Voltage gated potassium channel

Overview
NameVoltage gated potassium channel
Smed IDSMED30021717
Length (bp)1043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage gated potassium channel (SMED30021717) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage gated potassium channel (SMED30021717) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021717

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021717SMESG000028623.1 SmedASXL_012402SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021717SMESG000028623.1 dd_Smed_v4_17998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021717SMESG000028623.1 dd_Smed_v6_17998_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 120.939 bits (302), Expect = 8.762e-30
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 121.324 bits (303), Expect = 1.057e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 121.324 bits (303), Expect = 1.071e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 121.324 bits (303), Expect = 1.071e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 120.939 bits (302), Expect = 1.323e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-36 (Potassium voltage-gated channel protein egl-36 [Source:UniProtKB/Swiss-Prot;Acc:G5EFC3])

HSP 1 Score: 152.525 bits (384), Expect = 1.926e-41
Identity = 69/97 (71.13%), Postives = 79/97 (81.44%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAK 339
            E+   NP N F SIP GLWWA+ TMTTVGYGDM P T  G LVG+LCA+ GVLTI+LPVPVIVSNF+MFYSH QAR KLPK+RRRVLPVE +R +A+
Sbjct:  380 EKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIRLQAR 476          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 148.673 bits (374), Expect = 1.989e-40
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGI 345
            ER   N  N F SIP GLWW+LVT++TVG+GDMVPKTY GMLVG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P   G+
Sbjct:  353 ERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGV 451          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 148.673 bits (374), Expect = 1.989e-40
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGI 345
            ER   N  N F SIP GLWW+LVT++TVG+GDMVPKTY GMLVG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P   G+
Sbjct:  353 ERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGV 451          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 149.058 bits (375), Expect = 2.147e-40
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGI 345
            ER   N  N F SIP GLWW+LVT++TVG+GDMVPKTY GMLVG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P   G+
Sbjct:  373 ERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGV 471          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 149.058 bits (375), Expect = 2.396e-40
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGI 345
            ER   N  N F SIP GLWW+LVT++TVG+GDMVPKTY GMLVG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P   G+
Sbjct:  403 ERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGV 501          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 164.081 bits (414), Expect = 5.977e-46
Identity = 78/99 (78.79%), Postives = 84/99 (84.85%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVR-PKAKG 342
            ER   NP NDF SIP GLWWALVTMTTVGYGDM PKTY GM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R P+  G
Sbjct:  351 ERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPG 449          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 163.696 bits (413), Expect = 7.743e-46
Identity = 78/99 (78.79%), Postives = 84/99 (84.85%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVR-PKAKG 342
            ER   NP NDF SIP GLWWALVTMTTVGYGDM PKTY GM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R P+  G
Sbjct:  351 ERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPG 449          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shawl (gene:FBgn0085395 transcript:FBtr0332598)

HSP 1 Score: 166.777 bits (421), Expect = 1.339e-45
Identity = 77/95 (81.05%), Postives = 82/95 (86.32%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 333
            E+   NP N F SIP GLWWA+VTMTTVGYGD+ PKTYPGM VGALCA+ GVLTI+LPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE  R K
Sbjct:  433 EKLQDNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEQPRRK 527          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shawl (gene:FBgn0085395 transcript:FBtr0308029)

HSP 1 Score: 166.777 bits (421), Expect = 2.040e-45
Identity = 77/95 (81.05%), Postives = 82/95 (86.32%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 333
            E+   NP N F SIP GLWWA+VTMTTVGYGD+ PKTYPGM VGALCA+ GVLTI+LPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVE  R K
Sbjct:  433 EKLQDNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEQPRRK 527          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 164.081 bits (414), Expect = 2.107e-45
Identity = 78/99 (78.79%), Postives = 84/99 (84.85%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVR-PKAKG 342
            ER   NP NDF SIP GLWWALVTMTTVGYGDM PKTY GM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R P+  G
Sbjct:  351 ERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPG 449          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 109.383 bits (272), Expect = 6.909e-26
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER + +P +        F +IP G WWA+VTMTT+GYGDMVPKT+ GM+VGALCAI GVLTI++PVPVIV+NF M+YS   A
Sbjct:  381 ERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 109.383 bits (272), Expect = 6.909e-26
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER + +P +        F +IP G WWA+VTMTT+GYGDMVPKT+ GM+VGALCAI GVLTI++PVPVIV+NF M+YS   A
Sbjct:  381 ERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 109.383 bits (272), Expect = 7.131e-26
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER + +P +        F +IP G WWA+VTMTT+GYGDMVPKT+ GM+VGALCAI GVLTI++PVPVIV+NF M+YS   A
Sbjct:  381 ERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 106.686 bits (265), Expect = 3.638e-25
Identity = 45/65 (69.23%), Postives = 54/65 (83.08%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFY 258
             P + F+SIP+  WWA+V+MTTVGYGDMVP T  G +VG+LCAI GVLTI+LPVPVIVSNF+ FY
Sbjct:  349 EPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 413          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 106.686 bits (265), Expect = 5.068e-25
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER   NP +        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  365 ERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 121.709 bits (304), Expect = 3.222e-32
Identity = 54/95 (56.84%), Postives = 72/95 (75.79%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER   +P++        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    6 ERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 100          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 122.094 bits (305), Expect = 3.983e-30
Identity = 54/95 (56.84%), Postives = 72/95 (75.79%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER   +P++        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  367 ERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 121.709 bits (304), Expect = 5.584e-30
Identity = 54/95 (56.84%), Postives = 72/95 (75.79%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER   +P++        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  367 ERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: cldn12 (claudin 12 [Source:Xenbase;Acc:XB-GENE-974236])

HSP 1 Score: 110.153 bits (274), Expect = 4.115e-26
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 1
Query:   67 PTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEA 321
            P + F+SIP+G WWA+VTMTTVGYGDM P T  G +VG LCAI GVLTI+LPVPVIVSNF+ FY H +  +    + R  LPVE 
Sbjct:  388 PQSQFLSIPDGFWWAVVTMTTVGYGDMCPITLSGKVVGTLCAIAGVLTIALPVPVIVSNFNYFY-HRETEN----EERHSLPVEV 467          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4 [Source:NCBI gene;Acc:100492941])

HSP 1 Score: 109.768 bits (273), Expect = 7.963e-26
Identity = 50/82 (60.98%), Postives = 61/82 (74.39%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER   NPT+        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  381 ERIGANPTDPSGSNHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 120.553 bits (301), Expect = 7.622e-32
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:   23 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 100          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 120.939 bits (302), Expect = 9.111e-30
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  425 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 502          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 120.939 bits (302), Expect = 1.051e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  425 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 502          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 110.538 bits (275), Expect = 2.931e-26
Identity = 48/70 (68.57%), Postives = 57/70 (81.43%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            N   DF +IP G WWA+VTMTT+GYGDM PKT+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  419 NDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 110.153 bits (274), Expect = 4.322e-26
Identity = 48/70 (68.57%), Postives = 57/70 (81.43%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            N   DF +IP G WWA+VTMTT+GYGDM PKT+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  419 NDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.992e-45
Identity = 78/99 (78.79%), Postives = 84/99 (84.85%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVR-PKAKG 342
            ER   NP NDF SIP GLWWALVTMTTVGYGDM PKTY GM VGALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRRVLPVE  R P+  G
Sbjct:  351 ERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPG 449          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.450e-40
Identity = 69/97 (71.13%), Postives = 79/97 (81.44%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAK 339
            E+   NP N F SIP GLWWA+ TMTTVGYGDM P T  G LVG+LCA+ GVLTI+LPVPVIVSNF+MFYSH QAR KLPK+RRRVLPVE +R +A+
Sbjct:  380 EKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIRLQAR 476          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P22462|KCNC2_RAT (Potassium voltage-gated channel subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Kcnc2 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.333e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q14B80|KCNC2_MOUSE (Potassium voltage-gated channel subfamily C member 2 OS=Mus musculus OX=10090 GN=Kcnc2 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.351e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  425 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 502          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q96PR1|KCNC2_HUMAN (Potassium voltage-gated channel subfamily C member 2 OS=Homo sapiens OX=9606 GN=KCNC2 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.619e-29
Identity = 51/78 (65.38%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  421 FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A158QC21 (Ion_trans domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS844 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.751e-51
Identity = 86/96 (89.58%), Postives = 89/96 (92.71%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKA 336
            ERF  NP NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGA+CAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 
Sbjct:  295 ERFQHNPHNDFNSIPVGLWWAIVTMTTVGYGDMVPKTYLGMIVGAMCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKC 390          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A0R3TAZ6 (Ion_trans domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4233 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 7.705e-51
Identity = 86/96 (89.58%), Postives = 89/96 (92.71%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKA 336
            ERF  NP NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGA+CAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK 
Sbjct:  236 ERFQHNPHNDFNSIPVGLWWAIVTMTTVGYGDMVPKTYLGMIVGAMCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKC 331          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A158QVV4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8609 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.869e-50
Identity = 87/99 (87.88%), Postives = 91/99 (91.92%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGI 345
            ERF  NP NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGA+CAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK  G+
Sbjct:  411 ERFQHNPHNDFNSIPVGLWWAIVTMTTVGYGDMVPKTYLGMVVGAMCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKNGGV 509          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A183SG08 (BTB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3156 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 4.802e-50
Identity = 86/98 (87.76%), Postives = 90/98 (91.84%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKG 342
            ERF  NP NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGA+CA+TGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK  G
Sbjct:  412 ERFQNNPRNDFNSIPVGLWWAIVTMTTVGYGDMVPKTYLGMIVGAMCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKTPG 509          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A183AF82 (Ion_trans domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5617 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.175e-50
Identity = 81/96 (84.38%), Postives = 88/96 (91.67%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKA 336
            ERF  NP NDF SIP GLWWA+VTMTTVGYGD VPKTY GM+VGA+CAITGV+TISLPVPVIVSNFS FY+HTQA+SKLPKKRRRVLPVEAVRPK+
Sbjct:   49 ERFQFNPRNDFASIPVGLWWAIVTMTTVGYGDQVPKTYLGMIVGAMCAITGVMTISLPVPVIVSNFSRFYTHTQAQSKLPKKRRRVLPVEAVRPKS 144          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: KCNA10 (potassium voltage-gated channel subfamily A member 10-like [Source:NCBI gene;Acc:103039988])

HSP 1 Score: 107.842 bits (268), Expect = 1.852e-25
Identity = 49/75 (65.33%), Postives = 56/75 (74.67%), Query Frame = 1
Query:   67 PTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYS-HTQARSKLP 288
            P   F+SIP+G WWA+VTMTTVGYGDM P T  G +VG LCAI GVLTI+LPVPVIVSNF+ FY   T+   K P
Sbjct:  462 PNTQFVSIPDGFWWAVVTMTTVGYGDMCPITLGGKMVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEKQP 536          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000049045.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 107.457 bits (267), Expect = 3.506e-25
Identity = 49/82 (59.76%), Postives = 61/82 (74.39%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER   NP +       +F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  385 ERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 107.071 bits (266), Expect = 3.977e-25
Identity = 49/82 (59.76%), Postives = 61/82 (74.39%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ER   NP +       +F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:  385 ERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000051756.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001855.1:1147:4292:-1 gene:ENSAMXG00000030637.1 transcript:ENSAMXT00000051756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 4.093e-25
Identity = 46/75 (61.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query:   58 TKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSK 282
               P   F+SIP G WWA+VTMTTVGYGDM P T  G +VG LCAI GVLTI+LPVPVIVSNF+ FY     +++
Sbjct:  363 VDEPETQFVSIPEGFWWAVVTMTTVGYGDMCPVTLGGKMVGILCAIAGVLTIALPVPVIVSNFNYFYHRETEQAE 437          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: KCNA10 (potassium voltage-gated channel subfamily A member 10 [Source:HGNC Symbol;Acc:HGNC:6219])

HSP 1 Score: 106.686 bits (265), Expect = 4.193e-25
Identity = 46/75 (61.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query:   58 TKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSK 282
               P   F+SIP G WWA+VTMTTVGYGDM P T  G +VG LCAI GVLTI+LPVPVIVSNF+ FY     +++
Sbjct:  396 VDEPETQFVSIPEGFWWAVVTMTTVGYGDMCPVTLGGKMVGILCAIAGVLTIALPVPVIVSNFNYFYHRETEQAE 470          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007589.1 (pep scaffold:Pmarinus_7.0:GL482983:7539:12291:-1 gene:ENSPMAG00000006849.1 transcript:ENSPMAT00000007589.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 2.828e-33
Identity = 57/93 (61.29%), Postives = 69/93 (74.19%), Query Frame = 1
Query:   49 ERFTKNPTND-----FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER    P  D     F SIP G WWA+VTMTT+GYGDM PKT+ GMLVGALCA++GVLTI++PVPVIV+NF M+YS   A+ KLPKK+   +P
Sbjct:  178 ERLGAKPGIDEDKTHFTSIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALSGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNSYMP 270          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 110.538 bits (275), Expect = 6.075e-27
Identity = 51/82 (62.20%), Postives = 62/82 (75.61%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 273
            ERF  NP +        F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NFSM+YS   A
Sbjct:  384 ERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 104.76 bits (260), Expect = 9.914e-26
Identity = 47/65 (72.31%), Postives = 51/65 (78.46%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFY 258
            +P   F SIP+  WWA+VTMT VGYGDM P T  G +VGALCAITGVLTISLPVPVIVSNF  FY
Sbjct:  309 DPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFY 373          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 104.76 bits (260), Expect = 1.022e-25
Identity = 47/65 (72.31%), Postives = 51/65 (78.46%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFY 258
            +P   F SIP+  WWA+VTMT VGYGDM P T  G +VGALCAITGVLTISLPVPVIVSNF  FY
Sbjct:  312 DPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFY 376          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 105.145 bits (261), Expect = 1.027e-25
Identity = 47/65 (72.31%), Postives = 51/65 (78.46%), Query Frame = 1
Query:   64 NPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFY 258
            +P   F SIP+  WWA+VTMT VGYGDM P T  G +VGALCAITGVLTISLPVPVIVSNF  FY
Sbjct:  308 DPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFY 372          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 125.561 bits (314), Expect = 8.610e-33
Identity = 54/81 (66.67%), Postives = 66/81 (81.48%), Query Frame = 1
Query:   61 KNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 303
            K P   F+ IP+  WWA+VTMTTVGYGDM P++  G  +G+LCA+ GVLTI+LPVPVIV+NFS++YSH QAR KLPKKRRR
Sbjct:  323 KIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 118.627 bits (296), Expect = 3.257e-30
Identity = 49/74 (66.22%), Postives = 64/74 (86.49%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRR 300
            F +IP+  WWA+VTMTT+GYGDMVP T+ G +VG+LCA+ GVL I+LPVPVIVSNFS++YSH +AR KLP+++R
Sbjct:  345 FTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRKR 418          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO48063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ2])

HSP 1 Score: 112.849 bits (281), Expect = 8.477e-30
Identity = 50/87 (57.47%), Postives = 64/87 (73.56%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVL 309
            E+  K  + +F SIP   WWA++TMTTVGYGDM PKT  G ++G+LCAI GVL I LPV VI +NFS +Y H QAR  LP+K+RR++
Sbjct:  127 EKDVKGNSVNFTSIPQSFWWAIITMTTVGYGDMSPKTLSGQIIGSLCAICGVLIIGLPVSVIGNNFSTYYEHAQARLNLPRKKRRLI 213          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 112.849 bits (281), Expect = 4.394e-28
Identity = 45/75 (60.00%), Postives = 59/75 (78.67%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 303
            F S+P   WW L+TMTTVGYGDM P+T+PG ++G  CAI GVL ++LP+ VI SNF+++Y+H QAR KLP K+RR
Sbjct:  335 FTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLKLPVKQRR 409          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO45172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ3])

HSP 1 Score: 112.079 bits (279), Expect = 9.325e-28
Identity = 46/79 (58.23%), Postives = 61/79 (77.22%), Query Frame = 1
Query:   70 TNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRV 306
            T  F SIP   WW+L+TMTTVGYGDM P+T+ G ++G  CAI GVL ++LP+ VI SNFS++Y+H QAR KLPKK+ ++
Sbjct:  337 TTKFRSIPESFWWSLITMTTVGYGDMTPRTWEGKIIGGACAIFGVLMVALPISVIGSNFSLYYAHAQARLKLPKKKTKI 415          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 120.939 bits (302), Expect = 7.451e-30
Identity = 52/78 (66.67%), Postives = 65/78 (83.33%), Query Frame = 1
Query:   79 FISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            F +IP G WWA+VTMTT+GYGDM P+T+ GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKKR + +P
Sbjct:  375 FKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRNKHIP 452          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 120.168 bits (300), Expect = 1.088e-29
Identity = 57/95 (60.00%), Postives = 69/95 (72.63%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER   NP +        F +IP G WWA+VTMTT+GYGDM PKT  GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P
Sbjct:  365 ERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 120.168 bits (300), Expect = 1.277e-29
Identity = 57/95 (60.00%), Postives = 69/95 (72.63%), Query Frame = 1
Query:   49 ERFTKNPTN-------DFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLP 312
            ER   NP +        F +IP G WWA+VTMTT+GYGDM PKT  GMLVGALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P
Sbjct:  365 ERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: KCNA10 (potassium voltage-gated channel subfamily A member 10 [Source:HGNC Symbol;Acc:HGNC:6219])

HSP 1 Score: 115.546 bits (288), Expect = 2.738e-28
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 1
Query:   58 TKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYS-HTQARSKLP--KKRRRVLPVEAVRPKA 336
               P+  F+SIP+G WWA+VTMTTVGYGDM P T  G +VG LCAI GVLTI+LPVPVIVSNF+ FY   T+A  KLP  +   + +  EA+  +A
Sbjct:  395 VDEPSTQFVSIPDGFWWAVVTMTTVGYGDMCPITVAGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETEAEDKLPMAEALEQAMKAEAISKQA 490          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000043885.1 (potassium voltage-gated channel subfamily A member 1 [Source:NCBI gene;Acc:101160112])

HSP 1 Score: 111.309 bits (277), Expect = 9.610e-27
Identity = 48/63 (76.19%), Postives = 54/63 (85.71%), Query Frame = 1
Query:   70 TNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFY 258
            T DF+SIP+G WWA+VTMTTVGYGDM P T  G +VG++CAI GVLTISLPVPVIVSNFS FY
Sbjct:  382 TTDFVSIPHGFWWAVVTMTTVGYGDMYPATVWGKMVGSMCAIAGVLTISLPVPVIVSNFSYFY 444          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000028623.1 (SMESG000028623.1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.597e-169
Identity = 275/279 (98.57%), Postives = 278/279 (99.64%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGIXXXXXXXXXXXXXGHNRLPSSNRIIYNYNFSANPEEPEANKSFPAGVQFAKRGSSKEDRQNSVTNLDNESQSKRNPLTRQKKCSYGRRTAVXXXXXXXXXXXXXXXXXNSGNSSSEDVILLKAINLNSENETNVNEKQINNRLFERRRNFAYGSSSVYSNKMATNSNKLNRPFSFM*KIL 885
            ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGINPSLLSNNTLTLPGHNRLPSSNRIIYNYNFSANPEEPEANKSFPAGVQFAKRGSSKEDRQNSVTNLDNESQSKRNPLTRQKKCSYGRRTAVIDISSIKSSDDEDEKSINSGNSSSEDVILLKAINLNSENETNVNEKQINNRLFERRRNFAYGSSSVYSNKMATNSNKLNRPFSF+ ++L
Sbjct:  356 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKGINPSLLSNNTLTLPGHNRLPSSNRIIYNYNFSANPEEPEANKSFPAGVQFAKRGSSKEDRQNSVTNLDNESQSKRNPLTRQKKCSYGRRTAVIDISSIKSSDDEDEKSINSGNSSSEDVILLKAINLNSENETNVNEKQINNRLFERRRNFAYGSSSVYSNKMATNSNKLNRPFSFIQRVL 634          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 197.208 bits (500), Expect = 6.969e-58
Identity = 90/98 (91.84%), Postives = 93/98 (94.90%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKG 342
            E+FTKN  NDF SIPNGLWWA+ TMTTVGYGDMVPKTYPGMLVGALCA+TGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK KG
Sbjct:  348 EKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFKG 445          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 197.208 bits (500), Expect = 7.416e-58
Identity = 90/98 (91.84%), Postives = 93/98 (94.90%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAKG 342
            E+FTKN  NDF SIPNGLWWA+ TMTTVGYGDMVPKTYPGMLVGALCA+TGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK KG
Sbjct:  348 EKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFKG 445          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 185.652 bits (470), Expect = 1.019e-53
Identity = 86/97 (88.66%), Postives = 89/97 (91.75%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAK 339
            ERF  N  NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK +
Sbjct:  355 ERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKIQ 451          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 185.267 bits (469), Expect = 1.782e-53
Identity = 86/97 (88.66%), Postives = 89/97 (91.75%), Query Frame = 1
Query:   49 ERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAK 339
            ERF  N  NDF SIP GLWWA+VTMTTVGYGDMVPKTY GM+VGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPK +
Sbjct:  380 ERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKIQ 476          
The following BLAST results are available for this feature:
BLAST of Voltage gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC28.762e-3065.38potassium voltage-gated channel subfamily C member... [more]
KCNC21.057e-2965.38potassium voltage-gated channel subfamily C member... [more]
KCNC21.071e-2965.38potassium voltage-gated channel subfamily C member... [more]
KCNC21.071e-2965.38potassium voltage-gated channel subfamily C member... [more]
KCNC21.323e-2965.38potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-361.926e-4171.13Potassium voltage-gated channel protein egl-36 [S... [more]
shw-11.989e-4069.70SHaW family of potassium channels [Source:UniProt... [more]
shw-11.989e-4069.70SHaW family of potassium channels [Source:UniProt... [more]
shw-12.147e-4069.70SHaW family of potassium channels [Source:UniProt... [more]
shw-12.396e-4069.70SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw5.977e-4678.79gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw7.743e-4678.79gene:FBgn0003386 transcript:FBtr0332184[more]
Shawl1.339e-4581.05gene:FBgn0085395 transcript:FBtr0332598[more]
Shawl2.040e-4581.05gene:FBgn0085395 transcript:FBtr0308029[more]
Shaw2.107e-4578.79gene:FBgn0003386 transcript:FBtr0089275[more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc46.909e-2660.98potassium voltage-gated channel, Shaw-related subf... [more]
kcnc46.909e-2660.98potassium voltage-gated channel, Shaw-related subf... [more]
kcnc47.131e-2660.98potassium voltage-gated channel, Shaw-related subf... [more]
kcna2b3.638e-2569.23potassium voltage-gated channel, shaker-related su... [more]
kcnc1a5.068e-2559.76potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC23.222e-3256.84potassium channel, voltage gated Shaw related subf... [more]
KCNC23.983e-3056.84potassium channel, voltage gated Shaw related subf... [more]
KCNC25.584e-3056.84potassium channel, voltage gated Shaw related subf... [more]
cldn124.115e-2661.18claudin 12 [Source:Xenbase;Acc:XB-GENE-974236][more]
KCNC47.963e-2660.98potassium channel, voltage gated Shaw related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc27.622e-3265.38potassium voltage gated channel, Shaw-related subf... [more]
Kcnc29.111e-3065.38potassium voltage gated channel, Shaw-related subf... [more]
Kcnc21.051e-2965.38potassium voltage gated channel, Shaw-related subf... [more]
Kcnc42.931e-2668.57potassium voltage gated channel, Shaw-related subf... [more]
Kcnc44.322e-2668.57potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME5.992e-4578.79Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL2.450e-4071.13Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P22462|KCNC2_RAT7.333e-2965.38Potassium voltage-gated channel subfamily C member... [more]
sp|Q14B80|KCNC2_MOUSE7.351e-2965.38Potassium voltage-gated channel subfamily C member... [more]
sp|Q96PR1|KCNC2_HUMAN7.619e-2965.38Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QC211.751e-5189.58Ion_trans domain-containing protein OS=Hymenolepis... [more]
A0A0R3TAZ67.705e-5189.58Ion_trans domain-containing protein OS=Rodentolepi... [more]
A0A158QVV41.869e-5087.88Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183SG084.802e-5087.76BTB domain-containing protein OS=Schistocephalus s... [more]
A0A183AF827.175e-5084.38Ion_trans domain-containing protein OS=Echinostoma... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA101.852e-2565.33potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000049045.13.506e-2559.76potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000048024.13.977e-2559.76potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000051756.14.093e-2561.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
KCNA104.193e-2561.33potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007589.12.828e-3361.29pep scaffold:Pmarinus_7.0:GL482983:7539:12291:-1 g... [more]
kcnc1a6.075e-2762.20potassium voltage-gated channel, Shaw-related subf... [more]
kcna1b9.914e-2672.31potassium voltage-gated channel, shaker-related su... [more]
kcna1b1.022e-2572.31potassium voltage-gated channel, shaker-related su... [more]
kcna1b1.027e-2572.31potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427248.610e-3366.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398043.257e-3066.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480638.477e-3057.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382374.394e-2860.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451729.325e-2858.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045623.17.451e-3066.67potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.088e-2960.00potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.277e-2960.00potassium voltage-gated channel subfamily C member... [more]
KCNA102.738e-2856.25potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000043885.19.610e-2776.19potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028623.11.597e-16998.57SMESG000028623.1[more]
SMESG000054802.16.969e-5891.84SMESG000054802.1[more]
SMESG000054802.17.416e-5891.84SMESG000054802.1[more]
SMESG000058857.11.019e-5388.66SMESG000058857.1[more]
SMESG000058857.11.782e-5388.66SMESG000058857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021717 ID=SMED30021717|Name=Voltage gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1043bp
TTCCTTGTGGTCTTCATTGTTGTGTTTGCTGCATGAATTTATTATGCTGA
AAGATTCACTAAAAATCCAACAAATGATTTCATTTCTATTCCAAATGGGC
TTTGGTGGGCTCTTGTTACGATGACAACAGTTGGGTATGGAGACATGGTT
CCAAAAACGTACCCTGGAATGCTTGTTGGAGCATTATGTGCAATAACTGG
AGTATTAACTATCTCACTTCCGGTTCCAGTTATTGTTAGTAATTTTTCAA
TGTTTTATTCTCACACCCAAGCTAGATCAAAATTGCCAAAGAAAAGGAGA
CGTGTTTTACCAGTAGAAGCTGTTCGACCAAAAGCAAAAGGAATTAACCC
ATCATTATTAAGCAATAACACGTTAACGCTCCCCGGACATAACCGTCTTC
CAAGTTCAAATAGAATTATTTACAATTATAATTTCTCTGCAAATCCTGAA
GAACCTGAAGCAAACAAAAGTTTTCCAGCGGGAGTTCAGTTTGCTAAACG
AGGAAGCAGTAAGGAAGACCGCCAGAATTCCGTAACCAATCTTGATAATG
AATCTCAATCTAAAAGAAATCCACTCACTCGTCAGAAAAAATGCAGCTAT
GGCCGGCGAACGGCTGTGATAGATATATCCAGCATCAAATCATCTGATGA
TGAAGATGAAAAATCTATCAATTCCGGAAACTCTTCCAGTGAGGATGTGA
TATTACTGAAAGCGATAAATCTCAATTCTGAAAACGAGACCAATGTAAAT
GAAAAACAAATAAACAATAGATTGTTTGAAAGACGTAGAAACTTTGCTTA
CGGTTCCTCTTCAGTTTACTCAAATAAAATGGCGACAAATTCAAATAAAT
TAAACAGGCCATTTAGTTTTATGTAAAAAATTTTAAAAAGTAACATAGAC
ACAGTAATAATGAAACAAAAGAAAATTTTTTTTCAATTATCAATGATATC
TTATGCCCAGAATAGGGGGGCAGAAAGATTATTTTATATGATTTATTATG
ATTCTTTTATTAAAAGTTAAATAAAATTTCGTCAAATTTAAAA
back to top

protein sequence of SMED30021717-orf-1

>SMED30021717-orf-1 ID=SMED30021717-orf-1|Name=SMED30021717-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQ
ARSKLPKKRRRVLPVEAVRPKAKGINPSLLSNNTLTLPGHNRLPSSNRII
YNYNFSANPEEPEANKSFPAGVQFAKRGSSKEDRQNSVTNLDNESQSKRN
PLTRQKKCSYGRRTAVIDISSIKSSDDEDEKSINSGNSSSEDVILLKAIN
LNSENETNVNEKQINNRLFERRRNFAYGSSSVYSNKMATNSNKLNRPFSF
M*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR005821Ion_trans_dom
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0051260protein homooligomerization
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane