DNA-binding protein

Overview
NameDNA-binding protein
Smed IDSMED30021711
Length (bp)1282
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-binding protein (SMED30021711) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-binding protein (SMED30021711) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-binding protein (SMED30021711) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-binding protein (SMED30021711) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021711

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021711SMESG000070983.1 dd_Smed_v4_2102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021711SMESG000070983.1 dd_Smed_v6_2102_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-binding protein vs. Ensembl Human
Match: PA2G4 (proliferation-associated 2G4 [Source:HGNC Symbol;Acc:HGNC:8550])

HSP 1 Score: 308.916 bits (790), Expect = 1.515e-101
Identity = 168/358 (46.93%), Postives = 250/358 (69.83%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLS 1154
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+V+   +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL 
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQ 359          
BLAST of DNA-binding protein vs. Ensembl Human
Match: PA2G4 (proliferation-associated 2G4 [Source:HGNC Symbol;Acc:HGNC:8550])

HSP 1 Score: 199.134 bits (505), Expect = 2.599e-60
Identity = 120/272 (44.12%), Postives = 181/272 (66.54%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKF 896
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+V+   +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR    K+Y LK+K SR F+S+V  +F
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRD-PSKQYGLKMKTSRAFFSEVERRF 273          
BLAST of DNA-binding protein vs. Ensembl Human
Match: PA2G4 (proliferation-associated 2G4 [Source:HGNC Symbol;Acc:HGNC:8550])

HSP 1 Score: 121.709 bits (304), Expect = 5.383e-32
Identity = 80/174 (45.98%), Postives = 115/174 (66.09%), Query Frame = 3
Query:  156 AEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENE 671
              ++  +L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+V+   +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + E
Sbjct:   14 GRLLGGVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGE 187          
BLAST of DNA-binding protein vs. Ensembl Human
Match: AC034102.2 (novel protein)

HSP 1 Score: 115.161 bits (287), Expect = 6.380e-30
Identity = 80/159 (50.31%), Postives = 105/159 (66.04%), Query Frame = 3
Query:  144 YKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNC 614
            Y M    ++ +L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+V+   +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC
Sbjct:    2 YVMPDTHLKGVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC 160          
BLAST of DNA-binding protein vs. Ensembl Human
Match: METAP2 (methionyl aminopeptidase 2 [Source:HGNC Symbol;Acc:HGNC:16672])

HSP 1 Score: 58.9214 bits (141), Expect = 7.185e-9
Identity = 65/314 (20.70%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I N ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P    T   +  D+ KID G +I G  +    T       +  +   K D       CA   +RL   G+  + V E   +      +  K + N   + + +      KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  127 EEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVK-DATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILL 428          
BLAST of DNA-binding protein vs. Ensembl Celegans
Match: W08E12.7 (pep chromosome:WBcel235:IV:3295139:3297225:1 gene:WBGene00021088.1 transcript:W08E12.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W08E12.7)

HSP 1 Score: 257.684 bits (657), Expect = 4.726e-82
Identity = 138/348 (39.66%), Postives = 224/348 (64.37%), Query Frame = 3
Query:  117 LEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            L ++ +V KY++AAEI   +LKE++   + G    ++C+ GD  I E+  K++KKEK   KG A PTCIS +N + ++ P +S      ++G +VK+DLG +IDG    A HT V+GA+K+NKVTG+ AD++   ++  E A+R  +P  ++  +T+ +  TA++F    +EN +++ +E+N  + EK  + N  E  K   EK+  + ++ + IDI  STG  + K+ + ++TVF++      YQLK+KASR F+SDV       PF+LRSF +  KAK+GV+EC K+GL+  +P++YEK+GE VA FK TVL+M NG +K+ GL F+  +YQS L +++  ++++L
Sbjct:   23 LANDAVVTKYQVAAEITNAVLKEVLANIKEGAIAGDLCDLGDKLILEKTGKLYKKEKNFTKGIAMPTCISIDNCICHYTPLKSEAPVVLKNGQVVKVDLGTHIDGLIATAAHTVVVGASKDNKVTGKLADLLRGTHDALEIAIRSLRPDTENTTITKNIDKTAAEFGLTPIENMLSHQLERNEIDGEKKIIQNSGEKQKGEIEKIKIDKHEAYAIDILFSTGKGQPKDMDTRTTVFRKN-EQVSYQLKMKASRVFFSDVNKVHGPMPFSLRSFEEEVKAKMGVVECEKYGLLVPYPVLYEKEGELVAQFKATVLVMPNGLLKIAGLPFDSDVYQSDLTVKDPELQAVL 369          
BLAST of DNA-binding protein vs. Ensembl Celegans
Match: W08E12.7 (pep chromosome:WBcel235:IV:3295135:3297225:1 gene:WBGene00021088.1 transcript:W08E12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W08E12.7)

HSP 1 Score: 257.684 bits (657), Expect = 4.726e-82
Identity = 138/348 (39.66%), Postives = 224/348 (64.37%), Query Frame = 3
Query:  117 LEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            L ++ +V KY++AAEI   +LKE++   + G    ++C+ GD  I E+  K++KKEK   KG A PTCIS +N + ++ P +S      ++G +VK+DLG +IDG    A HT V+GA+K+NKVTG+ AD++   ++  E A+R  +P  ++  +T+ +  TA++F    +EN +++ +E+N  + EK  + N  E  K   EK+  + ++ + IDI  STG  + K+ + ++TVF++      YQLK+KASR F+SDV       PF+LRSF +  KAK+GV+EC K+GL+  +P++YEK+GE VA FK TVL+M NG +K+ GL F+  +YQS L +++  ++++L
Sbjct:   23 LANDAVVTKYQVAAEITNAVLKEVLANIKEGAIAGDLCDLGDKLILEKTGKLYKKEKNFTKGIAMPTCISIDNCICHYTPLKSEAPVVLKNGQVVKVDLGTHIDGLIATAAHTVVVGASKDNKVTGKLADLLRGTHDALEIAIRSLRPDTENTTITKNIDKTAAEFGLTPIENMLSHQLERNEIDGEKKIIQNSGEKQKGEIEKIKIDKHEAYAIDILFSTGKGQPKDMDTRTTVFRKN-EQVSYQLKMKASRVFFSDVNKVHGPMPFSLRSFEEEVKAKMGVVECEKYGLLVPYPVLYEKEGELVAQFKATVLVMPNGLLKIAGLPFDSDVYQSDLTVKDPELQAVL 369          
BLAST of DNA-binding protein vs. Ensembl Celegans
Match: map-2 (Methionine aminopeptidase 2 [Source:UniProtKB/TrEMBL;Acc:H1UBK1])

HSP 1 Score: 60.4622 bits (145), Expect = 1.075e-9
Identity = 72/340 (21.18%), Postives = 150/340 (44.12%), Query Frame = 3
Query:   87 DSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTY--------VIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNT------ASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRC-IADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDV--TKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            +S  E +  ++  E +   Y+ +AE  +++ K + +  +PG+ ++E+C   ++      ++   KE+ ++ G A+PT  S N+  +++ P    T   + GD+ KID G+++ G  + +  T         ++ A +E    G K   I          +RL   G+    + E ++ +         +  K + N   + + +      KT  I     +K  E+   E N+++ I+   STG   V +    S   K   +AD+K  L+L+ S+   + +   F    F  R    +  TK  + + +    G+++ +P + +  G + A ++ T+LM
Sbjct:  114 ESNEEKKALDISYEEVWQDYRRSAEAHRQVRKYVKSWIKPGMTMIEICERLET-----TSRRLIKEQGLEAGLAFPTGCSLNHCAAHYTPNAGDTTVLQYGDVCKIDYGIHVRGRLIDSAFTVHFDPKFDPLVEAVREATNAGIKESGI---------DVRLCDVGE----IVEEVMTSHEVELDGKSYVVKPIRNLNGHSIAQYRIHAGKTVPI-----VKGGEQTKMEENEIYAIETFGSTGKGYVHDDMETSHYMKNFELADEKIPLRLQKSKGLLNLIDKNFATLAFCRRWIDRLGETKYLMALKDLCDKGIVDPYPPLCDVKGCYTAQWEHTILM 430          
BLAST of DNA-binding protein vs. Ensembl Celegans
Match: map-2 (Methionine aminopeptidase 2 [Source:UniProtKB/TrEMBL;Acc:H1UBK1])

HSP 1 Score: 60.4622 bits (145), Expect = 1.075e-9
Identity = 72/340 (21.18%), Postives = 150/340 (44.12%), Query Frame = 3
Query:   87 DSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTY--------VIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNT------ASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRC-IADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDV--TKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            +S  E +  ++  E +   Y+ +AE  +++ K + +  +PG+ ++E+C   ++      ++   KE+ ++ G A+PT  S N+  +++ P    T   + GD+ KID G+++ G  + +  T         ++ A +E    G K   I          +RL   G+    + E ++ +         +  K + N   + + +      KT  I     +K  E+   E N+++ I+   STG   V +    S   K   +AD+K  L+L+ S+   + +   F    F  R    +  TK  + + +    G+++ +P + +  G + A ++ T+LM
Sbjct:  114 ESNEEKKALDISYEEVWQDYRRSAEAHRQVRKYVKSWIKPGMTMIEICERLET-----TSRRLIKEQGLEAGLAFPTGCSLNHCAAHYTPNAGDTTVLQYGDVCKIDYGIHVRGRLIDSAFTVHFDPKFDPLVEAVREATNAGIKESGI---------DVRLCDVGE----IVEEVMTSHEVELDGKSYVVKPIRNLNGHSIAQYRIHAGKTVPI-----VKGGEQTKMEENEIYAIETFGSTGKGYVHDDMETSHYMKNFELADEKIPLRLQKSKGLLNLIDKNFATLAFCRRWIDRLGETKYLMALKDLCDKGIVDPYPPLCDVKGCYTAQWEHTILM 430          
BLAST of DNA-binding protein vs. Ensembl Celegans
Match: map-2 (Methionine aminopeptidase 2 [Source:UniProtKB/TrEMBL;Acc:H1UBK1])

HSP 1 Score: 60.4622 bits (145), Expect = 1.075e-9
Identity = 72/340 (21.18%), Postives = 150/340 (44.12%), Query Frame = 3
Query:   87 DSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTY--------VIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNT------ASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRC-IADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDV--TKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            +S  E +  ++  E +   Y+ +AE  +++ K + +  +PG+ ++E+C   ++      ++   KE+ ++ G A+PT  S N+  +++ P    T   + GD+ KID G+++ G  + +  T         ++ A +E    G K   I          +RL   G+    + E ++ +         +  K + N   + + +      KT  I     +K  E+   E N+++ I+   STG   V +    S   K   +AD+K  L+L+ S+   + +   F    F  R    +  TK  + + +    G+++ +P + +  G + A ++ T+LM
Sbjct:  114 ESNEEKKALDISYEEVWQDYRRSAEAHRQVRKYVKSWIKPGMTMIEICERLET-----TSRRLIKEQGLEAGLAFPTGCSLNHCAAHYTPNAGDTTVLQYGDVCKIDYGIHVRGRLIDSAFTVHFDPKFDPLVEAVREATNAGIKESGI---------DVRLCDVGE----IVEEVMTSHEVELDGKSYVVKPIRNLNGHSIAQYRIHAGKTVPI-----VKGGEQTKMEENEIYAIETFGSTGKGYVHDDMETSHYMKNFELADEKIPLRLQKSKGLLNLIDKNFATLAFCRRWIDRLGETKYLMALKDLCDKGIVDPYPPLCDVKGCYTAQWEHTILM 430          
BLAST of DNA-binding protein vs. Ensembl Fly
Match: CG10576 (gene:FBgn0035630 transcript:FBtr0345606)

HSP 1 Score: 277.33 bits (708), Expect = 1.457e-89
Identity = 155/363 (42.70%), Postives = 237/363 (65.29%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPV 1163
            +D E E E    ED  +V KYK+A EIV K LK +I  C    ++ E+C  GD+++ EE  K++KKEK++KKG A+PTC+S NN V +F P ++    T + GD+VKIDLG +IDG+  VA HT V+GA  + K++GR+ADVILAAY   +AALRL K G ++  +T+ +   +  + CK +E  +++ +++   + EKT + NPSE  +K  EK  FE  +V+ ID+ VSTG+   +E++ K +++K+  +++ Y LK+KASR   ++V  K+ N PF +RSF + TKA++GV+EC  H ++E F ++YEK  E VA FK TVL+M NG   +TG+ FE   Y S   +    +K+LL++P+
Sbjct:    2 ADVEKEPEKTIAED-LVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGRQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSIYKK--SEENYMLKMKASRALLAEVKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLVTGIPFEAENYVSEYSVAQEELKTLLAQPL 361          
BLAST of DNA-binding protein vs. Ensembl Fly
Match: CG10576 (gene:FBgn0035630 transcript:FBtr0077121)

HSP 1 Score: 277.33 bits (708), Expect = 1.457e-89
Identity = 155/363 (42.70%), Postives = 237/363 (65.29%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPV 1163
            +D E E E    ED  +V KYK+A EIV K LK +I  C    ++ E+C  GD+++ EE  K++KKEK++KKG A+PTC+S NN V +F P ++    T + GD+VKIDLG +IDG+  VA HT V+GA  + K++GR+ADVILAAY   +AALRL K G ++  +T+ +   +  + CK +E  +++ +++   + EKT + NPSE  +K  EK  FE  +V+ ID+ VSTG+   +E++ K +++K+  +++ Y LK+KASR   ++V  K+ N PF +RSF + TKA++GV+EC  H ++E F ++YEK  E VA FK TVL+M NG   +TG+ FE   Y S   +    +K+LL++P+
Sbjct:    2 ADVEKEPEKTIAED-LVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGRQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSIYKK--SEENYMLKMKASRALLAEVKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLVTGIPFEAENYVSEYSVAQEELKTLLAQPL 361          
BLAST of DNA-binding protein vs. Ensembl Fly
Match: CG10576 (gene:FBgn0035630 transcript:FBtr0345901)

HSP 1 Score: 277.33 bits (708), Expect = 1.457e-89
Identity = 155/363 (42.70%), Postives = 237/363 (65.29%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPV 1163
            +D E E E    ED  +V KYK+A EIV K LK +I  C    ++ E+C  GD+++ EE  K++KKEK++KKG A+PTC+S NN V +F P ++    T + GD+VKIDLG +IDG+  VA HT V+GA  + K++GR+ADVILAAY   +AALRL K G ++  +T+ +   +  + CK +E  +++ +++   + EKT + NPSE  +K  EK  FE  +V+ ID+ VSTG+   +E++ K +++K+  +++ Y LK+KASR   ++V  K+ N PF +RSF + TKA++GV+EC  H ++E F ++YEK  E VA FK TVL+M NG   +TG+ FE   Y S   +    +K+LL++P+
Sbjct:    2 ADVEKEPEKTIAED-LVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGRQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSIYKK--SEENYMLKMKASRALLAEVKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLVTGIPFEAENYVSEYSVAQEELKTLLAQPL 361          
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Match: pa2g4b (proliferation-associated 2G4, b [Source:ZFIN;Acc:ZDB-GENE-030131-2182])

HSP 1 Score: 327.405 bits (838), Expect = 7.484e-109
Identity = 171/361 (47.37%), Postives = 254/361 (70.36%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            MS D + + +   + D+ +V KYKM A+I    LK +I   +PGV++L +C  GD+ I  E +K+FKKEKE+KKG A+PTC+S NN V +F P +S   +  +DGDLVKIDLGV++DG+     H++V+GATK+  VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ +++++ + EKT + NP++  +K  EK +FEV++V+ +D+ VSTG+ K ++   ++TV+KR    K+Y LK+K SR F+S+V  +F   PFTLR+F D +KA++GV+ECAKH L++ F +++EK+GE VA FKFTVL+MANGP+++T   FEP LY+S  ++Q+  +K+LL
Sbjct:    1 MSGDDDQQEQ--TIADDLVVTKYKMGADIANLALKTVIEAAKPGVSVLSLCEKGDAFIAAETSKVFKKEKEIKKGIAFPTCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKDAPVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFKCMPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKARDSGQRTTVYKR-DPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDESKARLGVVECAKHELLQPFSVLHEKEGEHVAQFKFTVLLMANGPLRITSGLFEPELYKSEYEVQDPELKALL 358          
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Match: pa2g4b (proliferation-associated 2G4, b [Source:ZFIN;Acc:ZDB-GENE-030131-2182])

HSP 1 Score: 321.242 bits (822), Expect = 6.250e-107
Identity = 169/358 (47.21%), Postives = 252/358 (70.39%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVK 1142
            MS D + + +   + D+ +V KYKM A+I    LK +I   +PGV++L +C  GD+ I  E +K+FKKEKE+KKG A+PTC+S NN V +F P +S   +  +DGDLVKIDLGV++DG+     H++V+GATK+  VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ +++++ + EKT + NP++  +K  EK +FEV++V+ +D+ VSTG+ K ++   ++TV+KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D +KA++GV+ECAKH L++ F +++EK+GE VA FKFTVL+MANGP+++T   FEP LY+S  ++Q+  +K
Sbjct:    1 MSGDDDQQEQ--TIADDLVVTKYKMGADIANLALKTVIEAAKPGVSVLTLCEKGDTFIAAETSKVFKKEKEIKKGIAFPTCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKDAPVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFKCMPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKARDSGQRTTVYKRDPS-KQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDESKARLGVVECAKHELLQPFSVLHEKEGEHVAQFKFTVLLMANGPLRITSGLFEPELYKSEYEVQDPELK 355          
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Match: pa2g4a (proliferation-associated 2G4, a [Source:ZFIN;Acc:ZDB-GENE-030616-161])

HSP 1 Score: 318.931 bits (816), Expect = 1.217e-105
Identity = 168/361 (46.54%), Postives = 249/361 (68.98%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            MS D + E     + ++ +V KYKM  +I  + L+ +I   +PGV++L +C  GD+ I  E  KIFK+EK+MKKG A+PTC+S NN V +F P +S   +  +DGDLVKIDLGV++DG+     H++VIGATKE  VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ +S+G+ K ++   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++ EK+GEFVA FKFTVL+MANGP+++T    E  LY+S   +Q+  +KSL+
Sbjct:    1 MSDDEQQE---QTIAEDLVVTKYKMGGDIANQALRAVIEAAKPGVSVLSLCQKGDAFIMAETGKIFKREKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVIGATKEAPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFKCNPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISSGEGKARDGGQRTTIYKRDPS-KQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDEGKARLGVVECAKHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPLRITSGPLEAELYKSEHDVQDPELKSLI 357          
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Match: pa2g4b (proliferation-associated 2G4, b [Source:ZFIN;Acc:ZDB-GENE-030131-2182])

HSP 1 Score: 176.407 bits (446), Expect = 8.408e-53
Identity = 99/205 (48.29%), Postives = 144/205 (70.24%), Query Frame = 3
Query:  177 LKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAK 782
            LK +I   +PGV++L +C  GD+ I  E +K+FKKEKE+KKG A+PTC+S NN V +F P +S   +  +DGDLVKIDLGV++DG+     H++V+GATK+  VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ +++++ + EKT + NP++  +K  EK +FEV++V+ +D+ VSTG+ K
Sbjct:    3 LKTVIEAAKPGVSVLSLCEKGDAFIAAETSKVFKKEKEIKKGIAFPTCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKDAPVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFKCMPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGK 207          
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Match: metap2a (methionyl aminopeptidase 2a [Source:ZFIN;Acc:ZDB-GENE-061013-5])

HSP 1 Score: 58.151 bits (139), Expect = 1.037e-8
Identity = 67/326 (20.55%), Postives = 139/326 (42.64%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            S+ E  V +  +E + + ++ AAE  +++ + + +  +PG+ ++++C     R+    ++   KE  +  G A+PT  S NN  +++ P     T     D+ KID G +I+G  +    T      K + +    AD       CA   +RL   G+  + V E   +      +  K + N   + + +      KT  I     +K  E    E  +V+ I+   STG   V + ++  + + +        ++L  ++   + V   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  141 SDEEKRVLDEANEEMWSDFRQAAEAHRQVRRYVKSWIKPGMTMIDIC----ERLE-ACSRRLIKEDGLNAGLAFPTGCSLNNCAAHYTPNAGDPTVLRYDDVCKIDFGTHINGRIIDCAFTVTFNP-KFDHLLEAVADATNTGIKCAGIDVRLCDVGESIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMDCSHYMKNFDVGHVPIRLPRAKHLLNVVNENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIIDPYPPLCDTKGSYTAQFEHTILL 454          
BLAST of DNA-binding protein vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:NCBI gene;Acc:493284])

HSP 1 Score: 323.553 bits (828), Expect = 2.349e-107
Identity = 171/361 (47.37%), Postives = 252/361 (69.81%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            MS D E + +   + ++ +V KYKM  +I  ++L+ L+     G ++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  +DGDLVKIDLGV++DG+     H++V+GA+KE  VTGRKADVI AA+ C EAALRL KPG  +  VTE     +  F C  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ +STG+ K K+   ++T++KR    K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP +Y+S L++Q+S +K+LL
Sbjct:    1 MSGDEEQQEQT--IAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFKCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQRTTIYKR-DPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKALL 358          
BLAST of DNA-binding protein vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:NCBI gene;Acc:493284])

HSP 1 Score: 316.62 bits (810), Expect = 6.056e-105
Identity = 168/355 (47.32%), Postives = 247/355 (69.58%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNS 1133
            MS D E + +   + ++ +V KYKM  +I  ++L+ L+     G ++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  +DGDLVKIDLGV++DG+     H++V+GA+KE  VTGRKADVI AA+ C EAALRL KPG  +  VTE     +  F C  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ +STG+ K K+   ++T++KR    K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP +Y+S L++Q+S
Sbjct:    1 MSGDEEQQEQ--TIAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFKCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQRTTIYKRD-PTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDMYKSELEVQDS 352          
BLAST of DNA-binding protein vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:NCBI gene;Acc:493284])

HSP 1 Score: 307.375 bits (786), Expect = 7.597e-101
Identity = 171/368 (46.47%), Postives = 249/368 (67.66%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTK 1172
            MS D E + +   + ++ +V KYKM A   +  +K        G ++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  +DGDLVKIDLGV++DG+     H++V+GA+KE  VTGRKADVI AA+ C EAALRL KPG  +  VTE     +  F C  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ +STG+ K K+   ++T++KR    K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP +Y+S L++Q+S +K+LL      K
Sbjct:    1 MSGDEEQQEQ--TIAEDLVVTKYKMGAGEPRHGVKYTTA----GASLLNLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFKCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQRTTIYKR-DPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKALLQSSASRK 361          
BLAST of DNA-binding protein vs. Ensembl Xenopus
Match: snrnp40 (small nuclear ribonucleoprotein, U5 40kDa subunit [Source:Xenbase;Acc:XB-GENE-957415])

HSP 1 Score: 57.3806 bits (137), Expect = 1.998e-8
Identity = 64/314 (20.38%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I   ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P     T  +  D+ KID G +I+G  +    T      K +K+     D       C+   +RL   G+  + V E   +      +  K + N   + +        KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:   63 EEIWTDFRQAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLYAGLAFPTGCSLNNCAAHYTPNAGDPTVLQYDDVCKIDFGTHINGRIIDCAFTVTFNP-KYDKLLEAVKDATNTGIKCSGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRAKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDMKGSYTAQFEHTILL 364          
BLAST of DNA-binding protein vs. Ensembl Xenopus
Match: snrnp40 (small nuclear ribonucleoprotein, U5 40kDa subunit [Source:Xenbase;Acc:XB-GENE-957415])

HSP 1 Score: 57.3806 bits (137), Expect = 2.186e-8
Identity = 65/314 (20.70%), Postives = 134/314 (42.68%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I   ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P     T  +  D+ KID G +I+G  +    T V    K +K+     D       C+   +RL   G+  + V E   +      +  K + N   + +        KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:   69 EEIWTDFRQAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLYAGLAFPTGCSLNNCAAHYTPNAGDPTVLQYDDVCKIDFGTHINGRIIDCAFT-VTFNPKYDKLLEAVKDATNTGIKCSGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRAKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDMKGSYTAQFEHTILL 370          
BLAST of DNA-binding protein vs. Ensembl Mouse
Match: Pa2g4 (proliferation-associated 2G4 [Source:MGI Symbol;Acc:MGI:894684])

HSP 1 Score: 312.768 bits (800), Expect = 4.173e-103
Identity = 170/357 (47.62%), Postives = 251/357 (70.31%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+VIG  +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL 358          
BLAST of DNA-binding protein vs. Ensembl Mouse
Match: Pa2g4 (proliferation-associated 2G4 [Source:MGI Symbol;Acc:MGI:894684])

HSP 1 Score: 312.768 bits (800), Expect = 4.173e-103
Identity = 170/357 (47.62%), Postives = 251/357 (70.31%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+VIG  +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL 358          
BLAST of DNA-binding protein vs. Ensembl Mouse
Match: Metap2 (methionine aminopeptidase 2 [Source:MGI Symbol;Acc:MGI:1929701])

HSP 1 Score: 59.3066 bits (142), Expect = 4.505e-9
Identity = 66/314 (21.02%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I N ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P    T   +  D+ KID G +I G  +    T       +  +T  K D       CA   +RL   G+  + V E   +      +  K + N   + +        KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  163 EEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDILLTAVK-DATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILL 464          
BLAST of DNA-binding protein vs. Ensembl Mouse
Match: Metap2 (methionine aminopeptidase 2 [Source:MGI Symbol;Acc:MGI:1929701])

HSP 1 Score: 59.3066 bits (142), Expect = 4.505e-9
Identity = 66/314 (21.02%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I N ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P    T   +  D+ KID G +I G  +    T       +  +T  K D       CA   +RL   G+  + V E   +      +  K + N   + +        KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  163 EEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDILLTAVK-DATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILL 464          
BLAST of DNA-binding protein vs. Ensembl Mouse
Match: Metap2 (methionine aminopeptidase 2 [Source:MGI Symbol;Acc:MGI:1929701])

HSP 1 Score: 59.3066 bits (142), Expect = 4.915e-9
Identity = 66/314 (21.02%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  126 ETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E I N ++ AAE  +++ K +++  +PG+ ++E+C   +       ++   KE  +  G A+PT  S NN  +++ P    T   +  D+ KID G +I G  +    T       +  +T  K D       CA   +RL   G+  + V E   +      +  K + N   + +        KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  173 EEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLED-----CSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDILLTAVK-DATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILL 474          
BLAST of DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q6AYD3|PA2G4_RAT (Proliferation-associated protein 2G4 OS=Rattus norvegicus OX=10116 GN=Pa2g4 PE=1 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.919e-102
Identity = 170/357 (47.62%), Postives = 252/357 (70.59%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+VIG  + ++VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGSQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL 358          
BLAST of DNA-binding protein vs. UniProt/SwissProt
Match: sp|P50580|PA2G4_MOUSE (Proliferation-associated protein 2G4 OS=Mus musculus OX=10090 GN=Pa2g4 PE=1 SV=3)

HSP 1 Score: 312.768 bits (800), Expect = 2.919e-102
Identity = 170/357 (47.62%), Postives = 251/357 (70.31%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+VIG  +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL 358          
BLAST of DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q9UQ80|PA2G4_HUMAN (Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3)

HSP 1 Score: 308.916 bits (790), Expect = 7.273e-101
Identity = 168/358 (46.93%), Postives = 250/358 (69.83%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF--EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLS 1154
             E E +   + ++ +V KYKM  +I  ++L+ L+     GV++L +C  GD+ I EE  KIFKKEKEMKKG A+PT IS NN V +F P +S + +  ++GDLVKIDLGV++DG+     HT+V+   +  +VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  FNC  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ VS+G+ K K+   ++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++YEK+GEFVA FKFTVL+M NGPM++T   FEP LY+S +++Q++ +K+LL 
Sbjct:    3 GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPS-KQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQ 359          
BLAST of DNA-binding protein vs. UniProt/SwissProt
Match: sp|M1CZC0|EBP1_SOLTU (ERBB-3 BINDING PROTEIN 1 OS=Solanum tuberosum OX=4113 GN=EBP1 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 7.075e-82
Identity = 148/365 (40.55%), Postives = 230/365 (63.01%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXX-XXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETF-EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKE-REIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSA-VKSLLSEP 1160
            MS D   E E++ L    +V KYK AAEIV K L+ ++++C+P   I+++C  GD+ I E+   +    +K++++G A+PTCIS NN V +F P  S ET  E+GD++KID+G +IDG+  V GHT+V+    E  VTGR ADVI A    AE ALRL +PGK +  VTE +   A+ ++CK++E  +++ M++ + +  K  +   + D +  E  +FE N+V++IDI  STGD K K   E ++T++KR + DK Y LK+KASR  +S++  KF   PFT R   +  +A++G++EC  H L++ +P+++EK G+ VAH KFTVL+M NG  ++T  A +    Q T   +N   +K+ L+ P
Sbjct:    1 MSDDEREEKELD-LTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVVEEGDILKIDMGCHIDGFIAVVGHTHVL---HEGPVTGRAADVIAATNTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPDTRVDE-AEFEENEVYSIDIVTSTGDGKPKLLDEKQTTIYKRAV-DKSYNLKMKASRFIFSEISQKFPIMPFTARDLEE-KRARLGLVECVNHELLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRVTSHALQE--LQPTKTTENEPEIKAWLALP 356          
BLAST of DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q96327|EBP1_ARATH (ERBB-3 BINDING PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=EBP1 PE=1 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.832e-77
Identity = 140/341 (41.06%), Postives = 216/341 (63.34%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXX-XXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFE 1094
            MSSD E + +  +L    +V KYK AAEIV K L+ ++ +C+P   I+++C  GDS I E+ A +    +K++++G A+PTCIS NN V +F P  S E+  EDGD+VKID+G +IDG+  + GHT+V+   +E  ++GRKADVI AA   A+ ALRL +PGK +  VTE +   A+ ++CK++E  +++ +++++ +  K  +   S +    E V+FE N+V+ IDI  STGD K K  + K T   +      YQLK+KASR   S++   F   PFT RS  +  +A++G++EC  HG ++ +P++YEK G+FVA  KFTVL+M NG  ++T    +
Sbjct:    1 MSSDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVL---QEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVEGVLSHQLKQHVIDGNKVVLSVSSPETTVDE-VEFEENEVYAIDIVASTGDGKPKLLDEKQTTIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEE-KRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQ 336          
BLAST of DNA-binding protein vs. TrEMBL
Match: A0A4Z2D700 (Proliferation-associated protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003886 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 5.277e-122
Identity = 188/370 (50.81%), Postives = 265/370 (71.62%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET----FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTKKK 1178
            SD E++ E + L+D T+VNKYKMAAE+   +L ELI  C  G NI+E+C  GD RI+E+ +++FKK+KEMKKG A+PT IS NNI+ ++ P  S E        GDLVKI++G ++DGYA + GHT+V+GAT++NK+TGRKADVILAA+  AEA +RL KPG ++   +E +    +DF C  +E    + M+K +Y+ EK+ + NPSE+ KK+ EK  F+ N VW +DI VSTGD K +E   ++T++K+   +  YQLK+KASRQ YS++ NKFL YPF LRS  D+ KA++G+ EC KHG+++   +  EKD EFVA F+FTVL+M NGPMK+TGL F+PSLY+S  K++++ +K LLS+ VK + K
Sbjct:    2 SDQESDAEQDVLDD-TVVNKYKMAAEVTNAVLIELIGLCTDGANIVELCELGDKRISEKVSQLFKKDKEMKKGVAFPTAISVNNIMCHYSPIDSEENDPTQINTGDLVKINVGAHVDGYAAIVGHTFVVGATQDNKITGRKADVILAAHTAAEAIMRLLKPGVENLKASEIVSKVVADFKCHAVEGMQCHQMKKLVYDAEKSIVFNPSEEQKKTIEKCTFDTNDVWNVDIVVSTGDGKPREHNARTTLYKK--NETLYQLKMKASRQLYSEIANKFLVYPFNLRSLDDIKKARLGITECIKHGVIQPLSVHCEKDDEFVAQFRFTVLLMPNGPMKVTGLTFDPSLYKSEFKVKDAEIKDLLSQSVKIQNK 368          
BLAST of DNA-binding protein vs. TrEMBL
Match: C1LJB6 (Proliferation-associated protein 2G4 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 5.393e-122
Identity = 188/370 (50.81%), Postives = 265/370 (71.62%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET----FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTKKK 1178
            SD E++ E + L+D T+VNKYKMAAE+   +L ELI  C  G NI+E+C  GD RI+E+ +++FKK+KEMKKG A+PT IS NNI+ ++ P  S E        GDLVKI++G ++DGYA + GHT+V+GAT++NK+TGRKADVILAA+  AEA +RL KPG ++   +E +    +DF C  +E    + M+K +Y+ EK+ + NPSE+ KK+ EK  F+ N VW +DI VSTGD K +E   ++T++K+   +  YQLK+KASRQ YS++ NKFL YPF LRS  D+ KA++G+ EC KHG+++   +  EKD EFVA F+FTVL+M NGPMK+TGL F+PSLY+S  K++++ +K LLS+ VK + K
Sbjct:    2 SDQESDAEQDVLDD-TVVNKYKMAAEVTNAVLIELIGLCTDGANIVELCELGDKRISEKVSQLFKKDKEMKKGVAFPTAISVNNIMCHYSPIDSEENDPTQINTGDLVKINVGAHVDGYAAIVGHTFVVGATQDNKITGRKADVILAAHTAAEAIMRLLKPGMENLKASEIVSKVVADFKCHAVEGMQCHQMKKLVYDAEKSIVFNPSEEQKKTIEKCTFDTNDVWNVDIVVSTGDGKPREHNARTTLYKK--NETLYQLKMKASRQLYSEIANKFLVYPFNLRSLDDIKKARLGITECIKHGVIQPLSVHCEKDDEFVAQFRFTVLLMPNGPMKVTGLTFDPSLYKSEFKVKDAEIKDLLSQSVKIQNK 368          
BLAST of DNA-binding protein vs. TrEMBL
Match: C7TZT2 (Proliferation-associated protein 2G4 (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.384e-121
Identity = 187/366 (51.09%), Postives = 263/366 (71.86%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET----FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVK 1166
            SD E++ E + L+D T+VNKYKMAAE+   +L ELI  C  G NI+E+C  GD RI+E+ +++FKK+KEMKKG A+PT IS NNI+ ++ P  S E        GDLVKI++G ++DGYA + GHT+V+GAT++NK+TGRKADVILAA+  AEA +RL KPG ++   +E +    +DF C  +E    + M+K +Y+ EK+ + NPSE+ KK+ EK  F+ N VW +DI VSTGD K +E   ++T++K+   +  YQLK+KASRQ YS++ NKFL YPF LRS  D+ KA++G+ EC KHG+++   +  EKD EFVA F+FTVL+M NGPMK+TGL F+PSLY+S  K++++ +K LLS+ VK
Sbjct:    2 SDQESDAEQDVLDD-TVVNKYKMAAEVTNAVLIELIGLCTDGANIVELCELGDKRISEKVSQLFKKDKEMKKGIAFPTAISVNNIMCHYSPIDSEENDPTQINTGDLVKINVGAHVDGYAAIVGHTFVVGATQDNKITGRKADVILAAHTAAEAIMRLLKPGMENLKASEIVSKVVADFKCHAVEGMQCHQMKKLVYDAEKSIVFNPSEEQKKTIEKCTFDTNDVWNVDIVVSTGDGKPREHNARTTLYKK--NETLYQLKMKASRQLYSEIANKFLVYPFNLRSLDDIKKARLGITECIKHGVIQPLSVHCEKDDEFVAQFRFTVLLMPNGPMKVTGLTFDPSLYKSEFKVKDAEIKDLLSQSVK 364          
BLAST of DNA-binding protein vs. TrEMBL
Match: Q5BYW1 (SJCHGC05984 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 2.228e-121
Identity = 187/366 (51.09%), Postives = 263/366 (71.86%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET----FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVK 1166
            SD E++ E + L+D T+VNKYKMAAE+   +L ELI  C  G NI+E+C  GD RI+E+ +++FKK+KEMKKG A+PT IS NNI+ ++ P  S E        GDLVKI++G ++DGYA + GHT+V+GAT++NK+TGRKADVILAA+  AEA +RL KPG ++   +E +    +DF C  +E    + M+K +Y+ EK+ + NPSE+ KK+ EK  F+ N VW +DI VSTGD K +E   ++T++K+   +  YQLK+KASRQ YS++ NKFL YPF LRS  D+ KA++G+ EC KHG+++   +  EKD EFVA F+FTVL+M NGPMK+TGL F+PSLY+S  K++++ +K LLS+ VK
Sbjct:   11 SDQESDAEQDVLDD-TVVNKYKMAAEVTNAVLIELIGLCTDGANIVELCELGDKRISEKVSQLFKKDKEMKKGVAFPTAISVNNIMCHYSPIDSEENDPTQINTGDLVKINVGAHVDGYAAIVGHTFVVGATQDNKITGRKADVILAAHTAAEAIMRLLKPGMENLKASEIVSKVVADFKCHAVEGMQCHQMKKLVYDAEKSIVFNPSEEQKKTIEKCTFDTNDVWNVDIVVSTGDGKPREHNARTTLYKK--NETLYQLKMKASRQLYSEIANKFLVYPFNLRSLDDIKKARLGITECIKHGVIQPLSVHCEKDDEFVAQFRFTVLLMPNGPMKVTGLTFDPSLYKSEFKVKDAEIKDLLSQSVK 373          
BLAST of DNA-binding protein vs. TrEMBL
Match: A0A2H1C3W9 (DNA-binding protein OS=Fasciola hepatica OX=6192 GN=D915_10907 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.804e-119
Identity = 180/365 (49.32%), Postives = 265/365 (72.60%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCP----EQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPV 1163
            SD E++ E   L+D  +VNKYKMAAEI   +L EL+  C PG  I+E+C +GD RI EEA+K+FKKEK MKKG ++PT IS NNI+ ++ P    + +    +D DLVKIDLG +IDG+A V GHT V+G+++E +VTG+KADV++AA+  AE ALR  +PG +S  ++E +  TASDF+C+ +E   ++ M + +Y+ EK  ++NPSE+ KKS EK  FEVN+VW IDI VS+GD K +E + ++T++K+   +  YQLK+KASRQ Y+++ NKF  YPF +R+  D+ KA++G+ ECAKH ++++ P+  EK+ EFVA F+FTVL+M NGPM++TGL F+  LY+S  K++++ VK +L +P+
Sbjct:    2 SDHESDEEATVLDD-IVVNKYKMAAEIANTVLTELVKMCIPGAQIVELCQYGDQRIQEEASKLFKKEKSMKKGLSFPTSISINNIICHYAPLEGEDNAITELKDEDLVKIDLGAHIDGFAAVVGHTVVVGSSQERRVTGKKADVVIAAHTAAEVALRQLRPGNESIKLSELVTKTASDFHCRPVEGMQSHQMRRMVYDAEKAIVLNPSEEHKKSIEKCTFEVNEVWNIDILVSSGDGKAREHKARTTIYKK--NETLYQLKMKASRQLYAEIANKFSAYPFNIRALEDLKKARLGITECAKHDVVQALPVYCEKEDEFVAQFRFTVLLMPNGPMRITGLPFDAGLYKSECKVKDAEVKEVLLQPI 363          
BLAST of DNA-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000018643.2 (proliferation-associated protein 2G4-like [Source:NCBI gene;Acc:103031777])

HSP 1 Score: 326.635 bits (836), Expect = 9.899e-109
Identity = 168/361 (46.54%), Postives = 252/361 (69.81%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPV 1163
            SE E +   + ++ +V KYKM A+I  + LK +    +PGV++L +C  GD+ I  E  K+FKKEKE+KKG A+PTC+S NN V +F P +S    T +DGDLVKIDLGV++DG+     H++V+GA+K+  VTGRKADVI AA+ CAEAALRL KPG  +  +TE     A  F C  +E  +++ +++++ + EKT + NP++  +K  EK +FEV++V+ +D+ VSTG+ K K+   ++TV+KR  + K+Y LK+K SR F+S+V  +F   PFTLR+F D +KA++GV+ECAKH L++ F +++EK+GEFVA FKFTVL+MANGP+++T    EP  Y+S  ++Q+  +++LL   V
Sbjct:    2 SEDEQQEQTIAEDLVVTKYKMGADIANRALKAVTEAAKPGVSVLSLCEKGDAFIAAETGKVFKKEKEIKKGIAFPTCVSVNNFVCHFSPLKSDPDYTLQDGDLVKIDLGVHVDGFISNVAHSFVVGASKDAPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQLTEAWNKIAQSFKCNAVEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKAKDSGRRTTVYKRDPS-KQYGLKMKTSRVFFSEVERRFDAMPFTLRAFEDESKARLGVVECAKHELLQPFNVLHEKEGEFVAQFKFTVLLMANGPLRITSGLLEPEHYKSEFEVQDPEIQALLQSSV 361          
BLAST of DNA-binding protein vs. Ensembl Cavefish
Match: pa2g4a (proliferation-associated protein 2G4 [Source:NCBI gene;Acc:103027720])

HSP 1 Score: 322.398 bits (825), Expect = 5.237e-107
Identity = 167/361 (46.26%), Postives = 250/361 (69.25%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            MS D + E     + ++ +V KYKM+ +I  + LK +I   +PGV++L +C  GD+ I  E  K+FK+EK+MKKG A+PTC+S NN V +F P +S    T +DGDLVKIDLGV++DG+     H++VIGA+KE  VTG+KADV+ AAY CAEAALRL KPG  +  +TE     A  F C  +E  +++ +++++ + EKT + NP++  +K  EK +FEV++V+ +D+ +STG+ K ++   ++T++KR    K+Y LK+K SR F+S+V  +F   PFTLR+  D  KA++GV+ECAKH L++ F ++ EK+GEFVA FKFTVL+MANGP+++T  AFEP  Y+S   +Q+  +KSL+
Sbjct:    1 MSDDEQQE---QTIAEDLVVTKYKMSGDIANQALKLVIEAAKPGVSVLSLCEKGDAYIMAETGKVFKREKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVIGASKEAPVTGKKADVVKAAYLCAEAALRLVKPGNQNTQITEAWNKIAHSFKCNPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKARDGGQRTTIYKRD-PSKQYGLKMKTSRIFFSEVERRFNAMPFTLRALEDEGKARLGVVECAKHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPLRITSGAFEPEFYKSEFDVQDPELKSLI 357          
BLAST of DNA-binding protein vs. Ensembl Cavefish
Match: metap2b (methionyl aminopeptidase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-2172])

HSP 1 Score: 61.2326 bits (147), Expect = 9.839e-10
Identity = 68/332 (20.48%), Postives = 137/332 (41.27%), Query Frame = 3
Query:   99 EVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCN---------FGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDV--TKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            E  V +  +E + N ++ AAE  +++ K +++  +PG+ ++E+C            ++R+N               G A+PT  S N+  +++ P     T  +  D+ KID G +I+G  +    T      K +K+     D       CA   +RL   G+  + V E   +      +  K + N   + + +      KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + V   F    F  R    +  TK  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  206 ERRVLDKANEEMWNDFRQAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENRLN--------------AGLAFPTGCSLNHCAAHYTPNAGDPTVLQYDDVCKIDFGTHINGRIIDCAFTVTFNP-KYDKLLEAVKDATNTGIKCAGIDVRLCDIGESIQEVMESYEVELDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGMVHD-DMECSHYMKNFEVGHVPIRLPRAKHLLNVVNENFGTLAFCRRWLDRLGETKYLMALKNLCDLGIIDPYPPLCDTKGCYTAQFEHTILL 516          
BLAST of DNA-binding protein vs. Ensembl Cavefish
Match: metap2a (methionine aminopeptidase 2 [Source:NCBI gene;Acc:103026355])

HSP 1 Score: 60.4622 bits (145), Expect = 1.398e-9
Identity = 67/326 (20.55%), Postives = 141/326 (43.25%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            S  E  V +  +E + N ++ AAE  +++ + + +  +PG++++++C     R+  + ++   KE  +  G A+PT  S NN  +++ P     T  +  D+ KID G +I+G  +    T      K +++     D       CA   +RL   G+  + V E   +      +  K + N   + + +      KT  I     +K  E    E  +V+ I+   STG   V + ++  + + +        ++L  ++   + V   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  123 SRDEKRVMDKANEEMWNDFRQAAEAHRQVRQYVKSWIKPGMSMIDIC----ERLE-DCSRRLIKENGLDAGLAFPTGCSLNNCAAHYTPNAGDPTVLQYDDVCKIDFGTHINGRIIDCAFTVTFNP-KYDRLLEAVKDATDTGIKCAGIDIRLCDVGESIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGVVHD-DMDCSHYMKNFDVGHVPIRLPRAKHLLNVVNENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIIDPYPPLCDAKGSYTAQFEHTILL 436          
BLAST of DNA-binding protein vs. Ensembl Cavefish
Match: metap1d (methionyl aminopeptidase type 1D, mitochondrial [Source:NCBI gene;Acc:103035219])

HSP 1 Score: 50.8322 bits (120), Expect = 1.550e-6
Identity = 33/142 (23.24%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  318 CISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQV 743
            C S NN+V +  P+  +   +DGD++ ID+ VY++GY      T++IG+  E    GRK  ++  A  C + A+   +PG+    +   +   A+    +V    + +G+    + + + +      D    E + F +  +
Sbjct:  170 CTSVNNVVCHGIPD--SRQLQDGDIINIDVTVYLEGYHGDTSETFLIGSVDEQ---GRK--LVDVARQCRDQAIAACEPGQPLCVIGNTISEIANSSGFRVCPYFIGHGIGSYFHGHPEIWHHANDNDFLMEEGMAFTIEPI 304          
BLAST of DNA-binding protein vs. Ensembl Sea Lamprey
Match: pa2g4b (proliferation-associated 2G4, b [Source:ZFIN;Acc:ZDB-GENE-030131-2182])

HSP 1 Score: 312.383 bits (799), Expect = 7.644e-104
Identity = 166/350 (47.43%), Postives = 245/350 (70.00%), Query Frame = 3
Query:  117 LEDETIVNKYKMAAEIV-QKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLS 1154
            + ++ +V KYKMA +IV +KI+K L+   + G ++  MC  GD+ I EE  K+FKKEKE+KKG A+PTCIS NN   +F P +S    T ++GDLVKIDLGV++DG+   A HT++IG +KEN  + RKADV+ AAY C+EAALRL K G ++  VT+     A++F C  +E  +++ +++++ + EKT + NP++  KK  EK  FEV++V+ +D+ +STG+ K +E   ++TVFKR   DK Y LK+KASR F S++  +F   PFTLR+F D  KA++GV+EC KH L++ FP++YEK+ EFVA FKFTVL+M NGP+++T     P LY+S L++Q+  +K+LL 
Sbjct:   15 IAEDLVVTKYKMAGDIVNRKIMKLLVEAAKGGESVRNMCEKGDNLIVEETNKVFKKEKEIKKGIAFPTCISVNNCTCHFSPLKSDPDCTMQNGDLVKIDLGVHVDGFVATAAHTFIIGVSKENPASDRKADVVKAAYLCSEAALRLVKAGTENTQVTQMWNKMANEFKCTPIEGMLSHQLKQHVIDGEKTVIQNPTDQQKKDHEKASFEVHEVYAVDVLISTGEGKARETGQRTTVFKRN-PDKHYILKMKASRAFLSEISTRFDVMPFTLRAFEDEKKARMGVVECVKHELLQPFPVLYEKESEFVAQFKFTVLLMPNGPLRITANLHNPELYKSELEVQDPELKALLQ 363          
BLAST of DNA-binding protein vs. Ensembl Yeast
Match: ARX1 (Nuclear export factor for the ribosomal pre-60S subunit; shuttling factor which directly binds FG rich nucleoporins and facilities translocation through the nuclear pore complex; interacts directly with Alb1p; responsible for Tif6p recycling defects in the absence of Rei1; associated with the ribosomal export complex [Source:SGD;Acc:S000002508])

HSP 1 Score: 66.2402 bits (160), Expect = 3.694e-12
Identity = 67/236 (28.39%), Postives = 98/236 (41.53%), Query Frame = 3
Query:   75 IMSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELIT---------KCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPE--------------------QSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENK--------VTGRKA----------DVILAAYNCAEAALRLFKP-GKDSKGVTEPLVNT-----ASDFNCKVL 623
            I   D++  ++  N+  E+++NKY+ A +I Q  LK + +           Q  + + E+C   DS I     + + K K  ++G A PT I  + I   +CPE                      T T   GDLVKI LGV+IDGY     HT VI    E K        + G KA          + ++A   CA    +L    G  S G+T  L+ T     A  +NC V+
Sbjct:    5 ISHEDTQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKTTQRQLTVPELCLLTDSFI-LTRLEQYYKNKVNERGIAIPTTIDIDQISGGWCPEIDDTQNLLNWNKGKDSTFASSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPILQPTGPLLGGKADAVAAAHIAMETVVALLACALTPEKLPASLGGTSSGITGQLIRTIVDTIARSYNCGVV 239          
BLAST of DNA-binding protein vs. Ensembl Yeast
Match: MAP2 (Methionine aminopeptidase; catalyzes the cotranslational removal of N-terminal methionine from nascent polypeptides; function is partially redundant with that of Map1p [Source:SGD;Acc:S000000187])

HSP 1 Score: 63.5438 bits (153), Expect = 1.945e-11
Identity = 69/340 (20.29%), Postives = 141/340 (41.47%), Query Frame = 3
Query:   66 FYLIMSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNF--GDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPL---VNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMAN 1061
            F L  ++D E+     +LE     N  +  AEI +++ + +  +  PG+ ++++ +     +R    A  +   E    +G  +PT +S N+  ++F P    +T  +  D++K+D GV ++G  + +  T       +N +   K D        A   +RL   G+  + V E     +N  + +  K   N   + +        K+  I     +K  +    E  + + I+   STG   V     + + + R   D +    L +++     +   F   PF  R    + + K    +    +HGL++ +P + +  G + A F+ T+L+ A+
Sbjct:   79 FNLQRTTDEESRYLKRDLERAEHWNDVRKGAEIHRRVRRAIKDRIVPGMKLMDIADMIENTTRKYTGAENLLAMEDPKSQGIGFPTGLSLNHCAAHFTPNAGDKTVLKYEDVMKVDYGVQVNGNIIDSAFTVSFDPQYDNLLAAVK-DATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGET-YQVKPCRNLCGHSIAPYRIHGGKSVPI-----VKNGDTTKMEEGEHFAIETFGSTGRGYVTAGG-EVSHYARSAEDHQVMPTLDSAKNLLKTIDRNFGTLPFCRRYLDRLGQEKYLFALNNLVRHGLVQDYPPLNDIPGSYTAQFEHTILLHAH 410          
BLAST of DNA-binding protein vs. Ensembl Nematostella
Match: EDO35730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM1])

HSP 1 Score: 320.472 bits (820), Expect = 1.297e-106
Identity = 173/361 (47.92%), Postives = 243/361 (67.31%), Query Frame = 3
Query:   99 EVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSE-KVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTK 1172
            E E   + ++ +V KYKMA ++  +IL +LI     G     +C  GD+ I EE  K++KKEKE+KKG A+PTCIS NN V +F P  S    T  DGDLVKID GV+IDG+  V GHT V+G +KENKVTGRKADV+LAAY  +E A R+ KPG ++  VTE +   A  F CK +E  +++ +++N+ + EK  + NP+E  +K   K +F V++V+ +D+ VSTGD K KE++ ++TV+KR      Y LK+KASR F+SDVCNKF   PFTLR+  D  KAK+G++ECAKH LME F +++EK+GEFVA FKFT+L+M NG +++T   FEP + QS   I++  +K +L++    K
Sbjct:   10 EEEEPTIAEDVVVTKYKMAGDMANRILLKLIEAANAGTTARTLCEKGDALILEETDKVYKKEKELKKGIAFPTCISVNNCVCHFSPLLSEPDITLNDGDLVKIDFGVHIDGFIAVIGHTIVVGCSKENKVTGRKADVLLAAYLASEVAQRMVKPGAENSTVTELVQKVAESFKCKPIEGMLSHQLKRNVIDGEKAIIQNPNEQQRKDHSKCEFAVHEVYGVDVLVSTGDGKTKEKDTRTTVYKR--TGNIYNLKMKASRVFFSDVCNKFTMMPFTLRALEDEKKAKMGIVECAKHELMEPFNVLWEKEGEFVAQFKFTMLLMPNGNIRITQGPFEPDMIQSEHCIEDETIKEILAQSASRK 368          
BLAST of DNA-binding protein vs. Ensembl Medaka
Match: pa2g4b (proliferation-associated protein 2G4-like [Source:NCBI gene;Acc:101170587])

HSP 1 Score: 325.094 bits (832), Expect = 3.987e-108
Identity = 172/361 (47.65%), Postives = 252/361 (69.81%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            MS D ET+ +   + D+ +V KYKM AEI  + LK ++T    GV++L +C  GD+ I  E  KIFK+EK+MKKG A+PTC+S NN V +  P +S      +DGD+VKIDLGV++DG+     H++V+GATK+N VTGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ +++++ + EKT + NP++  KK  EK +FEV++V+ +D+ +STG+ K K+   ++TV+KR   +K Y LK+K SR F+S++  +F   PFTLR+F D  KA++GV+ECAKH L++ F ++ EK+GEFVA FKFTVL+MANGP+++T   FEP LY+S  ++++  +K+LL
Sbjct:    1 MSGDDETQEQ--TIADDLVVTKYKMGAEIANQALKAVVTAATAGVSVLSLCEKGDALIVAETGKIFKREKDMKKGIAFPTCVSVNNCVCHHSPLKSDPDVILKDGDIVKIDLGVHVDGFISNVAHSFVVGATKDNPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKCSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDGGQRTTVYKRD-PNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEGKARLGVVECAKHELLQPFTVLQEKEGEFVAQFKFTVLLMANGPLRITNSLFEPELYKSEHEVEDPDLKALL 358          
BLAST of DNA-binding protein vs. Ensembl Medaka
Match: pa2g4a (proliferation-associated 2G4 [Source:NCBI gene;Acc:101162188])

HSP 1 Score: 311.997 bits (798), Expect = 4.520e-103
Identity = 163/359 (45.40%), Postives = 246/359 (68.52%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLL 1151
            SD E E     + ++ +V KYKM  +I  + L+ ++   +PGV+++ +C  GD+ I  E  K+FKKEKEMKKG A+PT IS NN V +F P +S    T +DGDLVKIDLGV++DG+     H++V+GA+KE   TGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ ++++I + EKT + NP++  +K  EK +FEV++V+ +D+ +STG+ K ++  +++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+  D  KA++GV+EC KH L++ F +++EK+GEFVA FKFTVL+MANGP ++T   F+   Y+S  ++Q+  +K+LL
Sbjct:    2 SDDEQE---QTIAEDLVVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYIMAETGKVFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKEQPATGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKCTPIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKARDSGLRTTIYKRDPS-KQYGLKMKTSRTFFSEVERRFDAMPFTLRALEDEAKARLGVVECTKHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPFDSEFYKSEHEVQDPELKTLL 356          
BLAST of DNA-binding protein vs. Ensembl Medaka
Match: pa2g4a (proliferation-associated 2G4 [Source:NCBI gene;Acc:101162188])

HSP 1 Score: 282.337 bits (721), Expect = 1.406e-91
Identity = 147/356 (41.29%), Postives = 228/356 (64.04%), Query Frame = 3
Query:   84 SDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTE--TFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKS-EKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVK 1142
            SD E E     + ++ +V KYKM  +I  + L+ ++   +PGV+++ +C  GD+ I  E  K+ +            T IS NN V +F P +S    T +DGDLVKIDLGV++DG+     H++V+G   E   TGRKADVI AA+ CAEAALRL KPG  +  VTE     A  F C  +E  +++ ++++I + EKT + NP++  +K  EK +FEV++V+ +D+ +STG+ K ++  +++T++KR  + K+Y LK+K SR F+S+V  +F   PFTLR+  D  KA++GV+EC KH L++ F +++EK+GEFVA FKFTVL+MANGP ++T   F+   Y+S  ++Q+  +K
Sbjct:    2 SDDEQE---QTIAEDLVVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYIMAETGKLLRW-----------TDISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVG---EQPATGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKCTPIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKARDSGLRTTIYKRDPS-KQYGLKMKTSRTFFSEVERRFDAMPFTLRALEDEAKARLGVVECTKHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPFDSEFYKSEHEVQDPELK 339          
BLAST of DNA-binding protein vs. Ensembl Medaka
Match: metap2b (methionyl aminopeptidase 2 [Source:NCBI gene;Acc:101170385])

HSP 1 Score: 54.6842 bits (130), Expect = 1.013e-7
Identity = 69/330 (20.91%), Postives = 143/330 (43.33%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            M+SD   E  V +  +E + N ++ AAE  +++ K + +  +PG+ ++E+C     R+  + ++   KE  +  G A+PT  S N+  +++ P     T  +  D+ KID G +I+G  +    T      K +K+     D        A   +RL   G+  + V E   +      +  K + N   + + +      KT  I     +K  E    E  +V+ I+   STG   V + +++ + + +        ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A F+ T+L+
Sbjct:  140 MTSD---EKRVMDKANEEMWNDFRQAAEAHRQVRKHVRSFLKPGMTMIEIC----ERLE-DCSRKLIKENGLNAGLAFPTGCSLNHCAAHYTPNAGDATVLQYDDVCKIDFGTHINGRIIDCAFTVTFNP-KYDKLLEAVKDATNTGIKNAGIDVRLCDVGEAIQEVMESYEVELDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPI-----VKGGEATRMEEGEVYAIETFGSTGKGMVHD-DMECSHYMKNFDVGHVPIRLPRAKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDTKGCYTAQFEHTILL 454          
BLAST of DNA-binding protein vs. Ensembl Medaka
Match: ENSORLT00000045745.1 (methionine aminopeptidase 2 [Source:NCBI gene;Acc:101164722])

HSP 1 Score: 52.7582 bits (125), Expect = 4.162e-7
Identity = 59/315 (18.73%), Postives = 135/315 (42.86%), Query Frame = 3
Query:  123 DETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTET-FEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK--IGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            +E + + ++ AAE  +++   + +  +PG+ ++E+C   +       ++   KE  +  G A+PT  S N+  +++ P     T     D+ KID G +I+G  +    T     +K +++     D       CA   +RL   G+  + V E   +      +  K + N   + + +    + KT  I     +K  E    E  + + I+   STG   V + +++ + + +  +     ++L  ++   + +   F    F  R    + ++K  + +      G+++ +P + +  G + A ++ T+L+
Sbjct:  169 NEEMWSDFRQAAEAHRQVRSYVRSWIKPGMTMIEICEKLED-----CSRRLIKENGLHAGLAFPTGCSINHCAAHYTPNAGDPTVLRFDDVCKIDFGTHINGRIIDCAFTVTFN-SKYDRLLEAVRDATNTGIRCAGIDVRLCDVGETIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHSGKTVPI-----VKGGEATKMEEGEAYAIETFGSTGKGAVHD-DMECSHYMKNFSVGHVPIRLPRAKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIIDPYPPLCDIKGSYTAQYEHTILL 471          
BLAST of DNA-binding protein vs. Planmine SMEST
Match: SMESG000070983.1 (SMESG000070983.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 368/372 (98.92%), Postives = 370/372 (99.46%), Query Frame = 3
Query:   78 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTKKKVAETN 1193
            MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINEEAAKIFKKEKEMKKGCAYPTCISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAE ALRLFKPGKDSKGVTEPL+NTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDF+VNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTKKKV ETN
Sbjct:    1 MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINEEAAKIFKKEKEMKKGCAYPTCISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEVALRLFKPGKDSKGVTEPLINTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFDVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHGLMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQNSAVKSLLSEPVKTKKKVVETN 372          
BLAST of DNA-binding protein vs. Planmine SMEST
Match: SMESG000063809.1 (SMESG000063809.1)

HSP 1 Score: 54.299 bits (129), Expect = 9.138e-8
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  318 CISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEK 653
            C S N ++ +  P+      EDGD++ ID+ VY +G+      T  IG   E     RK  ++  AY C E A  + KPG   + V + +   A+  NC V+     +G+ +
Sbjct:  167 CTSVNEVICHGIPD--LRPLEDGDILNIDITVYYNGFHGDLNETIYIGKVDE---ASRK--LVRTAYECLEKATEMIKPGTRYRDVGDVITKHATVNNCSVVRTYCGHGIHR 271          
BLAST of DNA-binding protein vs. Planmine SMEST
Match: SMESG000063809.1 (SMESG000063809.1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.021e-7
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  318 CISKNNIVSNFCPEQSTETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEK 653
            C S N ++ +  P+      EDGD++ ID+ VY +G+      T  IG   E     RK  ++  AY C E A  + KPG   + V + +   A+  NC V+     +G+ +
Sbjct:  182 CTSVNEVICHGIPD--LRPLEDGDILNIDITVYYNGFHGDLNETIYIGKVDE---ASRK--LVRTAYECLEKATEMIKPGTRYRDVGDVITKHATVNNCSVVRTYCGHGIHR 286          
BLAST of DNA-binding protein vs. Planmine SMEST
Match: SMESG000007051.1 (SMESG000007051.1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.294e-7
Identity = 67/326 (20.55%), Postives = 138/326 (42.33%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK-IGVLE-CAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            S  E + N++  E I   ++  AE+ ++  K +    +P + ++E+C   +       ++    E+ +  G A+PT  S N++ +++ P    T   +  D+ KID GV+++G  +    T      K +K+     D        A   +RL   G+  +   E   +      +  K + N   + +        KT  I     +K  E    E N+ + I+   STG   V++ +++ + + +        L+L  S+   + +   F    F  R    + + + IG L+   + GL++ +P + +  G + A ++ TVL+
Sbjct:   97 SSEEAKANDIIHEEIYKNFREGAEVHRQTRKYIKEWIKPNMTMIEICEELEK-----TSRTLIHERGLDAGLAFPTGCSLNHVAAHYTPNAGDTTVLKYDDVCKIDFGVHVNGRIIDCAFTLTFNE-KYDKLVEAVKDATNTGLREAGIDVRLCDIGEAIQETMESYEVELDGKTYKVKPIRNLNGHSIGPYQIHAGKTVPI-----VKGGEATKMEENEYYAIETFGSTGKGFVRD-DMECSHYMKNFDAGHVPLRLARSKALLNTINKNFGTLAFCRRWLDRLGEERYIGALKNLTETGLVDPYPPLCDIKGCYTAQWEHTVLL 410          
BLAST of DNA-binding protein vs. Planmine SMEST
Match: SMESG000007051.1 (SMESG000007051.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.473e-7
Identity = 67/326 (20.55%), Postives = 138/326 (42.33%), Query Frame = 3
Query:   90 SETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEMCNFGDSRINXXXXXXXXXXXXXXXGCAYPTCISKNNIVSNFCPEQS-TETFEDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCAEAALRLFKPGKDSKGVTEP--LVNTASDFNCKVLENCVAYGMEKNIYENEKTFMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCIADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAK-IGVLE-CAKHGLMESFPIMYEKDGEFVAHFKFTVLM 1052
            S  E + N++  E I   ++  AE+ ++  K +    +P + ++E+C   +       ++    E+ +  G A+PT  S N++ +++ P    T   +  D+ KID GV+++G  +    T      K +K+     D        A   +RL   G+  +   E   +      +  K + N   + +        KT  I     +K  E    E N+ + I+   STG   V++ +++ + + +        L+L  S+   + +   F    F  R    + + + IG L+   + GL++ +P + +  G + A ++ TVL+
Sbjct:  100 SSEEAKANDIIHEEIYKNFREGAEVHRQTRKYIKEWIKPNMTMIEICEELEK-----TSRTLIHERGLDAGLAFPTGCSLNHVAAHYTPNAGDTTVLKYDDVCKIDFGVHVNGRIIDCAFTLTFNE-KYDKLVEAVKDATNTGLREAGIDVRLCDIGEAIQETMESYEVELDGKTYKVKPIRNLNGHSIGPYQIHAGKTVPI-----VKGGEATKMEENEYYAIETFGSTGKGFVRD-DMECSHYMKNFDAGHVPLRLARSKALLNTINKNFGTLAFCRRWLDRLGEERYIGALKNLTETGLVDPYPPLCDIKGCYTAQWEHTVLL 413          
The following BLAST results are available for this feature:
BLAST of DNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PA2G41.515e-10146.93proliferation-associated 2G4 [Source:HGNC Symbol;A... [more]
PA2G42.599e-6044.12proliferation-associated 2G4 [Source:HGNC Symbol;A... [more]
PA2G45.383e-3245.98proliferation-associated 2G4 [Source:HGNC Symbol;A... [more]
AC034102.26.380e-3050.31novel protein[more]
METAP27.185e-920.70methionyl aminopeptidase 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W08E12.74.726e-8239.66pep chromosome:WBcel235:IV:3295139:3297225:1 gene:... [more]
W08E12.74.726e-8239.66pep chromosome:WBcel235:IV:3295135:3297225:1 gene:... [more]
map-21.075e-921.18Methionine aminopeptidase 2 [Source:UniProtKB/TrE... [more]
map-21.075e-921.18Methionine aminopeptidase 2 [Source:UniProtKB/TrE... [more]
map-21.075e-921.18Methionine aminopeptidase 2 [Source:UniProtKB/TrE... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG105761.457e-8942.70gene:FBgn0035630 transcript:FBtr0345606[more]
CG105761.457e-8942.70gene:FBgn0035630 transcript:FBtr0077121[more]
CG105761.457e-8942.70gene:FBgn0035630 transcript:FBtr0345901[more]
back to top
BLAST of DNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pa2g4b7.484e-10947.37proliferation-associated 2G4, b [Source:ZFIN;Acc:Z... [more]
pa2g4b6.250e-10747.21proliferation-associated 2G4, b [Source:ZFIN;Acc:Z... [more]
pa2g4a1.217e-10546.54proliferation-associated 2G4, a [Source:ZFIN;Acc:Z... [more]
pa2g4b8.408e-5348.29proliferation-associated 2G4, b [Source:ZFIN;Acc:Z... [more]
metap2a1.037e-820.55methionyl aminopeptidase 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pa2g42.349e-10747.37proliferation-associated 2G4 [Source:NCBI gene;Acc... [more]
pa2g46.056e-10547.32proliferation-associated 2G4 [Source:NCBI gene;Acc... [more]
pa2g47.597e-10146.47proliferation-associated 2G4 [Source:NCBI gene;Acc... [more]
snrnp401.998e-820.38small nuclear ribonucleoprotein, U5 40kDa subunit ... [more]
snrnp402.186e-820.70small nuclear ribonucleoprotein, U5 40kDa subunit ... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pa2g44.173e-10347.62proliferation-associated 2G4 [Source:MGI Symbol;Ac... [more]
Pa2g44.173e-10347.62proliferation-associated 2G4 [Source:MGI Symbol;Ac... [more]
Metap24.505e-921.02methionine aminopeptidase 2 [Source:MGI Symbol;Acc... [more]
Metap24.505e-921.02methionine aminopeptidase 2 [Source:MGI Symbol;Acc... [more]
Metap24.915e-921.02methionine aminopeptidase 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of DNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYD3|PA2G4_RAT2.919e-10247.62Proliferation-associated protein 2G4 OS=Rattus nor... [more]
sp|P50580|PA2G4_MOUSE2.919e-10247.62Proliferation-associated protein 2G4 OS=Mus muscul... [more]
sp|Q9UQ80|PA2G4_HUMAN7.273e-10146.93Proliferation-associated protein 2G4 OS=Homo sapie... [more]
sp|M1CZC0|EBP1_SOLTU7.075e-8240.55ERBB-3 BINDING PROTEIN 1 OS=Solanum tuberosum OX=4... [more]
sp|Q96327|EBP1_ARATH1.832e-7741.06ERBB-3 BINDING PROTEIN 1 OS=Arabidopsis thaliana O... [more]
back to top
BLAST of DNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D7005.277e-12250.81Proliferation-associated protein OS=Schistosoma ja... [more]
C1LJB65.393e-12250.81Proliferation-associated protein 2G4 OS=Schistosom... [more]
C7TZT21.384e-12151.09Proliferation-associated protein 2G4 (Fragment) OS... [more]
Q5BYW12.228e-12151.09SJCHGC05984 protein (Fragment) OS=Schistosoma japo... [more]
A0A2H1C3W93.804e-11949.32DNA-binding protein OS=Fasciola hepatica OX=6192 G... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018643.29.899e-10946.54proliferation-associated protein 2G4-like [Source:... [more]
pa2g4a5.237e-10746.26proliferation-associated protein 2G4 [Source:NCBI ... [more]
metap2b9.839e-1020.48methionyl aminopeptidase 2b [Source:ZFIN;Acc:ZDB-G... [more]
metap2a1.398e-920.55methionine aminopeptidase 2 [Source:NCBI gene;Acc:... [more]
metap1d1.550e-623.24methionyl aminopeptidase type 1D, mitochondrial [S... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pa2g4b7.644e-10447.43proliferation-associated 2G4, b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ARX13.694e-1228.39Nuclear export factor for the ribosomal pre-60S su... [more]
MAP21.945e-1120.29Methionine aminopeptidase; catalyzes the cotransla... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO357301.297e-10647.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pa2g4b3.987e-10847.65proliferation-associated protein 2G4-like [Source:... [more]
pa2g4a4.520e-10345.40proliferation-associated 2G4 [Source:NCBI gene;Acc... [more]
pa2g4a1.406e-9141.29proliferation-associated 2G4 [Source:NCBI gene;Acc... [more]
metap2b1.013e-720.91methionyl aminopeptidase 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000045745.14.162e-718.73methionine aminopeptidase 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of DNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070983.10.000e+098.92SMESG000070983.1[more]
SMESG000063809.19.138e-829.46SMESG000063809.1[more]
SMESG000063809.11.021e-729.46SMESG000063809.1[more]
SMESG000007051.11.294e-720.55SMESG000007051.1[more]
SMESG000007051.11.473e-720.55SMESG000007051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021711 ID=SMED30021711|Name=DNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1282bp
ATGAGCAATAGAGAAACATTTGTTTAAATTAGAAATACTTCCACAACTTT
TAAAATTTACTGCGTTTTTATTTAATAATGTCTAGCGATAGTGAAACAGA
GGTGGAAGTTAACAACTTAGAAGATGAAACAATTGTTAACAAGTATAAAA
TGGCAGCCGAAATTGTCCAGAAAATATTAAAAGAATTAATTACAAAATGT
CAACCTGGAGTAAATATTTTAGAAATGTGCAATTTTGGAGATTCTAGAAT
TAATGAAGAAGCAGCTAAAATTTTCAAAAAGGAAAAAGAAATGAAAAAAG
GTTGTGCTTATCCTACATGTATAAGTAAAAACAACATAGTTTCTAATTTC
TGCCCGGAACAATCCACTGAAACATTTGAAGATGGAGACTTAGTAAAAAT
AGATTTGGGTGTATATATTGATGGTTACGCTGTCGTAGCTGGACATACAT
ACGTTATCGGAGCTACGAAAGAAAATAAAGTAACTGGGCGTAAAGCTGAC
GTTATCTTAGCCGCTTATAATTGTGCAGAAGCTGCTCTGAGACTTTTTAA
ACCAGGTAAAGACAGTAAAGGAGTTACAGAACCTCTTGTTAATACAGCCT
CGGATTTTAATTGCAAAGTTTTGGAAAATTGTGTAGCTTACGGAATGGAA
AAAAATATTTATGAAAATGAAAAGACTTTTATGATTAATCCATCAGAAGA
TTTAAAAAAAAGCGAAAAAGTTGATTTCGAGGTTAACCAAGTTTGGACTA
TTGATATCGCAGTTTCAACGGGTGACGCAAAAGTTAAAGAGAGAGAAATT
AAATCTACTGTTTTCAAAAGATGCATAGCAGATAAGAAATATCAGTTAAA
ACTGAAAGCTTCTCGACAATTCTATAGTGATGTTTGCAATAAGTTTTTGA
ATTATCCATTTACCCTAAGATCATTTCACGATGTAACAAAAGCTAAAATC
GGAGTGTTAGAATGCGCTAAACATGGTCTAATGGAATCTTTTCCTATAAT
GTATGAGAAAGATGGGGAATTTGTTGCTCATTTTAAATTTACCGTTCTTA
TGATGGCTAATGGACCAATGAAATTAACCGGGCTTGCTTTTGAACCAAGT
CTCTATCAATCCACCTTGAAAATTCAAAATTCTGCTGTTAAGAGTCTTTT
ATCAGAACCTGTGAAAACTAAAAAGAAAGTAGCTGAAACTAATTAGGCTG
TACGTCTGTTTAAATAAATTATATGGCGCGCGGTTTTTGAATTTTGCACT
TTATTTATTTGTCCTAATATAGATTATCATAG
back to top

protein sequence of SMED30021711-orf-1

>SMED30021711-orf-1 ID=SMED30021711-orf-1|Name=SMED30021711-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
MSSDSETEVEVNNLEDETIVNKYKMAAEIVQKILKELITKCQPGVNILEM
CNFGDSRINEEAAKIFKKEKEMKKGCAYPTCISKNNIVSNFCPEQSTETF
EDGDLVKIDLGVYIDGYAVVAGHTYVIGATKENKVTGRKADVILAAYNCA
EAALRLFKPGKDSKGVTEPLVNTASDFNCKVLENCVAYGMEKNIYENEKT
FMINPSEDLKKSEKVDFEVNQVWTIDIAVSTGDAKVKEREIKSTVFKRCI
ADKKYQLKLKASRQFYSDVCNKFLNYPFTLRSFHDVTKAKIGVLECAKHG
LMESFPIMYEKDGEFVAHFKFTVLMMANGPMKLTGLAFEPSLYQSTLKIQ
NSAVKSLLSEPVKTKKKVAETN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036005Creatinase/aminopeptidase-like
IPR036390WH_DNA-bd_sf
IPR000994Pept_M24
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0031625ubiquitin protein ligase binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0016020membrane
GO:0030529intracellular ribonucleoprotein complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006364rRNA processing
GO:0006417regulation of translation
GO:0043066negative regulation of apoptotic process
GO:0045597positive regulation of cell differentiation
GO:0045892negative regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000994Peptidase M24PFAMPF00557Peptidase_M24coord: 22..227
e-value: 1.9E-15
score: 57.1
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 244..306
e-value: 5.6E-118
score: 395.6
IPR036005Creatinase/aminopeptidase-likeGENE3DG3DSA:3.90.230.10coord: 20..350
e-value: 5.6E-118
score: 395.6
IPR036005Creatinase/aminopeptidase-likeSUPERFAMILYSSF55920Creatinase/aminopeptidasecoord: 9..336
NoneNo IPR availablePANTHERPTHR10804PROTEASE FAMILY M24 METHIONYL AMINOPEPTIDASE, AMINOPEPTIDASE Pcoord: 6..367
NoneNo IPR availablePANTHERPTHR10804:SF11PROLIFERATION-ASSOCIATED PROTEIN 2G4coord: 6..367
NoneNo IPR availableCDDcd01089PA2G4-likecoord: 20..335
e-value: 4.4788E-80
score: 243.007
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 240..311