C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30021702
Length (bp)1066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30021702) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30021702) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30021702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30021702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021702h1SMcG0012769 SmedASXL_000733SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021702h1SMcG0012769 SmedASXL_000643SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021702h1SMcG0012769 dd_Smed_v4_15473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021702h1SMcG0012769 dd_Smed_v4_15473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021702h1SMcG0012769 dd_Smed_v4_15473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30021702h1SMcG0012769 dd_Smed_v4_15473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021702h1SMcG0012769 dd_Smed_v4_23203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021702h1SMcG0012769 dd_Smed_v4_23203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30021702h1SMcG0012769 dd_Smed_v4_23203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021702h1SMcG0012769 dd_Smed_v6_23203_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021702h1SMcG0012769 dd_Smed_v6_15473_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 58.9214 bits (141), Expect = 5.264e-9
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSP 936
            K ++CR C ++F+R      H R HTG KP+ CE C  KF R +++KRH +     ++   E   GG  S S++P
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAE--KGGAPSASSAP 375          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZBTB37 (zinc finger and BTB domain containing 37 [Source:HGNC Symbol;Acc:HGNC:28365])

HSP 1 Score: 58.5362 bits (140), Expect = 9.032e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  375 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 425          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZBTB37 (zinc finger and BTB domain containing 37 [Source:HGNC Symbol;Acc:HGNC:28365])

HSP 1 Score: 58.5362 bits (140), Expect = 9.032e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  375 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 425          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 57.3806 bits (137), Expect = 1.202e-8
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSP 936
            K ++CR C ++F+R      H R HTG KP+ CE C  KF R +++KRH +     ++   E   GG  S S++P
Sbjct:  265 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAE--KGGAPSASSAP 337          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZNF420 (zinc finger protein 420 [Source:HGNC Symbol;Acc:HGNC:20649])

HSP 1 Score: 53.1434 bits (126), Expect = 1.271e-8
Identity = 24/56 (42.86%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            K Y+C+ C K FNR     RH+R+HTG KPY C+ C   F R  +  +H R   +G
Sbjct:   26 KPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTAG 81          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: klu-1 (KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O46016])

HSP 1 Score: 61.6178 bits (148), Expect = 2.879e-10
Identity = 28/58 (48.28%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +SK++KC  C K+F+R     RH RLHTG KPY+C  CN  F R +    H+R TH+G
Sbjct:  365 ASKVHKCNMCSKSFSRSDMLTRHMRLHTGAKPYSCPTCNQVFSRSDHLSTHLR-THTG 421          

HSP 2 Score: 47.7506 bits (112), Expect = 8.903e-6
Identity = 26/62 (41.94%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSST 894
            +K Y C  C + F+R      H R HTG KPY C +CN    R +   RH+R THS  D S+
Sbjct:  394 AKPYSCPTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMR-THSLTDDSS 454          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 57.3806 bits (137), Expect = 6.560e-9
Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSS 891
            K ++CR C + F+R      H R HTG KP++C+IC  KF R +++KRH +   + R  S
Sbjct:  402 KPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVHKTSRSGS 461          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 54.6842 bits (130), Expect = 2.544e-8
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVR 864
            K ++CR C + F+R      H R HTG KPY+C+IC  KF R +++ RH +
Sbjct:  206 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 256          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.610e-8
Identity = 28/82 (34.15%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDS--------STELNNGGYLSRSNS 933
            K +KC  C K F++      H R HTG KP+ C++C   F R  D++RH  S H G           S++L+  GY++   S
Sbjct:  208 KPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEECVSASQISSDLSPKGYMTPPTS 289          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 53.9138 bits (128), Expect = 5.048e-8
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVR 864
            K ++CR C + F+R      H R HTG KPY+C+IC  KF R +++ RH +
Sbjct:  206 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 256          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: rn (gene:FBgn0267337 transcript:FBtr0299639)

HSP 1 Score: 61.6178 bits (148), Expect = 5.619e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  495 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 550          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: rn (gene:FBgn0267337 transcript:FBtr0330140)

HSP 1 Score: 61.6178 bits (148), Expect = 5.661e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  514 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 569          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: rn (gene:FBgn0267337 transcript:FBtr0300518)

HSP 1 Score: 61.6178 bits (148), Expect = 5.753e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  514 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 569          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: rn (gene:FBgn0267337 transcript:FBtr0299637)

HSP 1 Score: 61.2326 bits (147), Expect = 7.060e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  260 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 315          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG7987 (gene:FBgn0038244 transcript:FBtr0082979)

HSP 1 Score: 61.2326 bits (147), Expect = 7.844e-10
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRD 885
            + Y CRYC K F       +HER+HTG KPY C +C   F +    + H+RS HSG D
Sbjct:  644 RPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLD 701          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:ZFIN;Acc:ZDB-GENE-050208-621])

HSP 1 Score: 62.3882 bits (150), Expect = 2.688e-10
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C IC  K+ R +  + H+R  H+G
Sbjct:  381 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRK-HTG 431          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:ZFIN;Acc:ZDB-GENE-050208-621])

HSP 1 Score: 62.3882 bits (150), Expect = 2.688e-10
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C IC  K+ R +  + H+R  H+G
Sbjct:  381 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRK-HTG 431          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:ZFIN;Acc:ZDB-GENE-050208-621])

HSP 1 Score: 62.3882 bits (150), Expect = 2.688e-10
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C IC  K+ R +  + H+R  H+G
Sbjct:  381 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRK-HTG 431          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: zgc:173486 (zgc:173486 [Source:ZFIN;Acc:ZDB-GENE-080305-13])

HSP 1 Score: 58.151 bits (139), Expect = 3.872e-10
Identity = 29/53 (54.72%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHS 876
            YKC +C KTFN     + HER+HTG KPYTC  C   FIR  D+ RH+  THS
Sbjct:   42 YKCSHCGKTFNDSGSLKAHERIHTGEKPYTCTQCGKSFIRSSDRNRHM-MTHS 93          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: CU570894.2 (pep chromosome:GRCz11:22:2492397:2650505:1 gene:ENSDARG00000116814.1 transcript:ENSDART00000181596.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU570894.2)

HSP 1 Score: 58.151 bits (139), Expect = 1.861e-9
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNS 933
            K Y+C +C K F    C +RHER+HTG KPY C  C+ +F   E +K+H R TH+G    T    G   ++S+S
Sbjct:  142 KPYQCSHCDKRFGLPECLKRHERIHTGEKPYKCSHCDKRFHWSESRKKHER-THTGEKPYTCTQCGKSFTQSSS 214          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ZNF281 (zinc finger protein 281 [Source:NCBI gene;Acc:733827])

HSP 1 Score: 58.5362 bits (140), Expect = 8.780e-9
Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGR 882
            ++C  C  +F +K+  +RHE++H+G KP+ C+ CN KFI+    +RH R THSG 
Sbjct:  152 FQCSQCNMSFIQKYLLQRHEKIHSGEKPFNCDQCNMKFIQKYHMERHKR-THSGE 205          

HSP 2 Score: 48.9062 bits (115), Expect = 9.446e-6
Identity = 20/52 (38.46%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRS 867
            K + C  C   F +K+  ERH+R H+G KPY C+ C   F R +   +H R+
Sbjct:  178 KPFNCDQCNMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHKRT 229          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ZNF281 (zinc finger protein 281 [Source:NCBI gene;Acc:733827])

HSP 1 Score: 58.5362 bits (140), Expect = 9.603e-9
Identity = 24/54 (44.44%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            ++C  C  +F +K+  +RHE++H+G KP+ C+ CN KFI+    +RH R THSG
Sbjct:  194 FQCSQCNMSFIQKYLLQRHEKIHSGEKPFNCDQCNMKFIQKYHMERHKR-THSG 246          

HSP 2 Score: 48.9062 bits (115), Expect = 9.588e-6
Identity = 20/52 (38.46%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRS 867
            K + C  C   F +K+  ERH+R H+G KPY C+ C   F R +   +H R+
Sbjct:  220 KPFNCDQCNMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHKRT 271          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: zbtb8a (zinc finger and BTB domain containing 8A, gene 1 [Source:NCBI gene;Acc:100144694])

HSP 1 Score: 57.7658 bits (138), Expect = 1.078e-8
Identity = 25/56 (44.64%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
            SS  +KC +C  T  RK   +RH R HTG +PY CE C  +F RLE  + H ++ H
Sbjct:  312 SSGRFKCPFCTHTVKRKADLKRHLRCHTGERPYPCEACGKRFTRLEHLRNHFQTIH 367          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 57.7658 bits (138), Expect = 1.122e-8
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVR 864
            K ++CR C + F+R      H R HTG KP+ C+IC  KF R +++KRH +
Sbjct:  335 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 385          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: dock2 (dedicator of cytokinesis 2 [Source:Xenbase;Acc:XB-GENE-990617])

HSP 1 Score: 57.7658 bits (138), Expect = 1.181e-8
Identity = 22/48 (45.83%), Postives = 30/48 (62.50%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRS 867
            C YC KTFN+K   +RH RLH GI P+ C+ C  K+ R +  + H+R 
Sbjct:  368 CIYCGKTFNQKGSLDRHMRLHMGITPFVCKYCGKKYTRKDQLEYHIRG 415          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 59.3066 bits (142), Expect = 2.809e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSP 936
            K ++CR C ++F+R      H R HTG KP+ CE C  KF R +++KRH +     ++  +E   GG  S S++P
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKSE--KGGAPSASSAP 375          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zbtb37 (zinc finger and BTB domain containing 37 [Source:MGI Symbol;Acc:MGI:2444467])

HSP 1 Score: 58.5362 bits (140), Expect = 5.056e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  377 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 427          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zbtb37 (zinc finger and BTB domain containing 37 [Source:MGI Symbol;Acc:MGI:2444467])

HSP 1 Score: 58.5362 bits (140), Expect = 5.056e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  377 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 427          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zbtb37 (zinc finger and BTB domain containing 37 [Source:MGI Symbol;Acc:MGI:2444467])

HSP 1 Score: 58.5362 bits (140), Expect = 5.056e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  377 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 427          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zbtb37 (zinc finger and BTB domain containing 37 [Source:MGI Symbol;Acc:MGI:2444467])

HSP 1 Score: 58.5362 bits (140), Expect = 5.056e-9
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YC K+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  377 CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 427          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P53243|YG2A_YEAST (Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR067C PE=4 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 2.856e-10
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  697 QAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
             A   K Y C +C K F+R   + RHER H G+KP+ C++C   F+R +  +RH+R+ H
Sbjct:    1 MAAGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VI93|RN_DROME (Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 5.767e-9
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  514 AKPYKCTQCSKAFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 569          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q09838|PRZ1_SCHPO (Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 5.829e-9
Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRS 867
            + ++C  C K+F R+  + RHE+LHTGIK + C  CN +F R++   RH +S
Sbjct:  598 RPFQCSICKKSFARQHDKRRHEQLHTGIKAFACVTCNQRFARMDALNRHYKS 649          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q293Q2|SQZ_DROPS (Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=sqz PE=3 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 7.348e-9
Identity = 28/57 (49.12%), Postives = 36/57 (63.16%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            SK YKC  C K+F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  179 SKPYKCASCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 234          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VDZ3|SQZ_DROME (Zinc finger protein squeeze OS=Drosophila melanogaster OX=7227 GN=sqz PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 1.387e-8
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            +K YKC  C K+F       +H R+H GIKPY CEIC  KF +L   ++H+R TH+G
Sbjct:  155 AKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIR-THTG 210          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A3P7KZK9 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS5765 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.735e-29
Identity = 54/86 (62.79%), Postives = 69/86 (80.23%), Query Frame = 1
Query:  709 SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRST-HSGRDSSTELNNGGYLSRSNSPENPSTKI*L 963
            SK+YKCRYC K+FNRKFCRERHERLHTG+KPYTCE+C++KFIRLEDKKRHVRS  H+ R ++    NG   + + S + PS+++ L
Sbjct:  268 SKVYKCRYCGKSFNRKFCRERHERLHTGVKPYTCEVCDEKFIRLEDKKRHVRSILHTTRTAALACANGKIKTAAPSADPPSSELDL 353          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: W6UWM2 (Zinc finger protein OS=Echinococcus granulosus OX=6210 GN=EGR_00315 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.970e-29
Identity = 57/83 (68.67%), Postives = 67/83 (80.72%), Query Frame = 1
Query:  652 STITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRST-HSGRDSSTE 897
            STIT++ +SV       H  K+YKCRYC KTFNRKFCRERHERLHTG+KPYTCEICN+KFIRLEDKKRHVRS  H+ R ++ +
Sbjct:  409 STITSAMESV-------H--KVYKCRYCGKTFNRKFCRERHERLHTGVKPYTCEICNEKFIRLEDKKRHVRSILHTSRVAAAQ 482          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A183SJP4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS4442 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.045e-28
Identity = 55/89 (61.80%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  694 VQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRST-HSGRDSSTELNNGGYLSRSNSPENPSTKI 957
            + A  SK+YKCRYC K+FNRKFCRERHERLHTG+KPYTCE+C++KFIRLEDKKRHVRS  H+ R ++    NG   + + S + PS++I
Sbjct:  772 IDAVHSKVYKCRYCGKSFNRKFCRERHERLHTGVKPYTCEVCDEKFIRLEDKKRHVRSILHTTRTAALACANGKIKTATPSADPPSSEI 860          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A068Y6Q1 (Zinc finger protein YGR067C OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000778700 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.851e-28
Identity = 57/83 (68.67%), Postives = 67/83 (80.72%), Query Frame = 1
Query:  652 STITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRST-HSGRDSSTE 897
            STIT++ +SV       H  K+YKCRYC KTFNRKFCRERHERLHTG+KPYTCEICN+KFIRLEDKKRHVRS  H+ R ++ +
Sbjct:  662 STITSAMESV-------H--KVYKCRYCGKTFNRKFCRERHERLHTGVKPYTCEICNEKFIRLEDKKRHVRSILHTSRVAAAQ 735          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A0R3X231 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7305 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.158e-28
Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 1
Query:  652 STITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRST-HSGRDSSTE 897
            STIT++ +SV          K+YKCRYC KTFNRKFCRERHERLHTG+KPYTCEICN+KFIRLEDKKRHVRS  H+ R ++ +
Sbjct:  662 STITSAMESV---------HKVYKCRYCGKTFNRKFCRERHERLHTGVKPYTCEICNEKFIRLEDKKRHVRSILHTSRVAAAQ 735          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:NCBI gene;Acc:103038435])

HSP 1 Score: 62.003 bits (149), Expect = 3.607e-10
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  389 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 439          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:NCBI gene;Acc:103038435])

HSP 1 Score: 62.003 bits (149), Expect = 3.779e-10
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C +C  K+ R +  + H+R  H+G
Sbjct:  389 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHIRK-HTG 439          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029763.1 (zinc finger protein 70-like [Source:NCBI gene;Acc:103046447])

HSP 1 Score: 60.4622 bits (145), Expect = 8.402e-10
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
              + Y CRYC KTFN+K   + HER+HTG K Y+C +C  +F  L   K H+R  H
Sbjct:  288 GERPYHCRYCGKTFNQKGHVKGHERIHTGEKIYSCSVCGKRFTWLGQGKEHLRIHH 343          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: wt1a (WT1 transcription factor [Source:NCBI gene;Acc:103045853])

HSP 1 Score: 58.5362 bits (140), Expect = 3.544e-9
Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 1
Query:  694 VQAHS-----SKLYKCRY--CCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELN 903
            +Q HS      K Y+C Y  C + F+R    +RH+R HTG+KP+ CE C  KF R +  K H R TH+G+ S    N
Sbjct:  306 LQMHSRKHTGEKPYQCDYTDCGRRFSRSDQLKRHQRRHTGVKPFQCETCQRKFSRSDHLKTHTR-THTGKTSEKPFN 381          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: wt1a (WT1 transcription factor [Source:NCBI gene;Acc:103045853])

HSP 1 Score: 58.151 bits (139), Expect = 4.572e-9
Identity = 29/66 (43.94%), Postives = 39/66 (59.09%), Query Frame = 1
Query:  712 KLYKCRY--CCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELN 903
            K Y+C Y  C + F+R    +RH+R HTG+KP+ CE C  KF R +  K H R TH+G+ S    N
Sbjct:  289 KPYQCDYTDCGRRFSRSDQLKRHQRRHTGVKPFQCETCQRKFSRSDHLKTHTR-THTGKTSEKPFN 353          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005004.1 (pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 gene:ENSPMAG00000004537.1 transcript:ENSPMAT00000005004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 7.017e-10
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K Y+C  C   F +K+  +RHE++H+G KP+TCE C  +FI+    +RH R THSG
Sbjct:   30 GEKAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKR-THSG 86          

HSP 2 Score: 51.9878 bits (123), Expect = 1.177e-7
Identity = 21/58 (36.21%), Postives = 31/58 (53.45%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K + C  C   F +K+  ERH+R H+G KPY C+ C+  + R +   +H R  H G
Sbjct:   58 GEKPFTCEQCGMRFIQKYHLERHKRTHSGEKPYECDYCHQYYSRTDQLAKHKRMCHEG 115          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 55.0694 bits (131), Expect = 6.439e-9
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRD 885
            K + CR C ++F+R      H R HTG KP+ C+ C  +F R +++KRH R    GRD
Sbjct:  200 KPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIHLKGRD 257          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: zbtb46 (zinc finger and BTB domain containing 46 [Source:ZFIN;Acc:ZDB-GENE-090313-352])

HSP 1 Score: 52.373 bits (124), Expect = 7.296e-8
Identity = 33/97 (34.02%), Postives = 47/97 (48.45%), Query Frame = 1
Query:  592 VISND---SNVTTTSTQNALRAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
            VISND   +NV     QN++          ++VP +       +L +C YC     RK+   RH R HTG +P+ C+ C  +FIR E  +R  R  H
Sbjct:  282 VISNDKGINNVWFGRQQNSIV---------KAVPGK------RRLLQCNYCNFAAMRKYKLVRHIRTHTGERPFGCDACGKRFIRREHLQRRGRQVH 363          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.077e-7
Identity = 21/55 (38.18%), Postives = 27/55 (49.09%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGR 882
            Y C  C + F +K     H RLHTG +PY C  C  +F +     RH+RS    R
Sbjct:   50 YACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLRSAAHAR 104          

HSP 2 Score: 45.8246 bits (107), Expect = 7.256e-7
Identity = 21/54 (38.89%), Postives = 27/54 (50.00%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            Y C  C + F R    ERH R+HTG +PY C  C  +F +      H R  H+G
Sbjct:   22 YACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTR-LHTG 74          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: zbtb46 (zinc finger and BTB domain containing 46 [Source:ZFIN;Acc:ZDB-GENE-090313-352])

HSP 1 Score: 50.8322 bits (120), Expect = 2.148e-7
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  592 VISNDSNVTTTSTQNALRAISTITTSRQSVPSQVV--------QAHSS------KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
            ++S+  N T + T+   R+IST+  S   +   ++        +A+SS      +L +C YC     RK+   RH R HTG +P+ C+ C  +FIR E  +R  R  H
Sbjct:  282 LMSSGPNRTGSLTRLETRSISTLVRSEGVMSYLMIKESDNPRTEANSSLYVRKRRLLQCNYCNFAAMRKYKLVRHIRTHTGERPFGCDACGKRFIRREHLQRRGRQVH 389          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: YGR067C_mRNA (Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p [Source:SGD;Acc:S000003299])

HSP 1 Score: 65.4698 bits (158), Expect = 4.113e-12
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  697 QAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTH 873
             A   K Y C +C K F+R   + RHER H G+KP+ C++C   F+R +  +RH+R+ H
Sbjct:    1 MAAGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 56.6102 bits (135), Expect = 3.092e-9
Identity = 25/57 (43.86%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  694 VQAH-SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHV 861
            V++H   K + C YC K F +      HERLHTG KPY+C+IC+ KF R  +   H+
Sbjct:  612 VRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 51.6026 bits (122), Expect = 1.042e-7
Identity = 21/55 (38.18%), Postives = 29/55 (52.73%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGR 882
            + C  C K F R +  + H R HT  +P+ C IC   F R  D+KRH    H+G+
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRH-EDLHTGK 622          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 50.8322 bits (120), Expect = 1.442e-7
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEI--CNDKFIRLEDKKRHVRSTHSGR 882
            + ++C  C + F+R   ++RH R HTG KP+ C    C   F R ++ KRH+R TH+G+
Sbjct:   15 RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR-THTGQ 72          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: COM2 (Transcription factor that binds IME1 Upstream Activation Signal (UAS)ru; COM2 transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; may bind the IME1 promoter under all growth conditions to negatively regulate its transcription in the absence of a positive regulator that binds more effectively; repressor activity may depend on phosphorylation by PKA; C. albicans homolog (MNL1) plays a role in adaptation to stress [Source:SGD;Acc:S000000932])

HSP 1 Score: 50.0618 bits (118), Expect = 2.595e-7
Identity = 28/79 (35.44%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  643 RAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHER-LHTGIKPYTCEICNDKFIRLEDKKRHVRSTHS 876
            +   ++  +R   PS +  A  SK + C +C + F R+   +RH R LH   KP+TC ICN  F R ++  +HV+ TH+
Sbjct:  366 KKTGSMQKTRGRKPSLIPDA--SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK-THA 441          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S550])

HSP 1 Score: 51.9878 bits (123), Expect = 1.005e-8
Identity = 23/49 (46.94%), Postives = 30/49 (61.22%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRH 858
            K +KC YC KTF R    + H R HTG +P+ CE+C  KFI   + K+H
Sbjct:   55 KPFKCVYCGKTFARSNVLKAHVRCHTGERPFQCELCGAKFIISHNLKKH 103          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO47720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN2])

HSP 1 Score: 50.8322 bits (120), Expect = 1.599e-8
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  712 KLYKCRY--CCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVR 864
            K Y+C++  C K F R    +RH R+HTG+KPY C +C  +F R + +  H R
Sbjct:   30 KPYQCQWAGCEKQFRRSDEYQRHYRVHTGVKPYPCGLCRKRFKRSDHRLFHYR 82          

HSP 2 Score: 43.8986 bits (102), Expect = 3.655e-6
Identity = 22/58 (37.93%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  718 YKCRY--CCKTFNRKFCRERHERLHTGIKPYTCEI--CNDKFIRLEDKKRHVRSTHSG 879
            Y C +  C K+F  +     H+R+HTG KPY C+   C  +F R ++ +RH R  H+G
Sbjct:    2 YNCDWPGCYKSFRHRSFMVLHKRIHTGEKPYQCQWAGCEKQFRRSDEYQRHYR-VHTG 58          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO31301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA3])

HSP 1 Score: 52.7582 bits (125), Expect = 2.122e-8
Identity = 27/58 (46.55%), Postives = 35/58 (60.34%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K Y C +C K FN+ +  + H R+HTG +PY CE+C   F  L D KRH R TH+G
Sbjct:   12 GGKSYTCEHCGKRFNKSYNLKTHLRVHTGERPYQCEVCGHGFANLGDLKRHSR-THTG 68          

HSP 2 Score: 51.9878 bits (123), Expect = 3.972e-8
Identity = 27/58 (46.55%), Postives = 36/58 (62.07%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K +KC YC K F+     +RH RLHTG KP+ CE C+ +F RL+  K H+R  H+G
Sbjct:   68 GEKPFKCEYCEKVFSDFGSHKRHIRLHTGYKPFKCEQCDREFTRLDSYKNHIR-LHTG 124          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 50.447 bits (119), Expect = 2.218e-8
Identity = 23/67 (34.33%), Postives = 40/67 (59.70%), Query Frame = 1
Query:  667 SRQSVPSQVVQAHS-SKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVR 864
            SR    ++ ++ H+  K ++CR C + F+R      H R HTG KP+ CE C  +F R ++++RH++
Sbjct:   16 SRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMK 82          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO43181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ74])

HSP 1 Score: 50.447 bits (119), Expect = 6.402e-8
Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTE 897
              K ++C  C K F  +   ++HER HTGIKP+TC  C  KF ++ +  +H+R  H  +D+  E
Sbjct:   74 GEKPFQCPICNKKFADQSTVKKHERTHTGIKPFTCPECGLKFTQIGNMNKHLRKKHEAKDALKE 137          

HSP 2 Score: 45.0542 bits (105), Expect = 5.059e-6
Identity = 24/58 (41.38%), Postives = 32/58 (55.17%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K +KC  C + F +    E H+R+HTG KPY CE+C   F      K H+R TH+G
Sbjct:   18 GEKPFKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMR-THTG 74          

HSP 3 Score: 44.669 bits (104), Expect = 7.358e-6
Identity = 25/58 (43.10%), Postives = 31/58 (53.45%), Query Frame = 1
Query:  706 SSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
              K YKC  C + F+     + H R HTG KP+ C ICN KF      K+H R TH+G
Sbjct:   46 GQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHER-THTG 102          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:NCBI gene;Acc:101171237])

HSP 1 Score: 63.1586 bits (152), Expect = 1.510e-10
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C IC  K+ R +  + H+R  H+G
Sbjct:  369 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRK-HTG 419          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: zbtb37 (zinc finger and BTB domain containing 37 [Source:NCBI gene;Acc:101171237])

HSP 1 Score: 62.7734 bits (151), Expect = 1.890e-10
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  724 CRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            C YCCK+FN+K   +RH RLH GI P+ C IC  K+ R +  + H+R  H+G
Sbjct:  370 CIYCCKSFNQKGSLDRHMRLHMGITPFVCRICGKKYTRKDQLEYHIRK-HTG 420          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: zbtb8a (zinc finger and BTB domain containing 8A [Source:NCBI gene;Acc:101158317])

HSP 1 Score: 59.3066 bits (142), Expect = 1.916e-9
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGR 882
            +KC +C  T  RK   +RH R HTG +PY C+ CN +F RLE  + H  + H  R
Sbjct:  285 FKCPFCTHTVKRKADLKRHLRCHTGERPYPCQACNKRFTRLEHLRNHFETIHQAR 339          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: znf148 (zinc finger protein 148 [Source:NCBI gene;Acc:101167003])

HSP 1 Score: 59.6918 bits (143), Expect = 1.997e-9
Identity = 29/80 (36.25%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRD--SSTELNNGGYLSRSNSPENP 945
            K ++C  C   F +K+  ERH+R H+G KPY C+ C+  F R +   +H R  H  R+  SS    + G L  + SP +P
Sbjct:  225 KPFRCDECGMRFIQKYHMERHKRTHSGEKPYQCDYCHQYFSRTDRVLKHRRMCHENRERKSSKAAADVGLLREAGSPGSP 304          

HSP 2 Score: 56.9954 bits (136), Expect = 1.883e-8
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  712 KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            K ++C  C   F +K+  +RHE++HTG KP+ C+ C  +FI+    +RH R THSG
Sbjct:  197 KPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKR-THSG 251          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027299.1 (zinc finger protein 2 [Source:NCBI gene;Acc:101162244])

HSP 1 Score: 59.3066 bits (142), Expect = 1.998e-9
Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  688 QVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            Q V AHS   Y C  C K F R+    RH R HTG KPY+C  C+ KF   +  +RH+R  H+G
Sbjct:  336 QKVAAHSRDGYVCSLCGKAFQRRKILRRHARFHTGEKPYSCSSCSKKFALRKSLRRHLR-FHTG 398          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080376.1 (SMESG000080376.1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 311/311 (100.00%), Query Frame = 1
Query:   25 CDLKIIPKSDRRKSKRPQRNIIESAHDLSEFTIKSKIQKLTFPNINSNKVTIKLEESENQEFVNEDNKEKNDKDTSNSIIISNDHKILPSILALNGISGDNSILTSALMSPSNGLTILSQNAYNILRSVGSLTVAAQSNSIPFLNTCVSLSNNTTQSNVITKNKGLVXXXXXXXXXXXXXXXXXXXXLSVISNDSNVTTTSTQNALRAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSPENPSTKI 957
            CDLKIIPKSDRRKSKRPQRNIIESAHDLSEFTIKSKIQKLTFPNINSNKVTIKLEESENQEFVNEDNKEKNDKDTSNSIIISNDHKILPSILALNGISGDNSILTSALMSPSNGLTILSQNAYNILRSVGSLTVAAQSNSIPFLNTCVSLSNNTTQSNVITKNKGLVISSSNIAAISI+QPISQAANLSVISNDSNVTTTSTQNALRAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSPENPSTKI
Sbjct:  168 CDLKIIPKSDRRKSKRPQRNIIESAHDLSEFTIKSKIQKLTFPNINSNKVTIKLEESENQEFVNEDNKEKNDKDTSNSIIISNDHKILPSILALNGISGDNSILTSALMSPSNGLTILSQNAYNILRSVGSLTVAAQSNSIPFLNTCVSLSNNTTQSNVITKNKGLVISSSNIAAISINQPISQAANLSVISNDSNVTTTSTQNALRAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTELNNGGYLSRSNSPENPSTKI 478          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000071581.1 (SMESG000071581.1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.022e-10
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  718 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHS 876
            YKC  C + F RKFC  RH+R+H   K Y C IC   F  L   KRH+R+TH+
Sbjct:  177 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHA 229          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004840.1 (SMESG000004840.1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.648e-10
Identity = 27/64 (42.19%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  694 VQAHSS-KLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGR 882
            ++ HS  K Y C +C K F R    + H R HTG +P+ CE+C+ KF R ++K RHV++   GR
Sbjct:  234 LRVHSGIKPYTCEFCFKKFARSDHLKTHRRTHTGERPFECEVCHKKFARSDEKSRHVKTHTRGR 297          

HSP 2 Score: 55.8398 bits (133), Expect = 1.605e-8
Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 1
Query:  700 AHSSKLYKCRY--CCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSG 879
            A   K + C Y  C + FNR     RH R+H+GIKPYTCE C  KF R +  K H R TH+G
Sbjct:  207 AKPKKQFICNYESCRRKFNRSDELNRHLRVHSGIKPYTCEFCFKKFARSDHLKTH-RRTHTG 267          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.649e-9
Identity = 29/69 (42.03%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  685 SQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSS 891
            S + +  + K+ KC YC KTF      + H+R+HTG KPY CEIC   F +     RH R+TH  RD++
Sbjct:   76 SPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH-RNTHRYRDAT 143          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.455e-9
Identity = 29/69 (42.03%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  685 SQVVQAHSSKLYKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSS 891
            S + +  + K+ KC YC KTF      + H+R+HTG KPY CEIC   F +     RH R+TH  RD++
Sbjct:   76 SPIEEESTKKILKCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH-RNTHRYRDAT 143          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR35.264e-937.33early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
ZBTB379.032e-944.23zinc finger and BTB domain containing 37 [Source:H... [more]
ZBTB379.032e-944.23zinc finger and BTB domain containing 37 [Source:H... [more]
EGR31.202e-837.33early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4201.271e-842.86zinc finger protein 420 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klu-12.879e-1048.28KLUmpfuss related [Source:UniProtKB/TrEMBL;Acc:O4... [more]
egrh-16.560e-940.00EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-22.544e-843.14EGR (Early Growth factor Response factor) Homolog ... [more]
pag-33.610e-834.15Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
egrh-25.048e-843.14EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rn5.619e-1047.37gene:FBgn0267337 transcript:FBtr0299639[more]
rn5.661e-1047.37gene:FBgn0267337 transcript:FBtr0330140[more]
rn5.753e-1047.37gene:FBgn0267337 transcript:FBtr0300518[more]
rn7.060e-1047.37gene:FBgn0267337 transcript:FBtr0299637[more]
CG79877.844e-1044.83gene:FBgn0038244 transcript:FBtr0082979[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb372.688e-1048.08zinc finger and BTB domain containing 37 [Source:Z... [more]
zbtb372.688e-1048.08zinc finger and BTB domain containing 37 [Source:Z... [more]
zbtb372.688e-1048.08zinc finger and BTB domain containing 37 [Source:Z... [more]
zgc:1734863.872e-1054.72zgc:173486 [Source:ZFIN;Acc:ZDB-GENE-080305-13][more]
CU570894.21.861e-941.89pep chromosome:GRCz11:22:2492397:2650505:1 gene:EN... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF2818.780e-943.64zinc finger protein 281 [Source:NCBI gene;Acc:7338... [more]
ZNF2819.603e-944.44zinc finger protein 281 [Source:NCBI gene;Acc:7338... [more]
zbtb8a1.078e-844.64zinc finger and BTB domain containing 8A, gene 1 [... [more]
egr11.122e-843.14early growth response 1 [Source:NCBI gene;Acc:1000... [more]
dock21.181e-845.83dedicator of cytokinesis 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr32.809e-937.33early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Zbtb375.056e-944.23zinc finger and BTB domain containing 37 [Source:M... [more]
Zbtb375.056e-944.23zinc finger and BTB domain containing 37 [Source:M... [more]
Zbtb375.056e-944.23zinc finger and BTB domain containing 37 [Source:M... [more]
Zbtb375.056e-944.23zinc finger and BTB domain containing 37 [Source:M... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53243|YG2A_YEAST2.856e-1040.68Zinc finger protein YGR067C OS=Saccharomyces cerev... [more]
sp|Q9VI93|RN_DROME5.767e-947.37Zinc finger protein rotund OS=Drosophila melanogas... [more]
sp|Q09838|PRZ1_SCHPO5.829e-942.31Transcriptional regulator prz1 OS=Schizosaccharomy... [more]
sp|Q293Q2|SQZ_DROPS7.348e-949.12Zinc finger protein squeeze OS=Drosophila pseudoob... [more]
sp|Q9VDZ3|SQZ_DROME1.387e-847.37Zinc finger protein squeeze OS=Drosophila melanoga... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7KZK94.735e-2962.79Uncharacterized protein OS=Dibothriocephalus latus... [more]
W6UWM28.970e-2968.67Zinc finger protein OS=Echinococcus granulosus OX=... [more]
A0A183SJP41.045e-2861.80Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A068Y6Q12.851e-2868.67Zinc finger protein YGR067C OS=Echinococcus multil... [more]
A0A0R3X2314.158e-2867.47Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb373.607e-1046.15zinc finger and BTB domain containing 37 [Source:N... [more]
zbtb373.779e-1046.15zinc finger and BTB domain containing 37 [Source:N... [more]
ENSAMXT00000029763.18.402e-1046.43zinc finger protein 70-like [Source:NCBI gene;Acc:... [more]
wt1a3.544e-941.56WT1 transcription factor [Source:NCBI gene;Acc:103... [more]
wt1a4.572e-943.94WT1 transcription factor [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005004.17.017e-1044.83pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 g... [more]
egr46.439e-941.38early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
zbtb467.296e-834.02zinc finger and BTB domain containing 46 [Source:Z... [more]
ENSPMAT00000000923.11.077e-738.18pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
zbtb462.148e-731.48zinc finger and BTB domain containing 46 [Source:Z... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YGR067C_mRNA4.113e-1240.68Putative protein of unknown function; contains a z... [more]
AZF13.092e-943.86Zinc-finger transcription factor; involved in diau... [more]
CRZ11.042e-738.18Transcription factor, activates transcription of s... [more]
MIG21.442e-738.98Zinc finger transcriptional repressor; cooperates ... [more]
COM22.595e-735.44Transcription factor that binds IME1 Upstream Acti... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411411.005e-846.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477201.599e-841.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313012.122e-846.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491122.218e-834.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431816.402e-837.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb371.510e-1048.08zinc finger and BTB domain containing 37 [Source:N... [more]
zbtb371.890e-1048.08zinc finger and BTB domain containing 37 [Source:N... [more]
zbtb8a1.916e-943.64zinc finger and BTB domain containing 8A [Source:N... [more]
znf1481.997e-936.25zinc finger protein 148 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000027299.11.998e-945.31zinc finger protein 2 [Source:NCBI gene;Acc:101162... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080376.10.000e+099.68SMESG000080376.1[more]
SMESG000071581.13.022e-1049.06SMESG000071581.1[more]
SMESG000004840.13.648e-1042.19SMESG000004840.1[more]
SMESG000022366.11.649e-942.03SMESG000022366.1[more]
SMESG000022366.13.455e-942.03SMESG000022366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021702 ID=SMED30021702|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1066bp
AATAATAACAATAATAATAATAACTGTGATTTAAAAATAATCCCCAAAAG
TGACAGACGGAAATCTAAAAGACCTCAAAGAAATATAATTGAAAGCGCAC
ACGATTTATCTGAATTTACAATCAAATCGAAAATTCAGAAATTAACTTTT
CCAAATATCAACTCGAATAAAGTGACGATAAAACTGGAAGAATCAGAAAA
TCAAGAATTTGTTAATGAAGACAACAAAGAGAAAAACGATAAAGATACCT
CAAATTCTATAATAATTAGTAATGACCACAAAATCCTACCAAGCATTCTC
GCTTTAAATGGAATATCTGGAGACAATAGTATTCTCACCTCAGCTTTGAT
GTCTCCGTCGAATGGGTTGACAATTCTAAGTCAAAACGCTTACAACATTC
TTCGATCAGTTGGATCGCTCACAGTCGCTGCACAATCTAATTCAATTCCA
TTTTTGAATACATGCGTCAGCCTGTCAAACAACACCACCCAATCAAACGT
CATTACGAAAAACAAAGGTCTTGTGATATCATCCTCAAACATTGCAGCAA
TTTCCATCAGTCAACCCATATCCCAAGCTGCGAATTTGTCCGTGATCTCG
AATGATTCCAACGTCACAACTACTTCAACCCAAAATGCCCTCAGAGCGAT
CTCAACCATCACTACGTCTCGTCAATCCGTTCCCTCACAAGTCGTTCAGG
CGCACAGTTCTAAACTGTATAAATGCCGATATTGCTGCAAAACATTCAAC
CGGAAATTCTGTCGAGAACGCCATGAAAGATTGCACACGGGAATCAAACC
GTACACCTGTGAGATTTGCAATGACAAATTCATTCGACTCGAAGACAAAA
AGCGCCACGTAAGATCAACTCACAGCGGCCGGGACTCATCGACAGAGCTC
AACAACGGTGGCTACCTATCAAGAAGCAATTCACCGGAAAACCCATCGAC
AAAAATTTAATTGATTTATTTATTTATCGAGAACCGAAAAAAAAGAGAGA
AAACAAACCGAATACTTTTCATTTATTAATTTTTAATTTAATTTCCCGAA
AAAAAACAAACTGAAA
back to top

protein sequence of SMED30021702-orf-1

>SMED30021702-orf-1 ID=SMED30021702-orf-1|Name=SMED30021702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
NNNNNNNNCDLKIIPKSDRRKSKRPQRNIIESAHDLSEFTIKSKIQKLTF
PNINSNKVTIKLEESENQEFVNEDNKEKNDKDTSNSIIISNDHKILPSIL
ALNGISGDNSILTSALMSPSNGLTILSQNAYNILRSVGSLTVAAQSNSIP
FLNTCVSLSNNTTQSNVITKNKGLVISSSNIAAISISQPISQAANLSVIS
NDSNVTTTSTQNALRAISTITTSRQSVPSQVVQAHSSKLYKCRYCCKTFN
RKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHSGRDSSTEL
NNGGYLSRSNSPENPSTKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 268..291
e-value: 0.01
score: 25.0
coord: 240..262
e-value: 5.1
score: 15.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 270..291
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 242..262
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 240..267
score: 13.526
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 268..296
score: 11.074
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 270..300
e-value: 3.3E-6
score: 28.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 238..269
e-value: 1.7E-6
score: 29.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..85
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 294..319
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..83
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 285..319
NoneNo IPR availablePANTHERPTHR16515FAMILY NOT NAMEDcoord: 153..294
NoneNo IPR availablePANTHERPTHR16515:SF38SET (TRITHORAX/POLYCOMB) DOMAIN CONTAININGcoord: 153..294
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 238..288