T-complex protein 1 subunit beta

Overview
NameT-complex protein 1 subunit beta
Smed IDSMED30021699
Length (bp)1727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein 1 subunit beta (SMED30021699) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein 1 subunit beta (SMED30021699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-complex protein 1 subunit beta (SMED30021699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-complex protein 1 subunit beta (SMED30021699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021699SMESG000016726.1 dd_Smed_v4_525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021699SMESG000016726.1 dd_Smed_v4_525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30021699SMESG000016726.1 MF669562.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30021699SMESG000016726.1 MF669562.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30021699SMESG000016726.1 MF669562.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30021699SMESG000016726.1 MF669562.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30021699SMESG000016726.1 MF669562.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
epidermisSMED30021699SMESG000016726.1 dd_Smed_v4_525_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Match: CCT2 (chaperonin containing TCP1 subunit 2 [Source:HGNC Symbol;Acc:HGNC:1615])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 388/530 (73.21%), Postives = 452/530 (85.28%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR++SF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG+   GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Match: CCT2 (chaperonin containing TCP1 subunit 2 [Source:HGNC Symbol;Acc:HGNC:1615])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 354/487 (72.69%), Postives = 413/487 (84.80%), Query Frame = 3
Query:  201 MDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            MDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG+   GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    1 MDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 485          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Match: CCT2 (chaperonin containing TCP1 subunit 2 [Source:HGNC Symbol;Acc:HGNC:1615])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 350/478 (73.22%), Postives = 407/478 (85.15%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVN 1502
            SLAP+ I   GADEERAETAR++SF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG+   GL  V+
Sbjct:    5 SLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLGNVS 482          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Match: CCT2 (chaperonin containing TCP1 subunit 2 [Source:HGNC Symbol;Acc:HGNC:1615])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 305/408 (74.75%), Postives = 348/408 (85.29%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGA 1292
            SLAP+ I   GADEERAETAR++SF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GG A
Sbjct:    5 SLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGVA 412          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Match: CCT7 (chaperonin containing TCP1 subunit 7 [Source:HGNC Symbol;Acc:HGNC:1622])

HSP 1 Score: 311.997 bits (798), Expect = 1.022e-98
Identity = 188/529 (35.54%), Postives = 298/529 (56.33%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELM-NIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLP 1652
            P+ +L  G D  +     +S+      I + V+TTLGP+GMDK+++ G  ++ T++NDGATILK + V +PAAK LV+++K QD EVGDGTTSV +LA+E L++ +  + + LHPQ +I  +R A   A   +K+ A +  +     + +L+   A T LSSK+++Q K  FAK+ VDAV  L     L+ I I K  GG L DS L  G   +K         QPK+  N KI + N  ++  K +   ++I+V TV     + +AE   + +K+EKI   G  V +++  I +   Q F+ + +        E ++R  +  GG I ++ +      LG C + EE  IG +R   F+G    + CT +LRG  +  ++E ERSLHDA+ ++++ +K+   + GGGA EM ++  +   +   PGK+ + I A+++AL  +P  + DN GFD+++++ +LRA+H +G   YG+D+ N  I D  +  + E   V+   LTAA+EAA +IV VD  IK  PR     P
Sbjct:    5 PVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKA-TISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELEL-KAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIK-NPRSTVDAP 530          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 350/525 (66.67%), Postives = 429/525 (81.71%), Query Frame = 3
Query:   75 LAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES---ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQR 1640
            + P+QIL   A EER E+AR+SSFVGAIAIGDLVK+TLGPKGMDKIL+SG  ES   I VTNDGATILKSIGVDNPAAK+LV+MS  QD EVGDGTTSV VLA+ELL+EAE+L++Q++HPQT+ISG+R+A   A  +LK+S+  S        D+L+ IARTTL SKIL+QHK+ FA+LAVDAV RLKGSGNL+ IQIIKKLGG +++SYLDEGFLLEK  G+ QP+R+E AKILIANTPMD DK+KVFGS+++VD V K+AELE AEK KMKEKV+KI  H CNVFINRQLIYNYPEQLF+   +MAIEHADFEG+ERL+LV GG+I STFD P   + G CDLIEEIMIGEDRLL+FSGV +GEAC++VLRGATQ ILDE+ERSLHDALCV+   VK+ +++ G GA+E+LM+ A++  A +  GKEA+A+EAF RAL  LP II DN G DS++LV +LRA+H  G HN G+D+  G++ D+TKLG+ ESY VK  ++++AAEA E I+RVD+IIKAAPR R
Sbjct:    1 MLPVQILKDNAQEERGESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESG---DNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLKGSGNLDAIQIIKKLGGSMNESYLDEGFLLEKLPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSGVKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIKAAPRAR 522          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 350/525 (66.67%), Postives = 429/525 (81.71%), Query Frame = 3
Query:   75 LAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES---ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQR 1640
            + P+QIL   A EER E+AR+SSFVGAIAIGDLVK+TLGPKGMDKIL+SG  ES   I VTNDGATILKSIGVDNPAAK+LV+MS  QD EVGDGTTSV VLA+ELL+EAE+L++Q++HPQT+ISG+R+A   A  +LK+S+  S        D+L+ IARTTL SKIL+QHK+ FA+LAVDAV RLKGSGNL+ IQIIKKLGG +++SYLDEGFLLEK  G+ QP+R+E AKILIANTPMD DK+KVFGS+++VD V K+AELE AEK KMKEKV+KI  H CNVFINRQLIYNYPEQLF+   +MAIEHADFEG+ERL+LV GG+I STFD P   + G CDLIEEIMIGEDRLL+FSGV +GEAC++VLRGATQ ILDE+ERSLHDALCV+   VK+ +++ G GA+E+LM+ A++  A +  GKEA+A+EAF RAL  LP II DN G DS++LV +LRA+H  G HN G+D+  G++ D+TKLG+ ESY VK  ++++AAEA E I+RVD+IIKAAPR R
Sbjct:    1 MLPVQILKDNAQEERGESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESG---DNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLKGSGNLDAIQIIKKLGGSMNESYLDEGFLLEKLPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSGVKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIKAAPRAR 522          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 350/525 (66.67%), Postives = 429/525 (81.71%), Query Frame = 3
Query:   75 LAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES---ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQR 1640
            + P+QIL   A EER E+AR+SSFVGAIAIGDLVK+TLGPKGMDKIL+SG  ES   I VTNDGATILKSIGVDNPAAK+LV+MS  QD EVGDGTTSV VLA+ELL+EAE+L++Q++HPQT+ISG+R+A   A  +LK+S+  S        D+L+ IARTTL SKIL+QHK+ FA+LAVDAV RLKGSGNL+ IQIIKKLGG +++SYLDEGFLLEK  G+ QP+R+E AKILIANTPMD DK+KVFGS+++VD V K+AELE AEK KMKEKV+KI  H CNVFINRQLIYNYPEQLF+   +MAIEHADFEG+ERL+LV GG+I STFD P   + G CDLIEEIMIGEDRLL+FSGV +GEAC++VLRGATQ ILDE+ERSLHDALCV+   VK+ +++ G GA+E+LM+ A++  A +  GKEA+A+EAF RAL  LP II DN G DS++LV +LRA+H  G HN G+D+  G++ D+TKLG+ ESY VK  ++++AAEA E I+RVD+IIKAAPR R
Sbjct:    1 MLPVQILKDNAQEERGESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESG---DNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLKGSGNLDAIQIIKKLGGSMNESYLDEGFLLEKLPGMFQPRRVEKAKILIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSGVKLGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIKAAPRAR 522          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 285.804 bits (730), Expect = 3.671e-89
Identity = 190/523 (36.33%), Postives = 297/523 (56.79%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMN-IARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGN-----LETIQIIKKLGGLLSDSYLDEGFLLEKK-VGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEA---EKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGED-RLLKFSGVA-VGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKA 1625
            D+++ E+ R S+ V A A+ D V+T+LGP+GMDK++ SG  + +T+TNDGATIL  + V +P AK+LVE+SK QD E GDGTT+VVV+A  LL  A+ L+S+ +HP T+   ++ A  EA   L + +           D L+N +A T+L+SK+++QH    A +AV+AV ++  S N     L+ I+IIKK+G  + +S L EG L+++K +G   P RIE AKI +    +   K  +    I    +T  A+++ A   E+Q + E  ++I   GCNV      I R  +        +   IM I+  + E +E  S + G    ++ D      LGY DL+EEI  G D +++K +GV   G A +I+LRG+ + +L+EA+RS+HDALCVI+  VK +  + GGGA EM +A  +  LA    G       AF+ AL  +P  +A+N G      V +LR  H  G+ +YG+++  G + DM +  + +   V    +  A+E    I+++D+I+ A
Sbjct:   25 DKDKPESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGD-VTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPV----DLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVI----ITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIVMA 538          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 285.804 bits (730), Expect = 3.671e-89
Identity = 190/523 (36.33%), Postives = 297/523 (56.79%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMN-IARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGN-----LETIQIIKKLGGLLSDSYLDEGFLLEKK-VGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEA---EKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGED-RLLKFSGVA-VGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKA 1625
            D+++ E+ R S+ V A A+ D V+T+LGP+GMDK++ SG  + +T+TNDGATIL  + V +P AK+LVE+SK QD E GDGTT+VVV+A  LL  A+ L+S+ +HP T+   ++ A  EA   L + +           D L+N +A T+L+SK+++QH    A +AV+AV ++  S N     L+ I+IIKK+G  + +S L EG L+++K +G   P RIE AKI +    +   K  +    I    +T  A+++ A   E+Q + E  ++I   GCNV      I R  +        +   IM I+  + E +E  S + G    ++ D      LGY DL+EEI  G D +++K +GV   G A +I+LRG+ + +L+EA+RS+HDALCVI+  VK +  + GGGA EM +A  +  LA    G       AF+ AL  +P  +A+N G      V +LR  H  G+ +YG+++  G + DM +  + +   V    +  A+E    I+++D+I+ A
Sbjct:   25 DKDKPESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGD-VTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPV----DLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVI----ITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIVMA 538          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Match: CCT2 (gene:FBgn0030086 transcript:FBtr0071289)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 364/531 (68.55%), Postives = 441/531 (83.05%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES--ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SL P+++L   A EE+AE AR+SSF+GAIAIGDLVK+TLGPKGMDKIL++ G  +  + VTNDGATIL+++GVDNPAAKILV+MS+VQD+EVGDGTTSV VLASELLREAE+L+ QKLHPQ ++SGWR+A   A  AL  +A+ ++     F ++L+NIARTTLSSKIL QHKD FA LAVDAV RLKGSG L++IQIIKK GG L DS+LDEGFLL+KK GV+QP+RIENA+ILIANTPMD DKIKVFGS IKVD++ KIA+LE AEK+KMKEKV+KI KH CNVFINRQLIYNYPEQLF+   +M+IEHADF+G+ERL+  TGG+I STF+ P   KLG CD+IE++MIGED LL+FSGV +GEACTIV+RGATQ ILDEA+RSLHDALCV+  TVK+ R I GGG +E LMA AV K AA TPGKEAIAIEAF+RAL +LP  IADN G+DS+ LV++LRA H +G    GLDM  GK+ D+ +LGITES+ VK+QVL +A+EAAEMI+RVDNII+ APR+R  +PD 
Sbjct:    4 SLNPVRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSGELKSIQIIKKSGGTLGDSFLDEGFLLDKKPGVHQPQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIRCAPRRR--VPDR 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 280.796 bits (717), Expect = 4.886e-87
Identity = 183/549 (33.33%), Postives = 304/549 (55.37%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK-------GSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGD-IASTFDCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHT-------EGDHNY-GLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRG 1646
            MS+LA    LS     +   + R  + + A++I ++VK++LGP G+DK+L+    + +TVTNDGATIL+ + V++PAAK+LVE++++QD+EVGDGTTSVV+LA+ELL+ A++L+ QK+HP ++ISG+R AC EA   +  S   +A       D L+NIA+T++SSKI+    + F+ + VDA   +K        + +++ I ++K  G    +S L  G+ L   +   Q PK+I NAKI   +  +   K+K  G ++ ++   K+  +   E    KE++  I   G NV +    + +   + F   G MA+       ++ ++  TG   I S  +  GE     + +G    + +  I +D L+   G     A +I+LRG      DE ERS+HDALCV+++ ++ ++ + GGG  E  ++  +   A     +E +AI  F+++L  +P  ++ N   D++DLVA+LR+ H          D  + GLD++ G + D  K G+ E    K + L  A EAA  I+R+D++IK  P  + G
Sbjct:    1 MSTLA--SPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGD-VTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYI--SEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMK-MGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSG 543          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084291)

HSP 1 Score: 280.796 bits (717), Expect = 4.886e-87
Identity = 183/549 (33.33%), Postives = 304/549 (55.37%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK-------GSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGD-IASTFDCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHT-------EGDHNY-GLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRG 1646
            MS+LA    LS     +   + R  + + A++I ++VK++LGP G+DK+L+    + +TVTNDGATIL+ + V++PAAK+LVE++++QD+EVGDGTTSVV+LA+ELL+ A++L+ QK+HP ++ISG+R AC EA   +  S   +A       D L+NIA+T++SSKI+    + F+ + VDA   +K        + +++ I ++K  G    +S L  G+ L   +   Q PK+I NAKI   +  +   K+K  G ++ ++   K+  +   E    KE++  I   G NV +    + +   + F   G MA+       ++ ++  TG   I S  +  GE     + +G    + +  I +D L+   G     A +I+LRG      DE ERS+HDALCV+++ ++ ++ + GGG  E  ++  +   A     +E +AI  F+++L  +P  ++ N   D++DLVA+LR+ H          D  + GLD++ G + D  K G+ E    K + L  A EAA  I+R+D++IK  P  + G
Sbjct:    1 MSTLA--SPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGD-VTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYI--SEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMK-MGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSG 543          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Match: CCT4 (gene:FBgn0032444 transcript:FBtr0080411)

HSP 1 Score: 279.256 bits (713), Expect = 1.242e-86
Identity = 175/518 (33.78%), Postives = 286/518 (55.21%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE--LMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSG-----NLETIQIIKKLGGLLSDSYLDEGFLLE-KKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVA-VGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNII 1619
            D+ +    R+S+   A A+ D ++T+LGP+GMDK++ +G  E +++TNDGATILK + V +PAAK+LVE+S+ QD   GDGTTSVVV+A  LL   E+L+ + LHP  +   +++   +A   LKQ +      P   +D   L+  A T+L+SK+++Q     A +AVDAV ++   G     +L+ I++I  LGG + D+ L +G +   +  G N PKRIE AKI +    + A K  +  + I  D       L+E E+  +   V++I K GCNV      I R  + +  +        M ++  + E +E +         ++ D      L   DL+EE+  G ++ +K +G+  +G   +I+ RG+ + +L+EA RSLHDALCV++  VK +  I GGGA E+ MA  ++ LA    G +A    AF+ AL  +P+ +A+N G +    V +LR +H +G+ N G+++  G I D+    + +   V    +T A E    I+++D+I+
Sbjct:   19 DKSKPTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGE-VSITNDGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMST-----PIELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKE-ERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTNKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAITDIFAENVVQPLLVSISSITLATETIRSILKIDDIV 529          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Match: CCT7 (gene:FBgn0037632 transcript:FBtr0081918)

HSP 1 Score: 273.863 bits (699), Expect = 1.841e-84
Identity = 182/523 (34.80%), Postives = 291/523 (55.64%), Query Frame = 3
Query:   84 IQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKA---CVEA--SLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKA 1625
            I +L  G D  + +   +S+     +I D V+TTLGP+GMDK+++    ++ T++NDGATI+K + + +PAAK LV+++K QD EVGDGTTSVV+LA E L++ +  + + +HP+ +I   RKA   C+E    +A++   +S  Q  +  E      A T +SSK++ Q KD F+++ VDAV  L     L  I I K  GG L +S L  G   +K          PK  +N KI + N  ++  K +   ++I+VD V +  ++ +AE Q +  K+ KI + G NV +++  I +   Q F+ + I        E ++R     GG + +T +      LG C+  EE  +G +R   F G    +  T++LRG  +  L+E ERSLHDA+ ++++T+K    + GGGA EM ++  +   +    GKE + I A ++ L  +P  + DN GFD+++++ +LR KH +G   YG+D+    I D  +  + E   +K   LTAAAEAA MI+ VD  IK+
Sbjct:    5 IVLLKEGTDSSQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKA-TISNDGATIMKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAIRKALQLCMEKINEMAVQIVEQSKDQQRALLE----KCAATAMSSKLIHQQKDFFSRIVVDAVLSLDELLPLNMIGIKKVTGGSLEESQLVSGVAFKKTFSYAGFEMAPKSYDNCKIALLNIELEL-KAERDNAEIRVDNVKEYQKVVDAEWQILYNKLAKIHESGANVVLSKLPIGDVATQYFADRDIFCAGRVPEEDLKRTMKACGGAVMTTANDIKPNVLGLCEHFEERQVGGERFNLFQGCPNAKTSTLILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELSKLLRDYSRTIAGKEQLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQGGQWYGVDINKEDISDNYEQCVWEPSIIKINALTAAAEAACMILSVDETIKS 521          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Match: cct2 (chaperonin containing TCP1, subunit 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-020419-6])

HSP 1 Score: 400.208 bits (1027), Expect = 6.989e-137
Identity = 196/285 (68.77%), Postives = 242/285 (84.91%), Query Frame = 3
Query:  804 KVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            ++FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+I STFD P   KLG+C LIEE+MIGED L+ FSGV++GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMA AVS LA  TPGKEA+A+E+F++AL  LP IIADN G+DS++LV+QLRA H +  + +GLDM  G + DM+ LG+TES++VK+QVL +AAEAAEMI+RVDNIIKAAPR+R  +PDH
Sbjct:    1 QIFGSRVRVDSTAKVAEIETAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAAAGVMAIEHADFTGVERLALVTGGEITSTFDHPELVKLGHCKLIEEVMIGEDTLIHFSGVSMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKETRTVYGGGCSEMLMAKAVSDLANHTPGKEAVAMESFAKALMMLPTIIADNAGYDSAELVSQLRAAHQDNKNTFGLDMTQGCVGDMSALGVTESFQVKRQVLLSAAEAAEMILRVDNIIKAAPRKR--VPDH 283          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 302.368 bits (773), Expect = 3.953e-95
Identity = 190/549 (34.61%), Postives = 312/549 (56.83%), Query Frame = 3
Query:   78 APIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSG----NLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTF-DCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            +P+ +L +       E+ R  + + A +I ++VK++LGP G+DK+L+    + +T+TNDGATILK + V++PAAK+L E++++QD EVGDGTTSVV++A+ELL+ A++L+ QK+HP ++ISG+R AC EA   + ++            + L+N A+T++SSKI+    + FA + VDA   +K   G G     + ++ ++K  G    +S+L  G+ L   VG     KR+ NAKI   +  +   K+K  G ++ ++   K+ ++ + E    KE+V+KI   G NV +    I +   + F   G MA+     + ++R++  TG  + S+  +  GE     + LG  + + +  + +D L+         + +I+LRGA   + DE ERSLHDALCV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+R+L  +P  +A N   DS+DLVA+LRA H E   N         GLD+VNGK  D  + G+ E   VK + L  A EAA  I+R+D++IK  P Q+ G P +
Sbjct:    4 SPLSVLGQ---RTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGD-VTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTD--DLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMK-LGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSY 545          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 302.368 bits (773), Expect = 4.041e-95
Identity = 190/549 (34.61%), Postives = 312/549 (56.83%), Query Frame = 3
Query:   78 APIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSG----NLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTF-DCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            +P+ +L +       E+ R  + + A +I ++VK++LGP G+DK+L+    + +T+TNDGATILK + V++PAAK+L E++++QD EVGDGTTSVV++A+ELL+ A++L+ QK+HP ++ISG+R AC EA   + ++            + L+N A+T++SSKI+    + FA + VDA   +K   G G     + ++ ++K  G    +S+L  G+ L   VG     KR+ NAKI   +  +   K+K  G ++ ++   K+ ++ + E    KE+V+KI   G NV +    I +   + F   G MA+     + ++R++  TG  + S+  +  GE     + LG  + + +  + +D L+         + +I+LRGA   + DE ERSLHDALCV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+R+L  +P  +A N   DS+DLVA+LRA H E   N         GLD+VNGK  D  + G+ E   VK + L  A EAA  I+R+D++IK  P Q+ G P +
Sbjct:    6 SPLSVLGQ---RTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGD-VTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTD--DLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMK-LGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSY 547          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 301.212 bits (770), Expect = 7.660e-95
Identity = 181/523 (34.61%), Postives = 299/523 (57.17%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELM-NIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            P+ +L  G D  +     +S+      + + V+TTLGP+GMDK+++    ++ T++NDGATILK + V +PAAK LV++++ QD EVGDGTTSV +LA+E L++ +  + + LHPQT+I  +R A   A   +K+ A +  +     +  L+   A T L+SK++   KD F+K+ VDAV  L     L+ I + K  GG L +S L  G   +K         QPKR  N KI + N  ++  K +   ++++V++V     + +AE   + +K+EKI K G  V +++  I +   Q F+ + +        E ++R  +  GG I ++     +  LG C+L EE+ +G +R   F G    + CTI+LRG  +  ++E +RSLHDA+ ++++ +K+   + GGGA EM ++  +   +   PGK+ + I A+++AL  +P  + DN GFD+++++ +LRAKH +G   YG+D+ N  I D  +  + E   V+   LTAA+EAA +I+ VD  IK  PR
Sbjct:    5 PVILLKEGTDTSQGVPQLVSNINACQVVAEAVRTTLGPRGMDKLVVDNRGKA-TISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTIKKDDKQEQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMMLDDLLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELEL-KAEKDNAEVRVNSVEDYQAIVDAEWNILYDKLEKIHKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVVEEDLKRTMMACGGSIQTSVGSLTDDVLGQCELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETDRSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGMWYGVDVNNEDIADNFQACVWEPSIVRINALTAASEAACLILSVDETIK-NPR 524          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 278.485 bits (711), Expect = 3.965e-86
Identity = 174/503 (34.59%), Postives = 289/503 (57.46%), Query Frame = 3
Query:  138 SSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFP--STFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHT-EGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 1616
            S  + A A+ + ++T+LGP G+DK+++    E +TVTNDGATIL  + VD+  AK++VE+SK QDDE+GDGTT VVVLA  LL +AEQL+ + +HP  +  G+ +A   A +A++Q  +    FP      + L+  A TTL SK++ +   + A++AV+A+  +    +   + E I++  K+GG L D+ L +G +++K+    Q PK +++ KI I   P +  K K    K+ V +V     L++ EK K +E + ++ ++G N+ I +    +    L     + AI       +E +++ TGG I   F      KLG   L++EI  G  +DR+L         A TI +RG  + I++EA+R+LHDALCVI+  V+D R + GGGA+E+  A AV++ A + P  E  A+ AF+ AL  +P  +A+N G +    + ++RA+   E +   G+D ++    DM +  + E+   KKQ ++ A +  +MI+++D+I
Sbjct:   36 SHILAAKAVANTLRTSLGPNGLDKMMVDKDGE-VTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQA---AKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKT-KHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Match: kiaa0586 (KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 383/530 (72.26%), Postives = 458/530 (86.42%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G +S +TVTNDGATILK+IG+DNPAA++LV+MSKVQDDEVGDGTTSV VLA+ELLREAE L+++K+HPQT+ISGWR+A   A  AL  ++         F  +L+NIARTTLSSK+LT HKD F+KLAV+AV RLKGSGNLE I +IKKLGG L++SYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKE++A+E+F++ALR LP IIADN G+DS+DLV+QLRA H+EG   YGLDM NG I +M +LGITES++VK+QVL +A+EAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDSTVTVTNDGATILKAIGIDNPAAQVLVDMSKVQDDEVGDGTTSVTVLAAELLREAEVLVARKIHPQTIISGWRQATQVAREALLNASVDHGNDEEKFRCDLLNIARTTLSSKLLTHHKDHFSKLAVEAVLRLKGSGNLEAIHVIKKLGGSLTESYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFATAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGTCKLIEEVMIGEDKLIHFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMAHAVTELAIRTPGKESVAMESFAKALRMLPTIIADNAGYDSADLVSQLRAAHSEGKSTYGLDMKNGTIGEMGELGITESFQVKRQVLLSASEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Match: kiaa0586 (KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 354/526 (67.30%), Postives = 435/526 (82.70%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGV----AVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            SLAP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G +S +TVTNDGATILK+IG+DNPAA++LV+MSKVQDDEVGDGTTSV VLA+ELLREAE L+++K+HPQT+ISGWR+A   A  AL  ++         F  +L+NIARTTLSSK+LT HKD F+KLAV+AV RLKGSGNLE I +IKKLGG L++SYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTG + +       +       L+ +++   D L++++ +     + EACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKE++A+E+F++ALR LP IIADN G+DS+DLV+QLRA H+EG   YGLDM NG I +M +LGITES++VK+QVL +A+EAAE+I+RVDNIIKAAPR
Sbjct:    5 SLAPVNIFKAGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDSTVTVTNDGATILKAIGIDNPAAQVLVDMSKVQDDEVGDGTTSVTVLAAELLREAEVLVARKIHPQTIISGWRQATQVAREALLNASVDHGNDEEKFRCDLLNIARTTLSSKLLTHHKDHFSKLAVEAVLRLKGSGNLEAIHVIKKLGGSLTESYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFATAGVMAIEHADFAGVERLALVTGTEPSYIHGLLVKHSQQLWSLLCKVL---DFLIRYNKLKSTHTLSEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMAHAVTELAIRTPGKESVAMESFAKALRMLPTIIADNAGYDSADLVSQLRAAHSEGKSTYGLDMKNGTIGEMGELGITESFQVKRQVLLSASEAAEVILRVDNIIKAAPR 527          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Match: kiaa0586 (KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458])

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 345/474 (72.78%), Postives = 409/474 (86.29%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGL 1490
            SLAP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G +S +TVTNDGATILK+IG+DNPAA++LV+MSKVQDDEVGDGTTSV VLA+ELLREAE L+++K+HPQT+ISGWR+A   A  AL  ++         F  +L+NIARTTLSSK+LT HKD F+KLAV+AV RLKGSGNLE I +IKKLGG L++SYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKE++A+E+F++ALR LP IIADN G+DS+DLV+QLRA H+EG   YGL
Sbjct:    5 SLAPVNIFKAGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDSTVTVTNDGATILKAIGIDNPAAQVLVDMSKVQDDEVGDGTTSVTVLAAELLREAEVLVARKIHPQTIISGWRQATQVAREALLNASVDHGNDEEKFRCDLLNIARTTLSSKLLTHHKDHFSKLAVEAVLRLKGSGNLEAIHVIKKLGGSLTESYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFATAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGTCKLIEEVMIGEDKLIHFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMAHAVTELAIRTPGKESVAMESFAKALRMLPTIIADNAGYDSADLVSQLRAAHSEGKSTYGL 478          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Match: kiaa0586 (KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 300/406 (73.89%), Postives = 351/406 (86.45%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGG 1286
            SLAP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G +S +TVTNDGATILK+IG+DNPAA++LV+MSKVQDDEVGDGTTSV VLA+ELLREAE L+++K+HPQT+ISGWR+A   A  AL  ++         F  +L+NIARTTLSSK+LT HKD F+KLAV+AV RLKGSGNLE I +IKKLGG L++SYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GG
Sbjct:    5 SLAPVNIFKAGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDSTVTVTNDGATILKAIGIDNPAAQVLVDMSKVQDDEVGDGTTSVTVLAAELLREAEVLVARKIHPQTIISGWRQATQVAREALLNASVDHGNDEEKFRCDLLNIARTTLSSKLLTHHKDHFSKLAVEAVLRLKGSGNLEAIHVIKKLGGSLTESYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFATAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGTCKLIEEVMIGEDKLIHFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGG 410          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Match: kiaa0586 (KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 317/522 (60.73%), Postives = 381/522 (72.99%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            SLAP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G +S +TVTNDGATILK+IG+DNPAA++LV+MSKVQDDEVGDGTTSV VLA+ELLREAE L+++K+HPQT+ISGWR+A   A  AL  ++         F  +L+NIARTTLSSK+LT HKD F+KLAV+AV RLKGSGNLE I +IKKLGG L++SYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+     I       +    A  S   AL ++   + D    +         AD VS+                                         LRA H+EG   YGLDM NG I +M +LGITES++VK+QVL +A+EAAE+I+RVDNIIKAAPR
Sbjct:    5 SLAPVNIFKAGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDSTVTVTNDGATILKAIGIDNPAAQVLVDMSKVQDDEVGDGTTSVTVLAAELLREAEVLVARKIHPQTIISGWRQATQVAREALLNASVDHGNDEEKFRCDLLNIARTTLSSKLLTHHKDHFSKLAVEAVLRLKGSGNLEAIHVIKKLGGSLTESYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFATAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGTCKLIEEVMIGEDKLIHFSGVAMVATKNIFF-----SPFSVAMESFAKALRMLPTIIADNAGYDS--------ADLVSQ-----------------------------------------LRAAHSEGKSTYGLDMKNGTIGEMGELGITESFQVKRQVLLSASEAAEVILRVDNIIKAAPR 472          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Match: Cct2 (chaperonin containing Tcp1, subunit 2 (beta) [Source:MGI Symbol;Acc:MGI:107186])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 389/530 (73.40%), Postives = 452/530 (85.28%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G ++ + VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+ISGWR+A   A  AL  SA       + F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I +IKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E+F++ALR LP IIADN G+DS+DLVAQLRA H+EG    GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Match: Cct2 (chaperonin containing Tcp1, subunit 2 (beta) [Source:MGI Symbol;Acc:MGI:107186])

HSP 1 Score: 308.916 bits (790), Expect = 3.118e-102
Identity = 155/213 (72.77%), Postives = 178/213 (83.57%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEG 707
            SLAP+ I   GADEERAETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G ++ + VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+ISGWR+A   A  AL  SA       + F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I +IKKLGG L+DSYLDEG
Sbjct:    5 SLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEG 217          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Match: Cct7 (chaperonin containing Tcp1, subunit 7 (eta) [Source:MGI Symbol;Acc:MGI:107184])

HSP 1 Score: 310.842 bits (795), Expect = 1.623e-98
Identity = 186/523 (35.56%), Postives = 301/523 (57.55%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELM-NIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            P+ +L  G D  +     +S+      I + V+TTLGP+GMDK+++ G  ++ T++NDGATILK + V +PAAK LV+++K QD EVGDGTTSV +LA+E L++ +  + + LHPQ +I  +R A   A   +K+ A +  +     + +++   A T LSSK+++Q K  FAK+ VDAV  L     L+ I I K  GG L +S L  G   +K         QPK+ +N KI + N  ++  K +   ++I+V TV     + +AE   + +K+EKI + G  V +++  I +   Q F+ + +        E ++R  +  GG I ++ +      LG+C + EE  IG +R   F+G    + CTI+LRG  +  ++E ERSLHDA+ ++++ +K+   + GGGA EM ++  +   +   PGK+ + I A+++AL  +P  + DN GFD+++++ +LRA+H +G   YG+D+ N  I D  +  + E   V+   LTAA+EAA +IV VD  IK  PR
Sbjct:    5 PVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKA-TISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKQDKVEQRKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMMLDELLQLKMIGIKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELEL-KAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALVPDVLGHCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDETIK-NPR 524          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Match: Tcp1 (t-complex protein 1 [Source:MGI Symbol;Acc:MGI:98535])

HSP 1 Score: 297.745 bits (761), Expect = 3.040e-93
Identity = 193/538 (35.87%), Postives = 302/538 (56.13%), Query Frame = 3
Query:   93 LSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSG-------NLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTF-DCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQR 1640
            LS   D    E  R  + + A +I ++VK++ GP G+DK+L+    + +T+TNDGATILK + V++PAAK+L E++ +QD EVGDGTTSVV++A+ELL+ A++L+ QK+HP +VISG+R AC EA   + ++   +        D L+N A+T++SSKI+  + D FA + VDAV  +K +         + ++ I+K  G    +S L  G+ L   VG    PKRI NAKI   +  +   K+K  G ++ +    K+ ++ + E    KE+++KI   G NV +    I +   + F   G MA+       ++ ++  +G  I ST  +  GE     T LG  + + +  I +D L+         + +I+LRGA   + DE ERSLHDALCV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+R+L  +PN +A N   DS+DLVA+LRA H E   N         GLD+V+GK  D  + G+ E   VK + L  A EAA  I+R+D++IK  P  +
Sbjct:    5 LSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGD-VTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTD--ELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMK-LGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESK 538          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 276.944 bits (707), Expect = 1.542e-85
Identity = 174/505 (34.46%), Postives = 290/505 (57.43%), Query Frame = 3
Query:  138 SSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFED--ELMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHT-EGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIK 1622
            S  + A A+ + ++T+LGP G+DK+++    + +T+TNDGATIL  + VD+  AK++VE+SK QDDE+GDGTT VVVLA  LL EAEQL+ + +HP  +  G+ +A   A +A++   + S +      +   L+  A+TTL SK++     + A++AV+AV  +    +   + E I++  K+GG L D+ L +G +++K     Q PK++ +AKI I   P +  K K    K+ V +V     L++ EK+K +E +++I + G N+ I +    +    L    G+ A+       +E +++ TGG I   F      KLG+  +++EI  G  +D++L         A TI +RG  + I++EA+RSLHDALCVI+  ++D R + GGGAAE+  A AVS+ A + P  E  A+ AF+ AL  +P  +++N G +    + ++RA+   E +   G+D ++    DM    + E+   KKQ ++ A +   MI+++D+I K
Sbjct:   36 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGD-VTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA---ARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKT-KHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRK 535          
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Match: sp|Q3ZBH0|TCPB_BOVIN (T-complex protein 1 subunit beta OS=Bos taurus OX=9913 GN=CCT2 PE=1 SV=3)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 388/530 (73.21%), Postives = 453/530 (85.47%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I +IKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA+RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG    GLDM  G I DM+ LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAARQALLNSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFVGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLASRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGKTTAGLDMKEGTIGDMSVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Match: sp|Q4R6F8|TCPB_MACFA (T-complex protein 1 subunit beta OS=Macaca fascicularis OX=9541 GN=CCT2 PE=2 SV=3)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 388/530 (73.21%), Postives = 452/530 (85.28%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR++SF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG+   GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Match: sp|P78371|TCPB_HUMAN (T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 388/530 (73.21%), Postives = 452/530 (85.28%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR++SF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I IIKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E++++ALR LP IIADN G+DS+DLVAQLRA H+EG+   GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Match: sp|P80314|TCPB_MOUSE (T-complex protein 1 subunit beta OS=Mus musculus OX=10090 GN=Cct2 PE=1 SV=4)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 389/530 (73.40%), Postives = 452/530 (85.28%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G ++ + VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+ISGWR+A   A  AL  SA       + F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I +IKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV++LA RTPGKEA+A+E+F++ALR LP IIADN G+DS+DLVAQLRA H+EG    GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Match: sp|Q5XIM9|TCPB_RAT (T-complex protein 1 subunit beta OS=Rattus norvegicus OX=10116 GN=Cct2 PE=1 SV=3)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 389/530 (73.40%), Postives = 451/530 (85.09%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SLAP+ I   GADEERAETAR+SSF+GAIAIGDLVK+TLGPKGMDKILLS G + S+ VTNDGATILK+IGVDNPAAK+LV+MS+VQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWR+A   A  AL  SA         F  +LMNIA TTLSSK+LT HKD F KLAV+AV RLKGSGNLE I +IKKLGG L+DSYLDEGFLL+KK+GVNQPKRIENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF   G+MAIEHADF GVERL+LVTGG+IASTFD P   KLG C LIEE+MIGED+L+ FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVKD R++ GGG +EMLMA AV+ LA+RTPGKEA+A+E+F++ALR LP IIADN G+DS+DLVAQLRA H+EG    GLDM  G I DM  LGITES++VK+QVL +AAEAAE+I+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTMLASRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGRITAGLDMKEGSIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Match: A0A2C9K119 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106076711 PE=3 SV=1)

HSP 1 Score: 844.343 bits (2180), Expect = 0.000e+0
Identity = 407/532 (76.50%), Postives = 471/532 (88.53%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKIL-LSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            M SL P+QIL  GA+EE++ETARMSSFVGAIAIGDLVK+TLGPKGMDKIL  S  +E+I VTNDGATILKSIGVDNPAAK+LV++SKVQDDEVGDGTTSVVVLA ELL+EAE L++QK+HPQTVI+GWRKA   A  AL  +AR + + P  F ++LMNIARTTLSSKILTQHKD F+KLAVD+V RLKGSGNL+ IQ+IKKLGG LSDSYLDEGFLL+KKVGVNQPKR+ENAKILIANTPMD DKIKVFGS+++VD ++K+A+LE AEK+KMK KVEKI KHGCNVFINRQLIYNYPEQLFS  G+MAIEHADFEGVERL+LVTGG+I STFDCP + KLG CDLIEE+MIGED+LLKFSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMADAVSKLAA+TPGKE++A+EAF+++LR LP IIADNGG+DS+DL+AQ+RA HT G H  GLDM  G+I DM +LGITESY+VK+QVL + AEAAEMI+RVDNII+AAPR R   PDH
Sbjct:    1 MVSLNPVQILRMGAEEEKSETARMSSFVGAIAIGDLVKSTLGPKGMDKILQTSSNNETIQVTNDGATILKSIGVDNPAAKVLVDISKVQDDEVGDGTTSVVVLACELLKEAENLVAQKIHPQTVIAGWRKAVDAARQALTDAARDNGKDPVKFREDLMNIARTTLSSKILTQHKDLFSKLAVDSVLRLKGSGNLDAIQLIKKLGGNLSDSYLDEGFLLDKKVGVNQPKRVENAKILIANTPMDTDKIKVFGSRVRVDAISKVAQLELAEKEKMKSKVEKILKHGCNVFINRQLIYNYPEQLFSDAGVMAIEHADFEGVERLALVTGGEIVSTFDCPEKVKLGTCDLIEEVMIGEDKLLKFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLSQTVKETRTVYGGGCSEMLMADAVSKLAAKTPGKESVAMEAFAKSLRQLPTIIADNGGYDSADLIAQMRAAHTNGKHTIGLDMERGRIADMAELGITESYQVKRQVLMSGAEAAEMIMRVDNIIRAAPRAR--APDH 530          
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Match: A0A3S1CAN8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_004686 PE=3 SV=1)

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 402/532 (75.56%), Postives = 465/532 (87.41%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKIL-LSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            M SL P+QI   GA+EE++ETARMSSFVGAIAIGDLVK+TLGPKGMDKIL  SG +E+I VTNDGATILKSIGVDNPAAK+LV++S VQDDEVGDGTTSVVV A ELL+EAE L+SQK+HPQTVISGWRKA   A  AL  +AR +   P  F+++L+NIARTTLSSKILTQHK+KF+ LAVDAV RLKGSGNL+ IQ+IKKLGG LSDSYL+EGFLL+KKVGVNQPKR+ENAKILIANTPMD DKIKVFGS+++VD V+K+A+LE AEK+KMK KVEKI KHGCNVFINRQLIYNYPEQLFS  G+MAIEHADF+GVERLSLVTGG+I STFDCP + KLG C LIEE+MIGED+LLKFSGV +GEACT+VLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMADAVSKLAA+TPGKEA+A+E+F++ALR LP IIADN G+DS+DL+AQLRA HT G H  GLDM  G++ D+ +LGITESY+VK+QVL +  EAAEMI+RVDNIIKAAPR R   PDH
Sbjct:    1 MMSLNPVQIFKMGAEEEKSETARMSSFVGAIAIGDLVKSTLGPKGMDKILQTSGTNETIKVTNDGATILKSIGVDNPAAKVLVDISMVQDDEVGDGTTSVVVFACELLKEAENLVSQKIHPQTVISGWRKAVDAAREALTNAARDNGNDPIKFKEDLINIARTTLSSKILTQHKEKFSSLAVDAVLRLKGSGNLDAIQLIKKLGGNLSDSYLEEGFLLDKKVGVNQPKRVENAKILIANTPMDTDKIKVFGSRVRVDAVSKVAQLEVAEKEKMKLKVEKIIKHGCNVFINRQLIYNYPEQLFSDAGVMAIEHADFDGVERLSLVTGGEIVSTFDCPEKVKLGTCKLIEEVMIGEDKLLKFSGVELGEACTVVLRGATQQILDEAERSLHDALCVLSQTVKETRTVYGGGCSEMLMADAVSKLAAKTPGKEAVAMESFAKALRQLPTIIADNAGYDSADLIAQLRASHTSGKHTIGLDMQQGRVGDVAQLGITESYQVKRQVLVSGHEAAEMILRVDNIIKAAPRPRA--PDH 530          
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Match: V3ZDB1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210058 PE=3 SV=1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 393/530 (74.15%), Postives = 465/530 (87.74%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            ++ P+QI S+GA EE+AE ARMSSFVGAIAIGDLVK+TLGPKGMDKIL S     ++ VTNDGATILKSIGVDNPA K+LV++SKVQDDEVGDGTTSVVVLA ELL+EAEQL+S K+HPQT+I+GWR A   A  AL  SA+ +   P  F ++LMNIARTTLSSKILTQ+K+ FAKLAV+AV RLKGSGNL+ IQIIKKLGG L DSYLDEGFLL+K VGV+QPKR+ENAKILIANTPMD DKIKVFGS+++VD V+K+AELE AEK+KMK+KV KI KH CNVFINRQLIYNYPEQLF+  G+MAIEHADF+G+ERL+LVTGG+I STFDCP + KLG CD+IE++MIGED+LLKF+GVA+GEACT+VLRGATQ ILDE+ERSLHDALCV+ QTVK+ R++ GGG++EMLMADAVSKLAA+TPGKEA+A+EAF+RALRALP  IADN G+DS++LVAQLRA HT+G H YGLDM +G+I DM KLGITES++VK+QVL +AAEAAEMI+RVDNII +APR R+  PDH
Sbjct:    2 NMHPVQIFSQGAGEEKAEIARMSSFVGAIAIGDLVKSTLGPKGMDKILQSNDPNCTLQVTNDGATILKSIGVDNPAGKVLVDISKVQDDEVGDGTTSVVVLACELLKEAEQLVSSKIHPQTIITGWRAAVDTARKALTDSAKDNGTNPDKFCEDLMNIARTTLSSKILTQYKEHFAKLAVEAVLRLKGSGNLDAIQIIKKLGGALQDSYLDEGFLLDKTVGVHQPKRVENAKILIANTPMDTDKIKVFGSRVRVDAVSKVAELEVAEKEKMKDKVNKIIKHNCNVFINRQLIYNYPEQLFADAGMMAIEHADFDGIERLALVTGGEITSTFDCPDKVKLGTCDVIEQVMIGEDQLLKFTGVALGEACTVVLRGATQQILDESERSLHDALCVLSQTVKETRTVFGGGSSEMLMADAVSKLAAKTPGKEAVAMEAFARALRALPTCIADNAGYDSAELVAQLRAAHTDGKHTYGLDMNDGEIGDMEKLGITESFQVKRQVLLSAAEAAEMILRVDNIISSAPRPRQ--PDH 529          
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Match: A0A2T7P680 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11498 PE=3 SV=1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 390/519 (75.14%), Postives = 462/519 (89.02%), Query Frame = 3
Query:  102 GADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSG-GSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPD 1655
            GA+EE++ETARMSSFVGAIAIGDLVK+TLGPKGMDKIL S   ++++ VTNDGATILK+IGVDNPAAK+LV++SKVQDDEVGDGTTSVVVLA ELL+EAE L+ QKLHPQT++SGWRKA  EA  AL +SA  +   P  F+++LMNIARTTLSSKILTQHKD F+ LAV+AV RLKGSGNL+ IQIIKKLGG L DSYL+EGFLL+KK+GVNQPKR+ENAKIL+ANTPMDADKIKVFGS+++VD V+K+AELE AEK+KMK+KVEKI KHGCNVFINRQLIYNYPEQLF+  G+MAIEHADFEGVERL+LVTG +I STFDCP +TKLG C +IEE+MIGED+LL+FSGV +GEAC+IVLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMA+AVS+LAARTPGKEAIA+EAF+RALR LP IIADN G+DS++L+AQ+RA H +G H  GLDMV G++ D+ +LGITES++VK+QVL + AEAAEMI+RVDNIIKAAPRQR  +PD
Sbjct:    4 GAEEEKSETARMSSFVGAIAIGDLVKSTLGPKGMDKILQSSSNNDTVQVTNDGATILKAIGVDNPAAKVLVDISKVQDDEVGDGTTSVVVLACELLKEAESLVGQKLHPQTIVSGWRKAVDEARRALTESALDNGNDPEKFQEDLMNIARTTLSSKILTQHKDYFSTLAVNAVLRLKGSGNLDAIQIIKKLGGNLRDSYLEEGFLLDKKIGVNQPKRVENAKILVANTPMDADKIKVFGSRVRVDAVSKVAELELAEKEKMKDKVEKILKHGCNVFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGAEIVSTFDCPEKTKLGQCAVIEEVMIGEDKLLRFSGVKLGEACSIVLRGATQQILDEAERSLHDALCVLSQTVKETRTVFGGGCSEMLMAEAVSQLAARTPGKEAIAMEAFARALRMLPTIIADNAGYDSAELIAQMRAAHAQGKHTIGLDMVRGEVGDVAELGITESFQVKRQVLVSGAEAAEMIMRVDNIIKAAPRQR--VPD 520          
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Match: K1R294 (T-complex protein 1 subunit beta OS=Crassostrea gigas OX=29159 GN=CGI_10026913 PE=3 SV=1)

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 393/529 (74.29%), Postives = 461/529 (87.15%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            SL P+QI + GA+EE+AETAR+SSFVGAIAIGDLVK+TLGPKGMDKIL S G   I VTNDGATILKSIG+DNPAAKILV++SKVQDDEVGDGTTSVVVLASELLRE+E LISQ++HPQT+I+GWRKA  EA  AL+  AR +      F ++LMNIARTTLSSKILTQ+KD F+KLAVDAV RLKGSGNL+ I +IKK GG L DSYLDEGFLL+KK+GVNQPKRIENAKIL+ANTPMD DKIKVFGSK+KVD V+K+AELE AEK+KM++KV KI KHGCNVFINRQLIYNYPEQLF+  G+MAIEHADFEGVERL+LVTGG+I STFD P   +LG C LIEE+MIGED+L+KFSGV +GEACTIVLRGAT+ ILDEAERSLHDALCV+ QTVK+ +++ GGG+AEMLMADAVSKLAA+TPGKEA+A+EA+++ALR LP  IADN G+DS+ LV++LRA HT G H  GL+M  G++ DM KLGITES++VK+QVL +A+EAAEMI+RVD+IIKAAPR R+  PDH
Sbjct:    2 SLNPVQIFNAGAEEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILQSSGG--IQVTNDGATILKSIGIDNPAAKILVDISKVQDDEVGDGTTSVVVLASELLRESEALISQRIHPQTIITGWRKATDEARRALQSFARDNGNNEVKFREDLMNIARTTLSSKILTQYKDYFSKLAVDAVLRLKGSGNLDAIHLIKKSGGGLQDSYLDEGFLLDKKIGVNQPKRIENAKILVANTPMDTDKIKVFGSKVKVDAVSKVAELELAEKEKMRDKVNKIIKHGCNVFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFDAPESVRLGKCKLIEEVMIGEDKLIKFSGVEMGEACTIVLRGATKQILDEAERSLHDALCVLTQTVKETKTVFGGGSAEMLMADAVSKLAAKTPGKEAVAMEAYAKALRMLPTTIADNAGYDSAQLVSELRALHTAGKHTMGLNMKEGEVGDMEKLGITESFQVKRQVLMSASEAAEMILRVDDIIKAAPRPRQ--PDH 526          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 382/530 (72.08%), Postives = 453/530 (85.47%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            S+AP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILL GG E S+TVTNDGATILK+IGVDNPAAK+LV+MSKVQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQ +ISGWRKA   A  AL++SA         F+++L+NI+RTTLSSK+LT HKD FAKLAV+AV RLKGSGNLE I +I+KLGG L DSYLDEGFLL+KK+GVNQPKR+EN  ILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+I STFD P   KLG+C LIEE+MIGED L++FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMA  V+ LA RTPGKEA+A+E+F++ALR LP IIADN G+DS+DLVAQLRA H E    +GLDM  G I DM +LGITES++VK+QV+ +AAEAAEMI+RVD+IIKAAPR+R  +PDH
Sbjct:    5 SMAPVNIFKHGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHPQIIISGWRKATQAAREALRESAVDHGNDEVKFQEDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLKGSGNLEAIHVIQKLGGSLIDSYLDEGFLLDKKIGVNQPKRLENVNILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAAAGVMAIEHADFVGVERLALVTGGEITSTFDHPELVKLGHCKLIEEVMIGEDTLIRFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKETRTVYGGGCSEMLMAKVVTDLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHQENKTTFGLDMTQGTIGDMAELGITESFQVKRQVVLSAAEAAEMILRVDDIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:103036471])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 300/406 (73.89%), Postives = 351/406 (86.45%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGG 1286
            S+AP+ I   GADEE+AETAR+SSF+GAIAIGDLVK+TLGPKGMDKILL GG E S+TVTNDGATILK+IGVDNPAAK+LV+MSKVQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQ +ISGWRKA   A  AL++SA         F+++L+NI+RTTLSSK+LT HKD FAKLAV+AV RLKGSGNLE I +I+KLGG L DSYLDEGFLL+KK+GVNQPKR+EN  ILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+I STFD P   KLG+C LIEE+MIGED L++FSGVA+GEACTIVLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GG
Sbjct:    2 SMAPVNIFKHGADEEKAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLGGGREGSVTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHPQIIISGWRKATQAAREALRESAVDHGNDEVKFQEDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLKGSGNLEAIHVIQKLGGSLIDSYLDEGFLLDKKIGVNQPKRLENVNILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAAAGVMAIEHADFVGVERLALVTGGEITSTFDHPELVKLGHCKLIEEVMIGEDTLIRFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKETRTVYGG 407          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 305.064 bits (780), Expect = 2.896e-96
Identity = 196/559 (35.06%), Postives = 310/559 (55.46%), Query Frame = 3
Query:   66 MSSL-APIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSG----NLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGE-----------DRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            MS L  P+ +L +       E+ R  + + A +I ++VK++LGP G+DK+L+    + +T+TNDGATILK + V++PAAK+L E++ +QD EVGDGTTSVV++A+ELL+ A++L+ QK+HP ++ISG+R AC EA   + ++    A       + L+N A+T++SSKI+    D FA + VDA   +K   G G     + ++ ++K  G    +S+L  G+ L   VG     KR++NAKI   +  +   K+K  G ++ +    K+ ++ + E    KE+++KI   G NV +    I +   + F   G MA+       ++R++  TG  I     CP  + L   +  E  M+G+           D L+         + +I+LRGA   + DE ERSLHDALCV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+R+L  +P  +A N   DS+DLVA+LRA H E   N         GLD+VNGK  D  + G+ E   VK + L  A EAA  I+R+D++IK  P Q+ G P +
Sbjct:    1 MSMLDGPLNVLGQ---RTTGESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGD-VTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGAD--DLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMK-LGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATI-----CPSLSNLEGEETFEATMLGQAEEVVQERVCDDELILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGGPSY 547          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:103028526])

HSP 1 Score: 303.523 bits (776), Expect = 1.880e-95
Identity = 180/519 (34.68%), Postives = 298/519 (57.42%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELM-NIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIK 1622
            P+ +L  G D  +     +S+      I + V+TTLGP+GMDK+++    ++ T++NDGATILK + V +PAAK LV++++ QD EVGDGTTSV +LA+E L++ +  + + LHPQT+I  +R A   A   +K+ A +  +     + +L+   A T L+SK++   K+ F+K+ VDAV  L     L+ I + K  GG L +S L  G   +K         QPKR +N KI + N  ++  K +   ++++V +V     + +AE   + +K+EKI K G  V +++  I +   Q F+ + +        E ++R  +  GG I ++     +  LG C+L EE+ +G +R   F G    + CTI+LRG  +  ++E ERSLHDA+ ++++ +K+   + GGGA EM ++  +   +   PGK+ + I A+++AL  +P  + DN GFD+++++ +LRAKH +G   YG+D+ N  I D  +  + E   V+   LTAA+EAA +I+ VD  IK
Sbjct:   25 PVILLKEGTDTSQGVPQLISNINACQVIAEAVRTTLGPRGMDKLIVDNRGKA-TISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTVKKDNKEEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMMLDELLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYDNPKIALLNIELEL-KAEKDNAEVRVKSVEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGSLTDDVLGQCELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGMWYGVDVNNEDIADNFQACVWEPAIVRINALTAASEAACLILSVDETIK 541          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 275.404 bits (703), Expect = 4.694e-85
Identity = 171/503 (34.00%), Postives = 289/503 (57.46%), Query Frame = 3
Query:  138 SSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFP--STFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHT-EGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 1616
            S  + A A+ + +KT+LGP G+DK+++    E +TVTNDGATIL  + VD+  AK++VE+SK QDDE+GDGTT VVVLA  LL +AEQL+ + +HP  +  G+ +A   A +A++   +    FP   +  + L+  A TTL SK++ +   + A++AV+A+  +    +   + E I++  K+GG L D+ L +G +++K+    Q PK +++ KI I   P +  K K    K+ + +V     L++ EK+K +E ++++ ++G N+ I +    +    L     + A+       +E +++ TGG I   F      KLG   L+ E+  G  +DR+L         A TI +RG  + I++EA+R+LHDALCVI+  V+D R + GGGA+E+  A AV++ A + P  E  A+ AF+ AL  +P  +A+N G +    + ++RA+   E +   G+D +     DM +  + E+   KKQ ++ A +  +MI+++D+I
Sbjct:   36 SHIMAAKAVANTLKTSLGPNGLDKMMVDKDGE-VTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQA---ARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKT-KHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.834 bits (782), Expect = 7.230e-102
Identity = 155/217 (71.43%), Postives = 177/217 (81.57%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILL---SGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEG 707
            M SLAPI IL  GADEE+AETAR+SSF+GAI IGDLVK+TLGPKGMDKILL   S G   +TVTNDGATILKSIGVDNPAAKILV+MSKVQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+I+GWRK+   A  AL+ +A         F  +L+NI+RTTLSSK+LT HKD FAKLAV+AV RL+G G LE I +IKKLGG L DSYLDEG
Sbjct:    1 MVSLAPINILKSGADEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDHGHDKEKFHVDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLRGKGTLEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 268.855 bits (686), Expect = 3.429e-84
Identity = 162/464 (34.91%), Postives = 259/464 (55.82%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE------LMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLV 1442
            PI +L  G D  +     +S+    + + D V+TTLGP+GMDK+++    +S T++NDGATILK + V +PA K LV++++ QD EVGDGTTSV +LA+ELL++  Q + + +HPQ +   +RKA     LA+++    S   P   ED+      L+  A T LSSK+++Q KD FA + VDAV+ L     L  I + K  GG L DS+L  G   +K         QPK     KI + N  ++  K +   ++++V  V     + +AE   + +K+ KI   G  V +++  I +   Q F+ + +        E ++R  +  GG I ++     +  LG C+L EE+ IG DR   F G    + CTI+LRG  +  +DE ERSLHDA+ ++++ +K+   + GGGA EM ++  +  ++   PGKE + + A++RAL   P  + DN GFD+++++
Sbjct:    4 PIILLKEGTDTSQGIPQLLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKS-TISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKA---TGLAIEKIKEISV--PVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAVSMLDELMPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELEL-KAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGRCELFEEVQIGGDRYNFFKGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFDATNVL 460          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 270.781 bits (691), Expect = 7.177e-84
Identity = 169/519 (32.56%), Postives = 286/519 (55.11%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE--LMNIARTTLSSKILTQHKDKFAKLAVDAVTRL-----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVA-VGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKA 1625
            D E+    R S+   A AI D ++T+LGPKGMDK++  G  + +T+TNDGATILK + V +PAAK+LVE+SK QD E GDGTTSVVV+A  LL  + +L+ + +HP  +   ++KA  +A     Q    S   P    D   L+N A T L+SK+++Q+    A ++VDAV ++       S +L  I++I+KLGG + D  L EG +L +++      R+E AKI +    +   K     ++I +   T++  +   E+      V+++ K GCNV      I R  + +      +   IM ++  + E +E +    G    ++ D      L   +L+EE+ +G  +++K +G A  G+  +I++RG+ + +L+EAERSLHDALCVI+  VK +  I GGGA E+ ++  +++ A      EA  + A+  A+  +P  +A+N G +    V +LR +H +G+   G+++  G I ++ +  + +   V    ++ + E    I+++D+I+ A
Sbjct:   33 DREKPAMIRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGD-VTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKA-----QEILESMSLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRISNTGIIRVEKAKIGLIQFCLSPPKTD-MENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIVNA 544          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 262.307 bits (669), Expect = 8.900e-81
Identity = 175/502 (34.86%), Postives = 282/502 (56.18%), Query Frame = 3
Query:  138 SSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNY-GLD-MVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 1616
            S  + A ++   ++T+LGPKG+DK+++S   + ITVTNDGATIL  + V++  AK++VE+S+ QDDE+GDGTT VVVLA  LL +AEQL+ + +HP  +  G+ +A   A   L   A S    P+  E  L+  A TTL SKI+ + +   A++AV+AV  +    +   + E I++  K+GG L D+ L +G +++K     Q PK + NAKI I   P +  K K    K+ V  V     L + EK+K  E V ++ + G N+ I +    +    L     + A+       +E +++ TGG I   F      KLG+  ++ E+  G  +D +L         A TI +RG  + I++EA+RS+HDALCVI+  V+D R + GGG+AE+  + AVS+ A +    E  A+ AF+ AL  +P  +A+N G +S   +A++R++       Y G++ M +    DM +  + E+   KKQ ++ A +  +MI+++D+I
Sbjct:   36 SHIMAAKSVASTLRTSLGPKGLDKMMVSQDGD-ITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTE-SLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKDVDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKT-KHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKDHMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDI 534          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 9.651e-42
Identity = 119/394 (30.20%), Postives = 202/394 (51.27%), Query Frame = 3
Query:   63 RMSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLS--GGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGN------LETIQIIKKL-GGLLSDSYLDEGFLLEKKVGVNQP---KRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGY-CDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTIL 1205
            ++S  AP+ +LS+    E     +  +   A  I D+++T LGP+ M K+L+   GG   I +TNDG  IL+ I V +PAAK ++E+S+ QD+EVGDGTTSV++LA E+L  AEQ + Q++HP  +IS +RKA  +    LK    SS     T    ++ I ++ + +K L++  +    +A+DAV  ++   N      ++    I+K+ GG+L +S +  G +L K   V  P   +RIE  +IL+ +  ++  K +   + I++      A++ +AE+  +++    I +   ++    + I +  +       I AI         R++   G  I S      E  +G    L E   IG+D     +     +ACTI+LRGA++ IL
Sbjct:    2 QLSGGAPVLVLSQNTKRESGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGG---IVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDI--SSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKD--VTHPRMRRRIETPRILLLDCSLEFKKGE-SQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIGDDYFTFITECKDPKACTILLRGASKDIL 387          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 333/518 (64.29%), Postives = 415/518 (80.12%), Query Frame = 3
Query:   84 IQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQ-KLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            +QI      EERAE AR+S+FVGAIA+GDLVK+TLGPKGMDK+L S  S +  VTNDGATILKSI +DNPAAK+LV +SKVQDDEVGDGTTSV VL++ELLREAE+LI Q K+HPQT+I G+R A   A  AL ++A  ++   + F ++L++IA+TTLSSKIL+Q KD FA+LA +A+ RLKGS NLE IQIIK LGG LSDS+LDEGF+L KK G NQPKRIENAKILIANT +D DK+K+FG+K KVD+  K+A+LE+AE++KMK K+ KI+K G N FINRQLIY+YPEQLF+  GI +IEHADFEGVERL+LVTGG++ STFD P + KLG CD+IEEIM+GE   LKFSG   GEACTIVLRGAT   LDEAERSLHDAL V+ QT K+ R++ GGG AEM+M+ AV   A    GK+++A+EAF+RALR LP I+ADN GFDSS+LV++LR+    G    GLD+ NG I DM +LGI ESY++K+ V+++A+EAAE+++RVDNII+A PR
Sbjct:    3 VQIFGDQVTEERAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNAILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFSGCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARPR 520          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 284.263 bits (726), Expect = 4.311e-89
Identity = 181/512 (35.35%), Postives = 293/512 (57.23%), Query Frame = 3
Query:  129 ARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARS-SAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRI------ENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKH-TEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNII 1619
            A+ S  + A ++  ++KT+LGP+G+DKIL+S   E IT+TNDGATIL  + +DN  AK+LV++SK QDDE+GDGTT VVVLAS LL +A +LI + +HP  + +G+ +A   A   L+++    SA     F D L+  A+T+L SKI+++  D+FA++AV+AV  +    +   + + I++  ++GG +SDS L  G +L+K     Q PK +      +  K+ I   P +  K K    K+ + +V +  +L+  E+ K KE ++ + K G +V I +    +    L     + A+     + +E +++ T G I   F    + KLG C  I E   G  +DR+L        +  T  +RG+ + I+DEAER+LHD+LCV++  VKD R + GGGAAE+ M+ AVS+ A +  G +  A   F++AL  +P  +A+N G D    ++ L++K   E   N G+D +     DM +L + + +  KKQ +  A +   MI+++DN+I
Sbjct:   46 AKKSHILAARSVASIIKTSLGPRGLDKILISPDGE-ITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKT-KHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 271.937 bits (694), Expect = 2.154e-84
Identity = 179/547 (32.72%), Postives = 294/547 (53.75%), Query Frame = 3
Query:  102 GADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGN-------LETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKV-FGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTF-DCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGD------------HNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLP-DH 1658
            G ++   +  R  + +  +A+ ++VK++LGP G+DK+L+    +  TVTNDGATIL  + V +PA KILVE+++ QD E+GDGTTSVV++ASELL+ A +L+  K+HP T+I+G+R A  EA   + +   +S    +  ++ L+NIA+T++SSKI+    D F+ + VDA+  +K   +       ++ + ++K  G   ++S L  G+ L   V     PKRI    + IA   ++  K ++  G +I +D   ++ ++ + E   + E+V+KI   G  V +  + I +   + F    IM +     E + R++  TG  + S+  +  GE     + LG CD + +    +D  +   G +   + +I+LRGA    LDE ERSLHD+L V+++T++    + GGG  E  +   +   A     +E +AI  F+ AL  +P  +A N   DSS+LVA+LR+ H                 NYGLD++ GKI D    G+ E    K + L +A EA   I+R+D +I   P   +  P DH
Sbjct:   16 GGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGD-FTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVD--TLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDH 559          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 270.396 bits (690), Expect = 7.147e-84
Identity = 169/522 (32.38%), Postives = 282/522 (54.02%), Query Frame = 3
Query:   69 SSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKL-GGLLSDSYLDEGFLLEKKVGV----NQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNII 1619
            S    I +L  G D  + +   +S+    +A+ + +K TLGP G D IL+   ++  T++NDGATILK + V +PAAK LV++S+ QD EVGDGTTSV +LA EL++EA+  + + +    ++ G+RKA   A   + + A       S+  + L   ART +SSK++  + D F K+ VDAV  L  +   + +  IKK+ GG + +S    G   +K         QPK+  N KIL  N  ++  K +   ++++V+ V     + +AE Q + EK+ ++ + G N+ +++  I +   Q F+ + I        + + R+    GG I ST        LG C L EE+ IG +R   F G    + CT++LRG  + ++ E ERSLHDA+ ++++ ++++  + GGGA EM ++  +   +    GK+ + I AF++AL  +P  + +N GFD+ +++ +LR  H++G+  YG+      I D     + E   VK   L +A EA  +I+ VD  I
Sbjct:    5 SQTPTIVVLKEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSD-ILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLDRNDLDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELEL-KAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETI 524          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 236.884 bits (603), Expect = 1.847e-71
Identity = 166/518 (32.05%), Postives = 285/518 (55.02%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEA-SLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSG----NLETIQIIKKLGGLLSDSYLDEGFLLEKKV--GVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEA---CTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 1616
            ++E+ +  R ++ + A ++ D ++T+LGPKGMDK++ +   E I ++NDG TILK + + +P A++LVE+S  QD E GDGTTSVV+L   LL  AE+L+++ +HP  +   ++ A   +  + L+   + S     +  ++L+  A T+LSSKI++Q+    A LAVD+V ++        +L  I+++KK+GG + D+ + +G +L +        P R E AKI +    +   K     + I V+   ++ ++ + E+  +    +KI K  CNV      I R  + +      S   IM ++  + E +E LS   G    +  +   E +LG  DL+EEI     ++++ +G+    A    ++V+RGA   I+DE ERSLHDALCVI+  VK++  I GGGA E+ ++  +SK A    G +A   + F+ AL  +P  +A+N G +S  +V +LR+KH  G+ N G+ +      +  +  I +   V    +T A+E  + I+R+D+I
Sbjct:   13 NKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGE-IIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSL----SDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDT-ENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Match: EDO34981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT1])

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 390/532 (73.31%), Postives = 456/532 (85.71%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSE-SITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            M SL P+ IL++GA+EERAETAR+SSFVGAIAIGDLVK+TLGPKGMDKIL S G   +I VTNDGATILKSIG+DNPAAKILVE+SKVQDDEVGDGTTSV VL SELL+EAE+L+S K+HPQT+++GWRK+   A  AL+ +A   +  P  F ++LMNIARTTLSSKIL QH+D FAKLAVDAV RLKGSG+L  IQIIKKLGG + DS+LDEGFLL+KK+GVNQPK+IENAKILIANTPMDADKIKVFGS+++VD+  KIA+LE AEKQKMKEKVE I KH  N FINRQLIYNYPEQLF+  G+MAIEHADFEGVERL+LVTGG+I STF  P   KLG C  IEE+MIGED+L+ FSG A+ EACT+V+RGATQ ILDEAERSLHDALCV+ QTVK+ R++NGGGA+E+LMA AVS+LAA+TPGKEA A+E+F+ ALR LP IIADN G+DS+DLVA+LRA HT+G + YGL+MVNG + DM  LGITESY+VK+QVL +AAEAAEMIVRVDNI+KAAPRQR G   H
Sbjct:    1 MVSLNPVSILNQGAEEERAETARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILKSIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKFREDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLKGSGDLNAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQPKKIENAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFGRPDLVKLGTCKKIEEVMIGEDKLIHFSGCALNEACTVVIRGATQQILDEAERSLHDALCVLTQTVKETRTVNGGGASEVLMAHAVSQLAAKTPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKNTYGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNIVKAAPRQRGGDQCH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Match: EDO34983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT4])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 350/500 (70.00%), Postives = 412/500 (82.40%), Query Frame = 3
Query:  138 SSFVGAIAIGDLVKTTLGPKGMDKILLSGGSES-ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            SSFVGAIAIGDLVK+TLGPKGMDKIL S G    I VTNDGATILK+IG+DNPAAKILVE+SKVQDDEVGDGTTSV VLASELL+EAE+L+S K+HPQT+++GWRK+   A  AL+ +A   +  P  F D+LMNIARTTLSSKIL QH+D FAKLAVDAV RLKGSG+L  IQIIKKLGG + DS+LDEGFLL+KK+GVNQPK+IENAKILIANTPMDADK+KVFGS+++VD+  KIAELE+AEKQKMK+KVE I KHG N F+NRQLIYNYPEQLF+  G+MAIEHADFEGVERL+LVTGG+I STF  P   KLG C  IEE+MIGED+L+ FSG A+ EACT+V+RGATQ ILDEAERSLHDALCV+ QTVK+ R++NGGG + +++A               I +      L+ LP IIADN G+DS+DLVA+LRA HT+G + YGL+MVNG + DM  LGITESY+VK+QVL +AAEAAEMIVRVDNI+KAAPR
Sbjct:    1 SSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGDIQVTNDGATILKAIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLASELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKFRDDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLKGSGDLNAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQPKKIENAKILIANTPMDADKVKVFGSRVRVDSTAKIAELEKAEKQKMKDKVEMIIKHGINCFVNRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFSRPDLVKLGTCKKIEEVMIGEDKLIHFSGCALNEACTVVIRGATQQILDEAERSLHDALCVLTQTVKETRTVNGGGTSVVVIATVF------------IFLSCLYWCLQ-LPTIIADNAGYDSADLVAKLRAAHTQGKNTYGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNIVKAAPR 487          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Match: EDO28949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T514])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 322/457 (70.46%), Postives = 386/457 (84.46%), Query Frame = 3
Query:  264 ILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            +LK +   N  + + +E+SKVQDDEVGDGTTSV VL SELL+EAE+L+S ++HPQT+++GWRK+   A  AL+ +A   +  P  F ++LMNIARTTLSSKIL QH+D FAKLAVDAV RLKGSG+L  IQIIKKLGG + DS+LDEGFLL+KK+GVNQPK+IENAKILIANTPMDADKIKVFGS+++VD+  KIA+LE AEKQKMKEKVE I KH  N FINRQLIYNYPEQLF+  G+MAIEHADFEGVERL+LVTGG+I STF  P   KLG C  IEE+MIGED+L+ FSG A+ EACT+V+RGATQ ILDEAERSLHDALCV+ QTVK+ R++NGGGA+E+LMA AVS+LAA+TPGKEA A+E+F+ ALR LP IIADN G+DS+DLVA+LRA HT+G + YGL+MVNG + DM  LGITESY+VK+QVL +AAEAAEMIVRVDNI+KAAPR
Sbjct:    1 MLKFLEKPNICSLLFLELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCRIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKFREDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLKGSGDLNAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQPKKIENAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFGRPDLVKLGTCKKIEEVMIGEDKLIHFSGCALNEACTVVIRGATQQILDEAERSLHDALCVLTQTVKETRTVNGGGASEVLMAHAVSQLAAKTPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKNTYGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNIVKAAPR 457          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 290.812 bits (743), Expect = 2.297e-91
Identity = 178/531 (33.52%), Postives = 290/531 (54.61%), Query Frame = 3
Query:   84 IQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNI----ARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLP 1652
            I +L  G D  +     +S+      I D V+TTLGP+GMDK+++ G  ++ T++NDGATI+  + + +PAAK LV+++K QD EVGDGTTSV +L  E L++ +Q + + +HPQ ++  +RKA   A+LA+K+    +         E+  +    A T LSSK++   K+ FAK+ VDAV  L     L+ I + K  GG L DS L EG   +K         QPK   + KI + N  ++  K +   +++++D V     + +AE   + +K++K+ K G  V +++  I +   Q F+ + +        E ++R     GG I ++ +   +  LG CDL EE  +G +R   FSG      CTI++RG  +  ++E ERSLHDA+ ++++ +K+   + GGGA EM ++  +   +    GKE + I A ++A   +P  + DN GFD+++++ +LR KH +G   YG+D+    I D  +  + E   VK   +TAA EA+ +I+ VD  IK       G P
Sbjct:    5 IILLKEGTDASQGIPQLISNIDACQFIADAVRTTLGPRGMDKLIVDGRGKA-TISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKA---ANLAIKRIKELAVHVKKNDAGEMRQLLERCAATALSSKLIATQKEFFAKMVVDAVMMLDELLPLDMIGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVELEL-KAEKENAEVRLDNVKDYQSIVDAEWDILYDKLDKVVKSGAKVVLSKLPIGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDVLGRCDLFEEKQVGGERYNFFSGCKQSTTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQGGQWYGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETIKNPKSGGDGPP 530          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Match: EDO39756 (T-complex protein 1 subunit alpha [Source:UniProtKB/TrEMBL;Acc:A7S924])

HSP 1 Score: 274.633 bits (701), Expect = 1.133e-85
Identity = 175/490 (35.71%), Postives = 274/490 (55.92%), Query Frame = 3
Query:  237 ITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGN-------LETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGD-IASTFDCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQR 1640
            +TVTNDGATILK + V++PAAKIL E++ +QD EVGDGTTSVV+LA+ELL+ A +L+ QK+HP ++ISG+R AC EA   +++    S        D +++ A T LSSK++ Q  D FA + VDAV  +K +GN       ++ I ++K  GG   +S L +G+ L   +     PK++ NAKI   +  +   K+   G  + VD   K+  + + E    KE+++KI   G NV ++   I +   + F   G MA+       ++R++  TG   + S  +  GE     + LG  + + +  I +D L+   G     + +I+LRGA   +LDE ERS+HDA+CV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+ +L  +P I++ N   DS+DLVA+LRA H     N         GLD+V G + D  K G+ E    K + L  A EAA  I+R+D++IK  P ++
Sbjct:    2 VTVTNDGATILKLLEVEHPAAKILCELADLQDQEVGDGTTSVVILAAELLKGANELVKQKIHPTSIISGYRLACKEACKYIQEHMTISVD--ELGRDCIVSAANTALSSKLIGQQGDFFANMIVDAVMAVKRTGNKGEAKYPIKAINVLKAHGGSAKESILVDGYALNCTIASQAMPKQVTNAKIACLDFTLQKAKMH-LGVSVVVDDPEKLEAIRKRESDITKERIQKILASGANVVLSTGGIDDLCLKYFVECGAMAVRRVKKGDLKRIARSTGATMVLSLANLEGEESFDASMLGQAEEVCQQRICDDELIVIKGTKARSSSSIILRGANDYMLDEMERSMHDAICVVKRVLESKTLVPGGGAVEAALSIYLENFATSLGSREQLAIAEFANSLLVIPKILSVNAAKDSADLVAKLRAFHNTSQINAERSHLKWIGLDLVEGTVRDNKKAGVFEPAICKIKSLKFATEAAITILRIDDMIKLTPEKK 488          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 382/530 (72.08%), Postives = 457/530 (86.23%), Query Frame = 3
Query:   72 SLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGG-SESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            S+AP+ I   GADEE+AETAR+SSFVGAIAIGDLVK+TLGPKGMDKILLSGG S ++TVTNDGATILK+IGVDNPAAK+LV+MSKVQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+ISGWRKA   A  AL+++A   +  P+ F+++L+NIARTTLSSK+LT HK  F++LAVDAV RLKGSGNLE I +IKKLGG L+DSYLDEGFLL+KK+GVNQPKR+ENAKILIANT MD DKIK+FGS+++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+I STF+ P   KLG C LIEE+MIGED L+ FSGVA+GEACT+VLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GGG +EMLMA AV  LA RTPGKEA+A+E+F++AL  LP IIADN G+DS+DLVAQLRA H E    +GL+M  G + DM +LGITES++VK+Q+L +A+EAAEMI+RVDNIIKAAPR+R  +PDH
Sbjct:    5 SMAPVNIFRSGADEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHPQTIISGWRKATQTAREALREAAADHSNDPARFQEDLLNIARTTLSSKLLTHHKAHFSQLAVDAVMRLKGSGNLEAIHVIKKLGGSLTDSYLDEGFLLDKKIGVNQPKRLENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAQAGVMAIEHADFAGVERLALVTGGEITSTFEHPELVKLGQCKLIEEVMIGEDMLIHFSGVAMGEACTVVLRGATQQILDEAERSLHDALCVLAQTVKEPRTVYGGGCSEMLMAKAVIDLANRTPGKEAVAMESFAKALTMLPTIIADNAGYDSADLVAQLRAAHQENKTTFGLNMYQGTVGDMVELGITESFQVKRQMLLSASEAAEMILRVDNIIKAAPRKR--VPDH 532          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Match: cct2 (chaperonin containing TCP1 subunit 2 [Source:NCBI gene;Acc:101158813])

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 274/423 (64.78%), Postives = 329/423 (77.78%), Query Frame = 3
Query:   75 LAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGG-SESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLM----ADAVSKL 1328
            +AP+ I   GADEE+AETAR+SSFVGAIAIGDLVK+TLGPKGMDKILLSGG S ++TVTNDGATILK+IGVDNPAAK+LV+MSKVQDDEVGDGTTSV VLA+ELLREAE LI++K+HPQT+ISGWRKA   A  AL+++A   +  P+ F+++L+NIARTTLSSK+LT HK  F++LAVDAV RLKGSGNLE I +IKKLGG L+DSYLDEG +  ++                                ++VD+  K+AE+E AEK+KMKEKVE+I KHG N FINRQLIYNYPEQLF+  G+MAIEHADF GVERL+LVTGG+I STF+ P   KLG C LIEE+MIGED L+ FSGVA+GEACT+VLRGATQ ILDEAERSLHDALCV+ QTVK+ R++ GG     ++    ADA  +L
Sbjct:    1 MAPVNIFRSGADEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSGGKSGTVTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLIAKKIHPQTIISGWRKATQTAREALREAAADHSNDPARFQEDLLNIARTTLSSKLLTHHKAHFSQLAVDAVMRLKGSGNLEAIHVIKKLGGSLTDSYLDEGEVAARR-----------------------------WKTVRVDSTAKVAEIELAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFAQAGVMAIEHADFAGVERLALVTGGEITSTFEHPELVKLGQCKLIEEVMIGEDMLIHFSGVAMGEACTVVLRGATQQILDEAERSLHDALCVLAQTVKEPRTVYGGARHHRVLPGEAADAAERL 394          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:101173660])

HSP 1 Score: 310.457 bits (794), Expect = 3.994e-98
Identity = 185/523 (35.37%), Postives = 300/523 (57.36%), Query Frame = 3
Query:   81 PIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELM-NIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPR 1634
            P+ +L  G D  +     +S+      I + V+TTLGP+GMDK+++    ++ T++NDGATILK + V +PAAK LV++++ QD EVGDGTTSV +LA+E LR+ +  + + LHPQT+I  +R A   A   +K+ A S  +     + +L+   A T L+SK++   K+ F+K+ VDAV  L    +L+ I I K  GG L DS L  G   +K         QPKR +N KI + N  ++  K +   ++++V +V +   + +AE   + +K+EKI + G  V +++  I +   Q F+ + +        E ++R  +  GG I ++     E  LG C++ EE+ +G +R   F G    + CTI+LRG  +   +E ERSLHDA+ ++++ +K+   + GGGA EM ++  +   +   PGK+ + I A+++AL  +P  + DN GFD+++++ +LRAKH +G   YG+D+ N  I D     + E   V+   LTAA+EAA +I+ VD  IK  PR
Sbjct:   32 PVILLKEGTDSSQGIPQLVSNINACQVIAEAVRTTLGPRGMDKLMVDARGKA-TISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLRQLKPFVEESLHPQTIIRAFRTATNLAVSKIKEIAVSVKKDDKQEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMSLDELLSLKMIGIKKVQGGALEDSQLVSGVAFKKTFSYAGFEMQPKRYDNPKIALLNVELEL-KAEKDNAEVRVKSVEEYQAIVDAEWNILYDKLEKIYQSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGALTEDVLGLCEVFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFTEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQGGMWYGVDINNEDIADNFAAFVWEPSIVRINALTAASEAACLILSVDETIK-NPR 551          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 295.049 bits (754), Expect = 2.408e-92
Identity = 186/530 (35.09%), Postives = 298/530 (56.23%), Query Frame = 3
Query:  123 ETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK-------GSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN-QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTF-DCPGE-----TKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHN--------YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRG 1646
            E+ R  + + A +I ++VK++LGP G+DK+L+    + +T+TNDGATILK + V++PAAK+L E++ +QD EVGDGTTSVV+LA+ELL+ A++L+ QK+HP +VI+G+R AC EA   + ++            + L+N A+T++SSKI+    D FA + VDA   +K           + ++ ++K  G    +S+L  G+ L   VG     KRI NAKI   +  +   K+K  G ++ +    K+ ++ + E    KE+++KI   G NV +    I +   + F   G MA+       ++R++  TG  +  +  +  GE     T LG  + + +  I +D L+      V  + +I+LRGA   + DE ERS+HDALCV+++ ++ +  + GGGA E  ++  +   A     +E +AI  F+R+L  +P  +A N   DS+DLVA+LRA H E   N         GLD++NGK  D  + G+ E   VK + L  A EAA  I+R+D++IK  P  + G
Sbjct:   18 ESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGD-VTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTD--DLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMK-MGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTTGGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVRSSASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPEPKEG 543          
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 270.781 bits (691), Expect = 2.190e-83
Identity = 175/518 (33.78%), Postives = 285/518 (55.02%), Query Frame = 3
Query:  108 DEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE--LMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSG-NLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVF-----INRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMI-GEDRLLKFSGVA-VGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNII 1619
            D ++    R S+   A A+ D V+T+LGPKGMDK++     + +T+TNDGATILK + V +P+AK+LVE+SK QD E GDGTTSVV++A  LL    +L+ + +HP  +   ++KA  +    L   +R     P    D   L+N A T+L SK+++Q+    A ++VDAV R+      +G +L  I+IIKKLGG + D  L EG +L ++V      R+E AKI +    +   K     ++I V    ++  +   E+  +   V+++ K GCNV      I R  + +      +   IM ++  + E +E +    G    +  D      LG  +L EEI + G  +L+K +G +  G+  +IV+RG+ + ++DEAERS+HDALCVI+  VK +  I GGGA E+ +A  +++ +    G EA  + A+  AL  +P+ +A+N G +    V +LR KH +GD   G+++  G I ++ +  + +   V    LT A E    I+++D+++
Sbjct:   23 DRDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGD-VTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSR-----PVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVASTGVTRVEKAKIGLIQFCLSPPKTD-MDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVV 533          
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Match: SMESG000016726.1 (SMESG000016726.1)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 531/531 (100.00%), Postives = 531/531 (100.00%), Query Frame = 3
Query:   66 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 1658
            MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH
Sbjct:    1 MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH 531          
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Match: SMESG000067696.1 (SMESG000067696.1)

HSP 1 Score: 288.886 bits (738), Expect = 3.293e-90
Identity = 184/535 (34.39%), Postives = 300/535 (56.07%), Query Frame = 3
Query:   93 LSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSGN----LETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIAST---------FDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDH--------NYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIK 1622
            L+ G +    +  R  + + +  I ++VKT+LGP G+DK+L+    E +T++NDGATILK + V++PAAKILVE++++QD+EVGDGTTSVV++A+ELL+ AE+ I QK+HP T+ISG+R AC EA   L+ +   +       ++ + + A+T++SSK++    D FA +AV+A   +K   G G     ++ I ++K  G  + +S L  G+ L   +   Q P+ I+ AKI + +  +   K+K  G ++ V    K+ E+ + E    KEK+EKI K G NV +    I +   + F     MA+       ++R++  TGG +  +         FD   +  LGY + + +  I +D L+   G     A +++LRGA    +DE ERS+HD+ CV+++ ++ +  + GGGA E  +   + K A     +E IAI  F++AL  +P  +A N   DS+++VA+LRA H              YGLD+ N  + +  + GI E    K + L  A EAA  I+R+D+++K
Sbjct:    9 LAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGE-VTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNL--TIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKAINVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLK-LGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFD---QANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVK 536          
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Match: SMESG000079886.1 (SMESG000079886.1)

HSP 1 Score: 286.96 bits (733), Expect = 1.449e-89
Identity = 179/525 (34.10%), Postives = 294/525 (56.00%), Query Frame = 3
Query:   78 APIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE----LMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVN----QPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAA 1628
            A I +L  G D  +     MS+     +I + V+TTLGP+GMDK+++   S++ T++NDGATILK + V +P A  +V+++  QDDEVGDGTTSV++LASE L++A+  I + +HP+ +   ++KA   + LAL      S +     E E    L   A T LSSK++  +KD F+KL VDAV+ L     L+ I I K  GG L DS L  G   +K         QPK     KI + N  ++    K   ++I+V++V +   + +AE Q + +K+E I K G  + +++  I +   Q F+ + +        E ++R     GG I +T     E  LG CD  EE+ IG +R   F G    + CTI+LRG ++  ++E ERSLHDA+ ++++ +K+   + GGGA +M ++  +   + +  G++ + I A +++   +P  + +N GFD+++++ +LR KH++G    G+D++N  + D  +  + E   VK   +TAA EAA M++ +D  I+ A
Sbjct:    5 AQIVLLKEGTDTSQGIPQIMSNITAIQSIAEAVRTTLGPRGMDKLIIDEKSKA-TISNDGATILKLLDVIHPVAGTVVQIALSQDDEVGDGTTSVMLLASEFLKQAKPFIEEGVHPELIQKAYKKA---SKLALSYLNELSVKIEEGNEVERRSLLEKCASTALSSKLVATYKDFFSKLVVDAVSSLDHLLPLDMIGIKKVPGGSLQDSQLISGVAFKKTFSYAGFEMQPKSYVKPKISLLNIELELKSEKE-NAEIRVNSVEEYQRIVDAEWQILYDKLEAIYKSGAKIVLSKLPIGDVATQYFADRDMFCAGRVSEEDLKRTMAACGGGIQTTVKDITEDTLGKCDSFEEVQIGGERFNIFVGCPEAKTCTIILRGGSEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIDMEISRYLRDYSRKILGRDQLFISAMAKSFEIIPRQLCENAGFDATNILNKLRQKHSQGKIWCGVDILNEDVADNFEACVWEPALVKSNAITAATEAACMVLTLDETIRNA 524          
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Match: SMESG000012740.1 (SMESG000012740.1)

HSP 1 Score: 281.182 bits (718), Expect = 2.330e-87
Identity = 186/527 (35.29%), Postives = 300/527 (56.93%), Query Frame = 3
Query:   81 PIQILSRGADEERAET-----ARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE--LMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKH-TEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 1616
            P+ IL    DEE+ +      A  S  + A  + ++++T+LGPKG+DKI+++  ++ ITVTNDG TI++ + V++  AK++VE+SK QDDE+GDGTT VVVLA  LL +AEQL+ + +HP  +  G+  A   A L L++  + S QF  + E++  L+  A TTL SKI+ +   +FA++AV A+  +    +   + E I++  K+GG LSDS L +G +++K     Q PK I++AKI I     +  K K     + V+TV     L + E  K  E V+++   G N+ I +    +    L   K + A+       +E +++ TGG I   F+     KLG   ++ E+  G  +D++L        +A T  +RG ++ I+DEA+RSLHDALCV++  V+D R + GGGA+E+  + AVS  A + PG E  A+ AF+ AL A+P  +++N G  S   VA+L+A+   E +   G+D       DM +  + E+   KK  +  A +  +MI+++D+I
Sbjct:   17 PLVILR---DEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDND-ITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMA---AKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKT-KHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 535          
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Match: SMESG000050684.1 (SMESG000050684.1)

HSP 1 Score: 277.715 bits (709), Expect = 5.296e-86
Identity = 183/540 (33.89%), Postives = 303/540 (56.11%), Query Frame = 3
Query:   93 LSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLK---GSGN----LETIQIIKKLGGLLSDSYLDEGFLLEKKV-GVNQPKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDI---ASTFDCPGETK----LGYCDLIEEIMIGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKH-----TEGDHN---YGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNIIKAAPRQRR 1643
            LS   D    +  R  + + A+ + +++K++LGP G+DK+L+    E +T++NDGATILK + V++PAAKILVE++++QDDEVGDGTTSVV++A+ELL+ AE+ +S K+HP  +ISG+R AC EA   +  +            + ++N A+T++SSK++    + FAK+AV+A   +K   G G     + +I I+K  G  + +S +  G+ +   V  +  P+ I  AKI + +  +   ++K  G +I V    K+ E+ + E    KE++EKI K G NV +    I +   + F     MA+       ++R++  TGG +    ST D   E+     LG  + + +  + +D ++         A +I+LRGA    +DE ERS+HDALCVI++ ++ +  + GGGA E+ ++  +   A     KE IAI  ++R+L  +P  +A N   DS++L++QL+A H      EG  +    GLD+ N  I +    GI E   +K + L  A EAA  I+R+D+++K    +R+
Sbjct:    9 LSIDGDRTTGDNIRRQNVLAAVTVANIIKSSLGPVGLDKMLVDDVGE-VTISNDGATILKLLEVEHPAAKILVELAQLQDDEVGDGTTSVVLIAAELLKNAEEQVSGKIHPTILISGYRIACREACKYIMNNL--VLNVDDLGPECIINAAKTSMSSKLIGVDSNFFAKMAVEAAMAVKTPNGDGTFYYPINSINILKAHGKSMRESEIVNGYAINCTVSSLQMPRYINKAKIALLDFNLQKTRLK-LGVQILVTDPDKLDEIRKRESDITKERIEKILKAGANVILTTGGIDDLCMKYFVESNTMAVRRCKKVDLKRIAKATGGSLLCTMSTLDKEEESYDPSMLGEAEEVFQRRVCDDEMIIIKNTKTRSAASILLRGANDFYVDEMERSMHDALCVIKRVLESKSVVPGGGACEVALSVFLEDFATTIGSKEQIAIAEYARSLLTIPKQLAVNASLDSTELLSQLQASHHSSQNEEGKSDLKWMGLDLQNCTIANNKAAGIFEPTMIKIKSLKFATEAAITILRIDDLVKLKEEKRQ 544          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT20.000e+073.21chaperonin containing TCP1 subunit 2 [Source:HGNC ... [more]
CCT20.000e+072.69chaperonin containing TCP1 subunit 2 [Source:HGNC ... [more]
CCT20.000e+073.22chaperonin containing TCP1 subunit 2 [Source:HGNC ... [more]
CCT20.000e+074.75chaperonin containing TCP1 subunit 2 [Source:HGNC ... [more]
CCT71.022e-9835.54chaperonin containing TCP1 subunit 7 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-20.000e+066.67T-complex protein 1 subunit beta [Source:UniProtK... [more]
cct-20.000e+066.67T-complex protein 1 subunit beta [Source:UniProtK... [more]
cct-20.000e+066.67T-complex protein 1 subunit beta [Source:UniProtK... [more]
cct-43.671e-8936.33T-complex protein 1 subunit delta [Source:UniProt... [more]
cct-43.671e-8936.33T-complex protein 1 subunit delta [Source:UniProt... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT20.000e+068.55gene:FBgn0030086 transcript:FBtr0071289[more]
CCT14.886e-8733.33gene:FBgn0003676 transcript:FBtr0084290[more]
CCT14.886e-8733.33gene:FBgn0003676 transcript:FBtr0084291[more]
CCT41.242e-8633.78gene:FBgn0032444 transcript:FBtr0080411[more]
CCT71.841e-8434.80gene:FBgn0037632 transcript:FBtr0081918[more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct26.989e-13768.77chaperonin containing TCP1, subunit 2 (beta) [Sour... [more]
tcp13.953e-9534.61t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp14.041e-9534.61t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
cct77.660e-9534.61chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct53.965e-8634.59chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiaa05860.000e+072.26KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458][more]
kiaa05860.000e+067.30KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458][more]
kiaa05860.000e+072.78KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458][more]
kiaa05860.000e+073.89KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458][more]
kiaa05860.000e+060.73KIAA0586 [Source:Xenbase;Acc:XB-GENE-5929458][more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct20.000e+073.40chaperonin containing Tcp1, subunit 2 (beta) [Sour... [more]
Cct23.118e-10272.77chaperonin containing Tcp1, subunit 2 (beta) [Sour... [more]
Cct71.623e-9835.56chaperonin containing Tcp1, subunit 7 (eta) [Sourc... [more]
Tcp13.040e-9335.87t-complex protein 1 [Source:MGI Symbol;Acc:MGI:985... [more]
Cct51.542e-8534.46chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBH0|TCPB_BOVIN0.000e+073.21T-complex protein 1 subunit beta OS=Bos taurus OX=... [more]
sp|Q4R6F8|TCPB_MACFA0.000e+073.21T-complex protein 1 subunit beta OS=Macaca fascicu... [more]
sp|P78371|TCPB_HUMAN0.000e+073.21T-complex protein 1 subunit beta OS=Homo sapiens O... [more]
sp|P80314|TCPB_MOUSE0.000e+073.40T-complex protein 1 subunit beta OS=Mus musculus O... [more]
sp|Q5XIM9|TCPB_RAT0.000e+073.40T-complex protein 1 subunit beta OS=Rattus norvegi... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K1190.000e+076.50Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3S1CAN80.000e+075.56Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
V3ZDB10.000e+074.15Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7P6800.000e+075.14Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1R2940.000e+074.29T-complex protein 1 subunit beta OS=Crassostrea gi... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct20.000e+072.08chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct20.000e+073.89chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
tcp12.896e-9635.06t-complex 1 [Source:NCBI gene;Acc:103041096][more]
cct71.880e-9534.68chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct54.694e-8534.00chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002094.17.230e-10271.43pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
cct73.429e-8434.91chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct47.177e-8432.56chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct58.900e-8134.86chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
ENSPMAT00000002042.19.651e-4230.20pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT20.000e+064.29Subunit beta of the cytosolic chaperonin Cct ring ... [more]
CCT54.311e-8935.35Subunit of the cytosolic chaperonin Cct ring compl... [more]
TCP12.154e-8432.72Alpha subunit of chaperonin-containing T-complex; ... [more]
CCT77.147e-8432.38Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT41.847e-7132.05Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349810.000e+073.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349830.000e+070.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289490.000e+070.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486922.297e-9133.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397561.133e-8535.71T-complex protein 1 subunit alpha [Source:UniProt... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct20.000e+072.08chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct20.000e+064.78chaperonin containing TCP1 subunit 2 [Source:NCBI ... [more]
cct73.994e-9835.37chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
tcp12.408e-9235.09t-complex 1 [Source:NCBI gene;Acc:101175451][more]
cct42.190e-8333.78chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016726.10.000e+0100.00SMESG000016726.1[more]
SMESG000067696.13.293e-9034.39SMESG000067696.1[more]
SMESG000079886.11.449e-8934.10SMESG000079886.1[more]
SMESG000012740.12.330e-8735.29SMESG000012740.1[more]
SMESG000050684.15.296e-8633.89SMESG000050684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021699 ID=SMED30021699|Name=T-complex protein 1 subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=1727bp
TTTAATTATAAAAAATTCAAATATATCTTGACAACCTTTAGAATTTGCGA
GAATATATTAGTAGAATGTCTTCACTTGCCCCTATTCAAATTCTCAGCCG
AGGAGCCGATGAAGAACGTGCTGAAACAGCAAGAATGTCGTCTTTTGTTG
GTGCAATTGCTATTGGCGACTTAGTGAAAACTACTTTGGGCCCTAAAGGA
ATGGATAAAATTCTTCTCAGTGGTGGAAGTGAATCTATTACAGTCACAAA
CGACGGTGCCACAATTTTGAAATCCATTGGTGTTGACAACCCTGCTGCTA
AAATCTTAGTAGAAATGAGTAAGGTTCAAGATGATGAAGTTGGAGATGGA
ACTACATCAGTTGTAGTTCTTGCATCAGAATTACTTAGAGAGGCTGAACA
ATTAATTTCTCAAAAGTTACATCCACAAACTGTTATTTCTGGATGGCGCA
AAGCATGTGTTGAAGCATCTTTAGCATTGAAACAATCTGCTAGATCTAGC
GCTCAATTTCCATCTACATTTGAAGACGAATTAATGAACATTGCTAGAAC
AACTTTAAGCTCTAAAATCCTAACTCAACACAAGGATAAATTTGCAAAAT
TAGCAGTTGATGCGGTAACGCGCCTTAAAGGAAGTGGAAATCTAGAAACA
ATTCAAATTATAAAGAAACTAGGTGGTTTATTGTCAGATTCATATCTCGA
TGAAGGATTTTTGCTCGAGAAAAAGGTTGGAGTTAATCAACCAAAAAGGA
TTGAAAATGCCAAGATTTTAATTGCCAATACTCCTATGGATGCTGATAAG
ATTAAAGTTTTTGGAAGTAAAATTAAAGTAGACACAGTTACTAAAATTGC
TGAATTGGAAGAAGCTGAAAAACAAAAAATGAAAGAAAAGGTCGAAAAGA
TTGCCAAACATGGCTGCAACGTTTTTATTAATCGACAACTTATTTACAAT
TACCCTGAACAACTTTTTAGTATGAAAGGTATTATGGCAATTGAACACGC
GGACTTTGAAGGTGTTGAAAGACTATCTTTAGTGACTGGTGGTGATATTG
CTTCAACCTTTGATTGCCCCGGGGAAACTAAACTTGGATATTGTGATTTA
ATTGAGGAAATTATGATTGGAGAAGATCGTCTGTTGAAATTTAGTGGGGT
TGCAGTGGGAGAAGCCTGTACAATTGTATTAAGAGGAGCTACTCAAACTA
TTTTAGATGAAGCCGAAAGATCACTTCATGATGCTTTATGTGTAATACAA
CAAACTGTAAAAGATCAGAGAAGTATTAATGGAGGGGGTGCAGCTGAAAT
GCTTATGGCTGATGCTGTTAGCAAGCTTGCTGCTAGAACTCCTGGCAAGG
AAGCAATTGCAATTGAAGCATTTAGCCGTGCACTTCGTGCATTGCCTAAT
ATAATAGCCGATAATGGAGGTTTCGACAGCTCTGACTTGGTTGCTCAATT
GAGAGCTAAACACACCGAAGGTGACCATAATTACGGACTAGATATGGTAA
ATGGCAAAATAGAAGACATGACTAAATTGGGAATCACAGAATCCTACCGA
GTCAAAAAGCAAGTGCTAACCGCAGCTGCTGAAGCGGCAGAAATGATTGT
TCGTGTCGATAACATCATTAAAGCTGCTCCTAGACAGCGCAGAGGTCTAC
CTGATCATTAAAAAATGAGAGCTGATTGATAAAATTGTTTTGTTAATAAT
TACATAACTTGGTTCTTATTAAAAAAA
back to top

protein sequence of SMED30021699-orf-1

>SMED30021699-orf-1 ID=SMED30021699-orf-1|Name=SMED30021699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
MSSLAPIQILSRGADEERAETARMSSFVGAIAIGDLVKTTLGPKGMDKIL
LSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVV
VLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPS
TFEDELMNIARTTLSSKILTQHKDKFAKLAVDAVTRLKGSGNLETIQIIK
KLGGLLSDSYLDEGFLLEKKVGVNQPKRIENAKILIANTPMDADKIKVFG
SKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQL
FSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIM
IGEDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKD
QRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADN
GGFDSSDLVAQLRAKHTEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQV
LTAAAEAAEMIVRVDNIIKAAPRQRRGLPDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012716Chap_CCT_beta
IPR017998Chaperone_TCP-1
IPR002423Cpn60/TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR027413GROEL-like_equatorial_sf
IPR027410TCP-1-like_intermed_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
GO:0031625ubiquitin protein ligase binding
GO:0044183protein binding involved in protein folding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0050821protein stabilization
GO:0051086chaperone mediated protein folding independent of cofactor
GO:0051131chaperone-mediated protein complex assembly
GO:0051973positive regulation of telomerase activity
GO:0061077chaperone-mediated protein folding
GO:0090666scaRNA localization to Cajal body
GO:1901998toxin transport
GO:1904851positive regulation of establishment of protein localization to telomere
GO:1904871positive regulation of protein localization to Cajal body
GO:1904874positive regulation of telomerase RNA localization to Cajal body
GO:0006458'de novo' protein folding
GO:0007339binding of sperm to zona pellucida
GO:0032212positive regulation of telomere maintenance via telomerase
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:0002199zona pellucida receptor complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005832chaperonin-containing T-complex
GO:0005874microtubule
GO:0031012extracellular matrix
GO:0043209myelin sheath
GO:0044297cell body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 262..282
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 6..523
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 369..391
score: 38.59
coord: 403..415
score: 36.7
coord: 88..107
score: 54.66
coord: 58..76
score: 42.71
coord: 35..51
score: 53.86
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 144..401
e-value: 1.0E-185
score: 620.2
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 154..401
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 34..521
e-value: 6.2E-150
score: 500.1
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 213..365
e-value: 1.0E-185
score: 620.2
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 208..374
IPR012716T-complex protein 1, beta subunitTIGRFAMTIGR02341TIGR02341coord: 8..525
e-value: 2.5E-274
score: 908.6
IPR012716T-complex protein 1, beta subunitPANTHERPTHR11353:SF23T-COMPLEX PROTEIN 1 SUBUNIT BETAcoord: 6..523
IPR012716T-complex protein 1, beta subunitCDDcd03336TCP1_betacoord: 9..524
e-value: 0.0
score: 930.587
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 32..519
e-value: 1.0E-185
score: 620.2
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 16..521
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 60..76
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 38..50
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 88..96