKITIMGESAGAASVGLHLVSPISRDR 284          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000067302.1 (SMESG000067302.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.238e-18
Identity = 69/240 (28.75%), Postives = 114/240 (47.50%), Query Frame = 3
Query:  477 KQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPY------------PAKSYKSPCVQYEKDSHKIIGSENCLYLNVYVPSKAIDK-----------KLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSIINPQTNET--NHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGSTVALALSNSIKAIRLFSKIWI 1121
            +  I T C  I  NI   I EF+G+PYA  PI++  F     ++  + C + Y     PY             +  Y S C Q   +  KI G+++CL +N+ +P KA              K PV+ ++SG  +         F V   +++ + SI +T N+RLG +    N QT ++  N G+ D L A+ +++K +  F GD++N++L    SG+T  +      + +  FSKIW+
Sbjct:   13 QASIVTYCATIVLNIRGNIQEFVGLPYASLPIEKFHFNKPGPLLSFQDCYKAYWITMEPYRRQFDNGRLRVLSSSDYVS-CKQITFNKSKIHGTDHCLTVNIKMPRKAEKGIFHFLKNTSVIKFPVVILLSGRTYLEN----RPFQVGDLLIESSNSIFITINFRLGVL-GFSNFQTMKSPKNIGVIDFLKAMEFVYKYLHKFDGDKNNMMLLAENSGATTGIIYMLMNREVSWFSKIWL 246          
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Match: SMESG000010788.1 (SMESG000010788.1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.420e-18
Identity = 63/188 (33.51%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  537 EFLGIPYAFPPIDRRRFTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDS------------HKIIGSENCLYLNVYVPSKAIDKKLPV-IFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIHVTSNYRLGPMNSI-INPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNIILYGVGSGS 1058
             F  IPYA PPI+  RF + QEIV  +  + VY     P       + C Q E                K   SE+CLYL ++ P + +  KLPV ++I  G FFS GS  +E +  +    K  + + V+  YRLGP+  + ++      N GL D+ +AL W+  NI  F GD  +I ++G  +GS
Sbjct:   56 HFARIPYALPPINNLRFKYPQEIVGNQ-WKGVYNATTSP-------NTCWQVEGGEFDKLNPAARLWLSKTPMSEDCLYLTIWSP-RTVKTKLPVMVWIYGGSFFS-GSSTLEVYDGSILAAK-HEVVVVSLQYRLGPLGFLYLDDTLAPGNQGLMDQRMALKWVKDNIYNFNGDSESITIFGESAGS 232          
The following BLAST results are available for this feature:
BLAST of COesterase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NLGN4Y1.005e-1928.40neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4Y1.005e-1928.40neuroligin 4 Y-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X2.888e-1928.98neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X2.888e-1928.98neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
NLGN4X2.888e-1928.98neuroligin 4 X-linked [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K07C11.41.010e-2031.08Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
B0238.72.371e-2031.29Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
ace-24.893e-2033.94Carboxylic ester hydrolase [Source:UniProtKB/TrEM... [more]
glit-16.595e-2030.47GLIoTactin (Drosophila neuroligin-like) homolog [... [more]
ges-18.906e-2029.96Gut esterase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrt2.806e-2625.24gene:FBgn0004108 transcript:FBtr0075322[more]
Nrt2.806e-2625.24gene:FBgn0004108 transcript:FBtr0075323[more]
Nrt2.806e-2625.24gene:FBgn0004108 transcript:FBtr0304018[more]
alpha-Est109.086e-2333.33gene:FBgn0015569 transcript:FBtr0289953[more]
alpha-Est109.343e-2333.33gene:FBgn0015569 transcript:FBtr0305910[more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71n6.46.546e-4724.77si:ch211-71n6.4 [Source:ZFIN;Acc:ZDB-GENE-091204-2... [more]
si:ch73-89b15.35.397e-2029.10si:ch73-89b15.3 [Source:ZFIN;Acc:ZDB-GENE-141212-2... [more]
nlgn4xa2.765e-1930.25neuroligin 4 X-linked a [Source:ZFIN;Acc:ZDB-GENE-... [more]
cel.13.580e-1932.60carboxyl ester lipase, tandem duplicate 1 [Source:... [more]
nlgn2a5.968e-1932.29neuroligin 2a [Source:ZFIN;Acc:ZDB-GENE-090918-2][more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faxdc26.426e-4325.93fatty acid hydroxylase domain containing 2 [Source... [more]
faxdc22.020e-3924.68fatty acid hydroxylase domain containing 2 [Source... [more]
nlgn4x4.539e-1928.57neuroligin 4 X-linked [Source:NCBI gene;Acc:100329... [more]
ACHE2.577e-1823.77acetylcholinesterase (Cartwright blood group) [Sou... [more]
ddx173.512e-1828.51DEAD-box helicase 17 [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nlgn28.279e-2132.08neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835][more]
Ache7.108e-1827.35acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87... [more]
Nlgn29.287e-1830.57neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835][more]
Nlgn29.287e-1830.57neuroligin 2 [Source:MGI Symbol;Acc:MGI:2681835][more]
Ache1.081e-1727.35acetylcholinesterase [Source:MGI Symbol;Acc:MGI:87... [more]
back to top
BLAST of COesterase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23654|NRT_DROME2.812e-2525.24Neurotactin OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|P37967|PNBA_BACSU1.482e-2032.88Para-nitrobenzyl esterase OS=Bacillus subtilis (st... [more]
sp|Q04456|EST1_CAEBR1.669e-2031.72Gut esterase 1 OS=Caenorhabditis briggsae OX=6238 ... [more]
sp|Q01470|PCD_PSEOX1.587e-1929.77Phenmedipham hydrolase OS=Pseudarthrobacter oxydan... [more]
sp|P18142|D2_DICDI2.553e-1931.88cAMP-regulated D2 protein OS=Dictyostelium discoid... [more]
back to top
BLAST of COesterase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AIC96.105e-9433.28COesterase domain-containing protein OS=Echinostom... [more]
A0A2H1CPF21.410e-8832.86Carboxylesterase OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A4S2LNX44.131e-8130.57COesterase domain-containing protein OS=Opisthorch... [more]
A0A075A2P47.859e-8031.03Carboxylesterase OS=Opisthorchis viverrini OX=6198... [more]
A0A3R7GHI98.381e-8030.51Para-nitrobenzyl esterase OS=Clonorchis sinensis O... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71n6.44.036e-3624.47para-nitrobenzyl esterase-like [Source:NCBI gene;A... [more]
si:dkey-30c15.171.277e-2231.60cAMP-regulated D2 protein-like [Source:NCBI gene;A... [more]
ENSAMXT00000006974.25.734e-2032.83cholinesterase [Source:NCBI gene;Acc:103037776][more]
nlgn4xb2.000e-1928.52neuroligin-4, X-linked-like [Source:NCBI gene;Acc:... [more]
nlgn2a2.025e-1931.88neuroligin 2 [Source:NCBI gene;Acc:103033407][more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002735.11.177e-2027.85pep scaffold:Pmarinus_7.0:GL485913:3796:8263:-1 ge... [more]
ENSPMAT00000007813.15.719e-1631.12pep scaffold:Pmarinus_7.0:GL477731:150595:158527:1... [more]
tg2.216e-1231.58thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388871.706e-2736.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353905.838e-2132.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353723.674e-2031.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322264.537e-2032.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469927.218e-1828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of COesterase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71n6.41.763e-4123.42para-nitrobenzyl esterase [Source:NCBI gene;Acc:10... [more]
si:ch211-71n6.42.468e-4123.42para-nitrobenzyl esterase [Source:NCBI gene;Acc:10... [more]
ENSORLT00000020295.22.382e-2228.13neuroligin-4, X-linked [Source:NCBI gene;Acc:10116... [more]
si:ch73-89b15.33.534e-2128.68cAMP-regulated D2 protein-like [Source:NCBI gene;A... [more]
ces35.755e-1926.72carboxylesterase 5A-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of COesterase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027379.10.000e+099.49SMESG000027379.1[more]
SMESG000009084.13.654e-2028.57SMESG000009084.1[more]
SMESG000034751.18.652e-1932.39SMESG000034751.1[more]
SMESG000067302.13.238e-1828.75SMESG000067302.1[more]
SMESG000010788.16.420e-1833.51SMESG000010788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021718 ID=SMED30021718|Name=COesterase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2193bp
CTACGAGAATTTGGTTTGATATTTTATACAATGTTTTAATGTACTTATAG
AAAATTGTCTTTTTCTGCGTGTTTAAGGCGAAGTTGTGTTTTAAAAAATA
AAATCGGAATAGAAAATTTCCATTGATTTCAATCCTCAGAGTCAGGGCTT
GCCTCGATTCTGATTGGTCTATTTCTAGTTCAATAGCAATCACTCTGTGA
GTCAGTTTTGTTATGTATTTTTAAAACGCCTTGTTGAGTTAGTTAGCAGA
ATTGATAAAAAGTCGAATAAAAAAGTAATTATAAATGTCCCAATCTGTTC
TCTATAATAAATCTATTAATTCTGACATTCCGATTTTAGAAATCAAGGTC
TTCAAACGAAAACTCAGGATTTATATTGGAGTATCTTTGTTATTGTTTTT
TGTGTTGATTGTAATTTGTATTGTTCTTATTTTGCTTTGGCTTGGAATCA
TTAATAAGAAACCAATTGATTTTGCCAAACAAAAAATTGAAACCAAATGT
GGTCCAATTGAAGGAAACATAAATGATGGTATATTGGAATTTCTTGGAAT
ACCTTATGCATTTCCTCCAATCGATCGTCGGAGATTTACACATGCTCAAG
AAATCGTTGACAAAAAAGGCTGTCAAGAAGTTTACAGAAATTTAAACCAT
CCGTATCCGGCCAAGTCATACAAGTCTCCATGTGTTCAGTACGAAAAGGA
TAGCCACAAAATAATCGGAAGTGAAAATTGCCTTTATTTAAATGTATATG
TGCCATCAAAAGCGATTGATAAAAAGCTACCTGTAATTTTTATAGTTAGT
GGACTTTTCTTTTCTTATGGCAGTGGAAATATGGAAGGATTCACCGTTAC
CCCAGACGTTGTTAAAATTACCCAATCTATACATGTAACTTCAAATTACC
GATTAGGGCCCATGAATTCTATTATTAATCCGCAAACTAATGAAACCAAT
CACGGTCTTTCTGATGAGCTGTTGGCGTTGACTTGGATTCATAAGAATAT
TGCAGCTTTCGGTGGAGATCAGTCAAATATAATTTTATATGGGGTTGGAT
CCGGTTCAACTGTAGCTTTAGCCCTGTCTAATTCCATTAAGGCAATCCGT
TTGTTTTCGAAAATTTGGATATCCAATCCCATGACATTGGTCACAAAGAC
TTTGAATGATGCTTTGAAAGTCCAACAATCATATCTTGGTGACATCAAAA
AATCGGAAATATTTCAAGACACATTGAAGTTAGACATGATTTTCCAGCCG
TGGAATTGGACGAATATTGAATCGATAATTGACAACCGGTATTTCAATTT
TCCAACTCCAAACAAAGCAAAATACACAAACGATTCGATTTATTTCTTAT
TGATTGACAATGATTTCATCAATGACGGCAACATTTTGAAACGGCTACGA
GTGAACCACAACATTCCCATAGTGATTGGGAATTGTGCAAATGAGGTCGA
CATTTTCCCATCGCCAAACAGTGTCCGATATTGGCAAGCTGACTATTTCA
ATGACTTTATCAAACTGAAAATGAAACCGTTTGGAAGAGTCGTCAATGAT
GTGTTTCTTGATACATTTCGAAAGAATTATGTGACAGATTCGATTCTAAC
AATTGAAGAAGGCTACACAAGAGCGGTGACAGATATTAGGATCACTTGTC
CATTGAATTCTATCCTGAAAAAGTTGATGGCCCTATCGAACTGGCACCCG
ATTTATCGGTATATTCTGGAAGACAAACACAAACCGATCGATTATTTCAA
CATGAAATATTCCAATGAATTGGCAGCATATGGATGGGATAATATCCTCT
ATTTTCACGGCTATAAAAGCCATCTGGAGTACGGGGCTTACGGGGAGAAA
GAAATCAGTATGAGTAAGGTTTTGAATAAAGCCATGCGCGAGTTTGCATG
GAACGGTGAGCTGAAGGATTTCTCAGCGAGCAGAGACGGCTACGTAATGA
TGAATCTTATTAAAAACGGACAAGTTTATCGAGAATGTTATTTTAAAACG
AACGAATGCAATTTCTGGGAAAAAGAATTGGGAAATATTGAAGAGTTTTC
ATGGATAATTTAACTAAATTCTGAAAAGATTCTATTTATAGTTTCTTGAA
GTTAACTGTACTAAGATTTATGTAGCTAACAATTTTTATTCTTTATTTAC
ATATATTTTGTTTTATTACTTTGAGCATTTGAATTGTTGTTAT
back to top

protein sequence of SMED30021718-orf-1

>SMED30021718-orf-1 ID=SMED30021718-orf-1|Name=SMED30021718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MSQSVLYNKSINSDIPILEIKVFKRKLRIYIGVSLLLFFVLIVICIVLIL
LWLGIINKKPIDFAKQKIETKCGPIEGNINDGILEFLGIPYAFPPIDRRR
FTHAQEIVDKKGCQEVYRNLNHPYPAKSYKSPCVQYEKDSHKIIGSENCL
YLNVYVPSKAIDKKLPVIFIVSGLFFSYGSGNMEGFTVTPDVVKITQSIH
VTSNYRLGPMNSIINPQTNETNHGLSDELLALTWIHKNIAAFGGDQSNII
LYGVGSGSTVALALSNSIKAIRLFSKIWISNPMTLVTKTLNDALKVQQSY
LGDIKKSEIFQDTLKLDMIFQPWNWTNIESIIDNRYFNFPTPNKAKYTND
SIYFLLIDNDFINDGNILKRLRVNHNIPIVIGNCANEVDIFPSPNSVRYW
QADYFNDFIKLKMKPFGRVVNDVFLDTFRKNYVTDSILTIEEGYTRAVTD
IRITCPLNSILKKLMALSNWHPIYRYILEDKHKPIDYFNMKYSNELAAYG
WDNILYFHGYKSHLEYGAYGEKEISMSKVLNKAMREFAWNGELKDFSASR
DGYVMMNLIKNGQVYRECYFKTNECNFWEKELGNIEEFSWII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR002018CarbesteraseB
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 46..587
e-value: 2.7E-70
score: 239.7
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 68..543
IPR002018Carboxylesterase, type BPFAMPF00135COesterasecoord: 66..545
e-value: 1.5E-52
score: 179.2
NoneNo IPR availablePANTHERPTHR11559CARBOXYLESTERASEcoord: 32..583
NoneNo IPR availablePANTHERPTHR11559:SF391CARBOXYLIC ESTER HYDROLASEcoord: 32..583
NoneNo IPR availableTMHMMTMhelixcoord: 31..53