14-3-3 protein epsilon

Overview
Name14-3-3 protein epsilon
Smed IDSMED30021698
Length (bp)971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 14-3-3 protein epsilon (SMED30021698) t-SNE clustered cells

Violin plots show distribution of expression levels for 14-3-3 protein epsilon (SMED30021698) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 14-3-3 protein epsilon (SMED30021698) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 14-3-3 protein epsilon (SMED30021698) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021698

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021698SMESG000047644.1 Contig5316GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30021698SMESG000047644.1 Contig5316GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021698SMESG000047644.1 Contig5316GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30021698SMESG000047644.1 Contig5316GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021698SMESG000047644.1 dd_Smed_v4_36_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30021698SMESG000047644.1 dd_Smed_v6_36_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 343.969 bits (881), Expect = 7.210e-119
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 343.969 bits (881), Expect = 7.210e-119
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 310.842 bits (795), Expect = 4.525e-106
Identity = 152/216 (70.37%), Postives = 178/216 (82.41%), Query Frame = 3
Query:  117 MVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            MV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 216          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAE (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:HGNC Symbol;Acc:HGNC:12851])

HSP 1 Score: 310.842 bits (795), Expect = 4.525e-106
Identity = 152/216 (70.37%), Postives = 178/216 (82.41%), Query Frame = 3
Query:  117 MVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            MV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 216          
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Match: YWHAB (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:HGNC Symbol;Acc:HGNC:12849])

HSP 1 Score: 301.982 bits (772), Expect = 1.997e-102
Identity = 146/244 (59.84%), Postives = 188/244 (77.05%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 788
            D+   V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E ++  +  + K YR ++E EL+++C D++ LLD++++  A+  E+KVF+LKMKGDY+RYLSE    + ++    NS  AY+EA  I++ ++QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTS+   DE    E  N
Sbjct:    4 DKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE-RNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 311.612 bits (797), Expect = 1.261e-106
Identity = 151/244 (61.89%), Postives = 194/244 (79.51%), Query Frame = 3
Query:   51 MTD-RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDE 779
            M+D +E  V RAKLAEQAERYD+M  +M+ V ++  EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  + K YR +VEKEL+++C D+++LLD+ ++  A   E+KVF+LKMKGDYYRYL+E    ++R +  E S  +Y+EA  IA+  +QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSDA  D+   +E
Sbjct:    1 MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQ-QMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANE 243          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 311.612 bits (797), Expect = 1.261e-106
Identity = 151/244 (61.89%), Postives = 194/244 (79.51%), Query Frame = 3
Query:   51 MTD-RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDE 779
            M+D +E  V RAKLAEQAERYD+M  +M+ V ++  EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  + K YR +VEKEL+++C D+++LLD+ ++  A   E+KVF+LKMKGDYYRYL+E    ++R +  E S  +Y+EA  IA+  +QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSDA  D+   +E
Sbjct:    1 MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQ-QMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANE 243          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 311.612 bits (797), Expect = 1.261e-106
Identity = 151/244 (61.89%), Postives = 194/244 (79.51%), Query Frame = 3
Query:   51 MTD-RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDE 779
            M+D +E  V RAKLAEQAERYD+M  +M+ V ++  EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  + K YR +VEKEL+++C D+++LLD+ ++  A   E+KVF+LKMKGDYYRYL+E    ++R +  E S  +Y+EA  IA+  +QPTHPIRLGLALNFSVF+YEILN+ D+ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSDA  D+   +E
Sbjct:    1 MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQ-QMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANE 243          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 309.301 bits (791), Expect = 1.107e-105
Identity = 154/242 (63.64%), Postives = 188/242 (77.69%), Query Frame = 3
Query:   72 VYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDA---DQDEKACDEENN 788
            V RAKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  L K YR +VE+EL ++C D++ LLDE ++V A   E+KVF+LKMKGDYYRYL+E   ++ R A  E S  AY+EA  IA+  +QPTHPIRLGLALNFSVFYYEILN+ + ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD    DQ+++   E  N
Sbjct:    9 VQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQ-QLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASED-RAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN 248          
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 309.301 bits (791), Expect = 1.107e-105
Identity = 154/242 (63.64%), Postives = 188/242 (77.69%), Query Frame = 3
Query:   72 VYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDA---DQDEKACDEENN 788
            V RAKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  L K YR +VE+EL ++C D++ LLDE ++V A   E+KVF+LKMKGDYYRYL+E   ++ R A  E S  AY+EA  IA+  +QPTHPIRLGLALNFSVFYYEILN+ + ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD    DQ+++   E  N
Sbjct:    9 VQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQ-QLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASED-RAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN 248          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083566)

HSP 1 Score: 352.443 bits (903), Expect = 2.308e-122
Identity = 174/247 (70.45%), Postives = 207/247 (83.81%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD--ADQDEKACDEE 782
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI++SIEQK E K    +L +IK YR QVEKEL+++C+DI+++L++H++  A+ GE+KVF+ KMKGDY+RYL+EF   ++RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD  A+ D  A D E
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEVDPNAGDGE 247          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083565)

HSP 1 Score: 352.058 bits (902), Expect = 3.391e-122
Identity = 170/239 (71.13%), Postives = 203/239 (84.94%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI++SIEQK E K    +L +IK YR QVEKEL+++C+DI+++L++H++  A+ GE+KVF+ KMKGDY+RYL+EF   ++RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   +E
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEE 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083568)

HSP 1 Score: 351.288 bits (900), Expect = 5.403e-122
Identity = 173/246 (70.33%), Postives = 206/246 (83.74%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDAD-QDEKACDEE 782
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI++SIEQK E K    +L +IK YR QVEKEL+++C+DI+++L++H++  A+ GE+KVF+ KMKGDY+RYL+EF   ++RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   +D  A D E
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEDPNAGDGE 246          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3epsilon (gene:FBgn0020238 transcript:FBtr0083567)

HSP 1 Score: 350.517 bits (898), Expect = 8.668e-122
Identity = 169/234 (72.22%), Postives = 201/234 (85.90%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI++SIEQK E K    +L +IK YR QVEKEL+++C+DI+++L++H++  A+ GE+KVF+ KMKGDY+RYL+EF   ++RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088413)

HSP 1 Score: 312.768 bits (800), Expect = 5.861e-107
Identity = 151/237 (63.71%), Postives = 188/237 (79.32%), Query Frame = 3
Query:   54 TDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
             D+E  V +AKLAEQ+ERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E     +  L + YR +VEKEL+E+C +++ LLD++++  AS  E+KVF+LKMKGDYYRYL+E    + R    ++S  AY+EA  IA++ +QPTHPIRLGLALNFSVFYYEILNS D+ACQLAK+AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD   DE
Sbjct:    4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE-ASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDE 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 352.443 bits (903), Expect = 2.253e-122
Identity = 173/238 (72.69%), Postives = 198/238 (83.19%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMVD+M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA +DLQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 352.443 bits (903), Expect = 2.253e-122
Identity = 173/238 (72.69%), Postives = 198/238 (83.19%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMVD+M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA +DLQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-779])

HSP 1 Score: 352.443 bits (903), Expect = 2.253e-122
Identity = 173/238 (72.69%), Postives = 198/238 (83.19%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMVD+M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA +DLQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MGDREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhae2 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050306-44])

HSP 1 Score: 342.043 bits (876), Expect = 2.940e-118
Identity = 167/238 (70.17%), Postives = 199/238 (83.61%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M++VA    +L++EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K  + +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+E+SYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MADREHLVYQAKLAEQAERYDEMVESMKNVAGKDEDLSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGADKLKMIREYRQTVENELKSICNDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDIQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 307.375 bits (786), Expect = 8.846e-105
Identity = 145/235 (61.70%), Postives = 190/235 (80.85%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            DR   + +AKLAEQAERYD+M   M+ V +   EL+ EERNLLSVAYKNV+G+RR++WR++SSIEQK E  D  +L ++K YR +VE EL+++C D++ LL+++++  +S  E+KVF+LKMKGDYYRYL+E    +++KA  ENS  AY++A  I+++++QPTHPIRLGLALNFSVF+YEILNS ++AC LAK+AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    2 DRTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGND-KKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLKMKGDYYRYLAEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNAPD 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 343.969 bits (881), Expect = 4.003e-119
Identity = 170/239 (71.13%), Postives = 198/239 (82.85%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            M +RE  VYRAKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D+
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDD 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 344.354 bits (882), Expect = 4.658e-119
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M +RE  VYRAKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:493518])

HSP 1 Score: 343.969 bits (881), Expect = 4.745e-119
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M +RE  VYRAKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVEAELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 300.827 bits (769), Expect = 5.155e-102
Identity = 146/238 (61.34%), Postives = 189/238 (79.41%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKA 770
            D+   V +AKL+EQAERYD+M  +M+ V ++  EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  D  R  + + YR +VE EL+++C D++ LLD++++  A+  E+KVF+LKMKGDYYRYLSE    + ++     S  AY+EA  I++S++QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTS+ +Q E+A
Sbjct:    3 DKSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGND-KRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATPPESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSE-NQGEEA 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Match: insm1 (insulinoma associated 1 [Source:Xenbase;Acc:XB-GENE-993149])

HSP 1 Score: 296.975 bits (759), Expect = 1.734e-100
Identity = 148/249 (59.44%), Postives = 188/249 (75.50%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQK-AEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGG--EAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 788
            M DRE  V +A+LAEQAERYD+M  AM+ V ++   L+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK +   +  ++ +++AYR ++EKEL+ VC D++SLLD  ++   S    E+KVF+LKMKGDYYRYL+E     +R    E+S  AY EA  I++  +QPTHPIRLGLALN+SVFYYEI N+ ++AC LAK AFDDAI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD   D+    E NN
Sbjct:    1 MVDREQLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNFLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGG--EGNN 247          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhae (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [Source:MGI Symbol;Acc:MGI:894689])

HSP 1 Score: 343.969 bits (881), Expect = 4.950e-119
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide [Source:MGI Symbol;Acc:MGI:1891917])

HSP 1 Score: 303.138 bits (775), Expect = 4.313e-103
Identity = 146/244 (59.84%), Postives = 188/244 (77.05%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 788
            D+   V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E ++  +  + K YR ++E EL+++C D++ LLD+++++ A+  E+KVF+LKMKGDY+RYLSE      ++    NS  AY+EA  I++ ++QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTS+   DE    E  N
Sbjct:    4 DKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE-RNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:MGI Symbol;Acc:MGI:891963])

HSP 1 Score: 301.597 bits (771), Expect = 1.921e-102
Identity = 145/235 (61.70%), Postives = 185/235 (78.72%), Query Frame = 3
Query:   72 VYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACD 776
            + +AKLAEQAERYD+M   M+ V +   EL+ EERNLLSVAYKNV+G RR++WR++SSIEQK +  D  +L LIK YR +VE EL+ +C  ++ LLD++++  A+  E+KVF+LKMKGDY+RYL+E    ++RK   ENS  AY+EA  I++ ++QPTHPIRLGLALNFSVFYYEILN+ + AC LAK AFD+AI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD+  +E  CD
Sbjct:    7 IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSD-KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEE--CD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:MGI Symbol;Acc:MGI:891963])

HSP 1 Score: 301.597 bits (771), Expect = 1.921e-102
Identity = 145/235 (61.70%), Postives = 185/235 (78.72%), Query Frame = 3
Query:   72 VYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACD 776
            + +AKLAEQAERYD+M   M+ V +   EL+ EERNLLSVAYKNV+G RR++WR++SSIEQK +  D  +L LIK YR +VE EL+ +C  ++ LLD++++  A+  E+KVF+LKMKGDY+RYL+E    ++RK   ENS  AY+EA  I++ ++QPTHPIRLGLALNFSVFYYEILN+ + AC LAK AFD+AI ELD LNE+SYKDSTLIMQLLRDNLTLWTSD+  +E  CD
Sbjct:    7 IQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSD-KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEE--CD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 299.671 bits (766), Expect = 1.282e-101
Identity = 144/241 (59.75%), Postives = 186/241 (77.18%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDE 779
            D+   V +AKLAEQAERYD+M   M+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  +  + + YR ++E EL+++C D++SLL++ ++  AS  E+KVF+LKMKGDYYRYL+E    +++K   + S  AY+EA  I++ ++QPTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   DE    E
Sbjct:    2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQ-QMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGE 241          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P92177|1433E_DROME (14-3-3 protein epsilon OS=Drosophila melanogaster OX=7227 GN=14-3-3epsilon PE=1 SV=2)

HSP 1 Score: 352.058 bits (902), Expect = 3.399e-121
Identity = 170/239 (71.13%), Postives = 203/239 (84.94%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI++SIEQK E K    +L +IK YR QVEKEL+++C+DI+++L++H++  A+ GE+KVF+ KMKGDY+RYL+EF   ++RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   +E
Sbjct:    1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEE 239          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62262|1433E_SHEEP (14-3-3 protein epsilon OS=Ovis aries OX=9940 GN=YWHAE PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.463e-118
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62260|1433E_RAT (14-3-3 protein epsilon OS=Rattus norvegicus OX=10116 GN=Ywhae PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.463e-118
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62259|1433E_MOUSE (14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.463e-118
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Match: sp|P62258|1433E_HUMAN (14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.463e-118
Identity = 170/238 (71.43%), Postives = 197/238 (82.77%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DRE  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: H8YRY6 (14-3-3 epsilon-like transcript variant 1 OS=Penaeus vannamei OX=6689 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 1.693e-122
Identity = 176/234 (75.21%), Postives = 202/234 (86.32%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            MTDRE  VYRAKLAEQAERYDEMVDAM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR+QVEKELK++C+DI+ LLD+H++  AS GE++VFF KMKGDY+RYL+EF   N+RKAAAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS +RAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MTDREDNVYRAKLAEQAERYDEMVDAMKLVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEEKLEMIRNYRTQVEKELKDICSDILGLLDKHLIPTASAGESRVFFYKMKGDYHRYLAEFATGNDRKAAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPERACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A232F5J3 (14_3_3 domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_004136 PE=3 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 3.836e-122
Identity = 177/252 (70.24%), Postives = 209/252 (82.94%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN*ASCS 803
            MT+RE  VY+AKLAEQAERYDEMV+AM+ VA +  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YRSQVEKELK++CADI+ +L++H++  AS GE+KVF+ KMKGDY+RYL+EF + N+RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   DE   +  N+  + S
Sbjct:    1 MTEREDNVYKAKLAEQAERYDEMVEAMKKVASLDIELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEETKGAEEKLEMIRQYRSQVEKELKDICADILGVLEKHLIPCASTGESKVFYYKMKGDYHRYLAEFAIGNDRKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDENETEPPNDQGNAS 252          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: G8XR26 (14-3-3 epsilon OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.638e-122
Identity = 176/234 (75.21%), Postives = 202/234 (86.32%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            MTDRE  VYRAKLAEQAERYDEMVDAM+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR+QVEKELK++C+DI+ LLD+H++  AS GE++VFF KMKGDY+RYL+EF   N+RKAAAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS +RAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MTDREDNVYRAKLAEQAERYDEMVDAMKLVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEEKLEMIRNYRTQVEKELKDICSDILGLLDKHLIPTASAGESRVFFYKMKGDYHRYLAEFATGNDRKAAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPERACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: A0A0M8ZTX1 (14-3-3 protein epsilon OS=Melipona quadrifasciata OX=166423 GN=WN51_05097 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 8.015e-122
Identity = 176/238 (73.95%), Postives = 202/238 (84.87%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSR-LPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M++RE  VY+AKLAEQAERYDEMV+AM+ VA +  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K   R L +I+ YRSQVEKELK++CADI+ +LD+H+L  AS GE+KVF+ KMKGDY+RYL+EF V N+RK AAENSL AYK A+  A +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MSEREDNVYKAKLAEQAERYDEMVEAMKKVASLDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGAERKLEMIRQYRSQVEKELKDICADILGVLDKHLLPCASTGESKVFYYKMKGDYHRYLAEFAVGNDRKEAAENSLVAYKAASDTAMTDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Match: E2B527 (14-3-3 protein epsilon OS=Harpegnathos saltator OX=610380 GN=EAI_07742 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.488e-121
Identity = 174/238 (73.11%), Postives = 203/238 (85.29%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M++RE  VY+AKLAEQAERYDEMV+AM+ VA +  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YRSQVEKELK++CADI+ +LD+H++  AS GE+KVF+ KMKGDY+RYL+EF + N+RK AAENSL AYK A+ IA +DL PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MSEREDNVYKAKLAEQAERYDEMVEAMKKVASLDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGAEGKLEMIRQYRSQVEKELKDICADILGVLDKHLIPCASTGESKVFYYKMKGDYHRYLAEFAIGNDRKEAAENSLVAYKAASDIAMTDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:103034995])

HSP 1 Score: 350.903 bits (899), Expect = 4.241e-122
Identity = 172/239 (71.97%), Postives = 199/239 (83.26%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            M +RE  VY+AKLAEQAERYDEMVD+M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA +DLQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D+
Sbjct:    1 MANREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVETELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDD 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae1 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon [Source:NCBI gene;Acc:103034995])

HSP 1 Score: 350.517 bits (898), Expect = 1.252e-121
Identity = 172/238 (72.27%), Postives = 198/238 (83.19%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M +RE  VY+AKLAEQAERYDEMVD+M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VE ELK +C DI+ +LD+H++ AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA +DLQPTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 MANREDLVYQAKLAEQAERYDEMVDSMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQTVETELKSICNDILDVLDKHLIPAANSGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTDLQPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhae2 (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050306-44])

HSP 1 Score: 318.931 bits (816), Expect = 1.984e-109
Identity = 164/240 (68.33%), Postives = 186/240 (77.50%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEK 767
            M DRE  VY+AKLAEQAERYDEMV++M+ VA    EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VEKELK +C DI+              ++KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA  +L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D K
Sbjct:    1 MADREHFVYQAKLAEQAERYDEMVESMKSVAGKDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEDKLKMIREYRQTVEKELKSICNDIL--------------DSKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGK 226          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhaqb (14-3-3 protein beta/alpha-like [Source:NCBI gene;Acc:107197738])

HSP 1 Score: 308.916 bits (790), Expect = 1.755e-105
Identity = 145/231 (62.77%), Postives = 191/231 (82.68%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            DR   + +AKLAEQAERYD+M  +M++V +   EL+ EERNLLSVAYKNV+G+RR++WR++SSIEQK E  D  +L ++K YR +VE ELKE+C D++ LL+++++  ++  E+KVF+LKMKGDYYRYL+E    +++KA  ENS  AY++A  I+++++QPTHPIRLGLALNFSVF+YEILNS ++AC LAK+AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    2 DRTELIQKAKLAEQAERYDDMAASMKEVTEAGTELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGND-KKLQMVKEYREKVESELKEICNDVLELLNKYLIENSTNPESKVFYLKMKGDYYRYLAEVASGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Match: ywhabl (14-3-3 protein beta/alpha-A-like [Source:NCBI gene;Acc:103045356])

HSP 1 Score: 305.449 bits (781), Expect = 4.900e-104
Identity = 147/231 (63.64%), Postives = 189/231 (81.82%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            D+   V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  D  +  + K YR ++EKELKE+C D++ LLD++++  A+  E+KVF+LKMKGDY+RYL+E  + +++ A  +NS  AYK+A  I+++++QPTHPIRLGLALNFSVFYYEILNS ++AC+LAK AFD+AI ELD LNEESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    2 DKSELVQKAKLAEQAERYDDMAAAMKAVTEGDVELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGSDKKQ-QMAKEYREKIEKELKEICNDVLVLLDKYLIPKATPAESKVFYLKMKGDYFRYLAEVALGDDKIAIIQNSQDAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007337.1 (pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 gene:ENSPMAG00000006598.1 transcript:ENSPMAT00000007337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 348.591 bits (893), Expect = 1.674e-121
Identity = 169/241 (70.12%), Postives = 201/241 (83.40%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDP-SRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKA 770
            M +RE +VY+AKLAEQAERYDEMV+ M+ VA +  EL++EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L +I+ YR  VEKELK++C DI+ +LD+H++ AA  GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+E+SYKDSTLIMQLLRDNLTLWTSD   D +A
Sbjct:    1 MEEREDQVYQAKLAEQAERYDEMVEVMKKVAGLNTELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGSEGKLKIIREYRQTVEKELKDICMDILEVLDKHLIPAAMTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACKLAKTAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDMQGDAEA 241          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006708.1 (pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 gene:ENSPMAG00000006053.1 transcript:ENSPMAT00000006708.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.931 bits (816), Expect = 3.189e-110
Identity = 155/217 (71.43%), Postives = 181/217 (83.41%), Query Frame = 3
Query:  114 EMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            EMV++M+ VA +  EL++EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K    +L LI+ YR  VEKELK +C DI+ +LD+H++  AS GE+KVF+ KMKGDY+RYL+EFT  N+RK AAENSL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:    1 EMVESMKKVAALDVELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEEKLKLIREYRQMVEKELKSICGDILDVLDKHLIPTASTGESKVFYYKMKGDYHRYLAEFTTANDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGD 217          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005915.1 (pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1 gene:ENSPMAG00000005339.1 transcript:ENSPMAT00000005915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.671 bits (766), Expect = 2.073e-102
Identity = 149/248 (60.08%), Postives = 192/248 (77.42%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQK-AEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAA--SGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEEN 785
            M DRE  V +A+LAEQAERYD+M  AM+ V ++   L+ EERNLLSVAYKNV+G+RR++WR++SSIEQK A      +  ++KAYR +VEKEL+ VC D++ LLD+ ++ +   S  E+KVF+LKMKGDY+RYL+E    ++R     NS  AYKEA  I +  +QPTHPIRLGLALNFSVFYYEI N+ ++AC+LAK AFDD+I ELD+LNE+SYKDSTLIMQLLRDNLTLWTSD  QD++  +E+N
Sbjct:    1 MADRELLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTAGDGSEKKQAMVKAYREKVEKELETVCQDVLDLLDKFLVKSCDDSQQESKVFYLKMKGDYFRYLAEVAAGDKRDGVVLNSEKAYKEAYEICKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACELAKTAFDDSIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDRQQDDEPEEEKN 248          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 298.901 bits (764), Expect = 3.453e-102
Identity = 144/239 (60.25%), Postives = 188/239 (78.66%), Query Frame = 3
Query:   72 VYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 788
            V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR++WR++SSIEQK++  D  +  + K YR +VEKEL ++C D+++LLD+H++V+A+  E+KVF+ KMKGDYYRYL+E  V  ++ +A E S  AY  A  ++++++ PTHPIRLGLALNFSVFYYEILNS ++AC LAK AFD+AI ELD LNE+SYKDSTLIMQLLRDNLTLW SDA  ++   D   N
Sbjct:    9 VQKAKLAEQAERYDDMSAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKSDASDKKQ-HMAKEYRHKVEKELCDICNDVLALLDKHLIVSATSAESKVFYQKMKGDYYRYLAEVAVGIDKASAMERSQAAYLSAFDVSKAEMSPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWASDAQGEDADVDGAEN 246          
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011016.1 (pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gene:ENSPMAG00000009989.1 transcript:ENSPMAT00000011016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 268.855 bits (686), Expect = 1.225e-90
Identity = 129/214 (60.28%), Postives = 166/214 (77.57%), Query Frame = 3
Query:  132 RDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQK-AEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGG--EAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            R V ++T  L+ EERNLLSVAYKNV+G+RR++WR++SSIEQK A   +  RL L+++YR ++E+EL+ VC D+++LLD H++        E+KVF+LKMKGDY+RYL+E     +R     NS  AYKEA  +++  + PTHPIRLGLALNFSVFYYEI N+ ++ACQLAK AFD+AI ELD+LNE+SYKDSTLIMQLLRDNLTLWTSD   DE
Sbjct:    6 RQVTELTEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTATDGNEKRLGLVRSYREKIEQELEAVCGDVLNLLDNHLIPRCDHPQYESKVFYLKMKGDYFRYLAEVATGEKRDHVVSNSEKAYKEAYEVSKEQMMPTHPIRLGLALNFSVFYYEIQNAPEQACQLAKTAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDE 219          
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Match: BMH1 (14-3-3 protein, major isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of exocytosis, vesicle transport, Ras/MAPK and rapamycin-sensitive signaling, aggresome formation, spindle position checkpoint; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; antiapoptotic gene similar to human 14-3-3; BMH1 has a paralog, BMH2, that arose from whole genome duplication [Source:SGD;Acc:S000000979])

HSP 1 Score: 324.709 bits (831), Expect = 3.542e-112
Identity = 160/243 (65.84%), Postives = 196/243 (80.66%), Query Frame = 3
Query:   54 TDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS--RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACD 776
            T RE  VY AKLAEQAERY+EMV+ M+ VA    EL++EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K+ S  ++ LI +YRS++E EL ++  DI+S+LD H++ +A+ GE+KVF+ KMKGDY+RYL+EF+  + R+ A   SL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEI NS D+AC LAK+AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD  +  +A D
Sbjct:    3 TSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAED 245          
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Match: BMH2 (14-3-3 protein, minor isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of many processes including exocytosis, vesicle transport, Ras/MAPK signaling, and rapamycin-sensitive signaling; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; abundance relative to Bmh1p increases during sporulation [Source:SGD;Acc:S000002506])

HSP 1 Score: 324.324 bits (830), Expect = 5.179e-112
Identity = 157/232 (67.67%), Postives = 193/232 (83.19%), Query Frame = 3
Query:   60 RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS--RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            RE  VY AKLAEQAERY+EMV+ M+ VA    EL++EERNLLSVAYKNVIG+RRASWRI+SSIEQK E K+ S  ++ LI++YRS++E EL ++  DI+S+LD H++ +A+ GE+KVF+ KMKGDY+RYL+EF+  + R+ A  +SL AYK A+ IA ++L PTHPIRLGLALNFSVFYYEI NS D+AC LAK+AFDDAI ELD L+EESYKDSTLIMQLLRDNLTLWTSD
Sbjct:    5 REDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 236          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO41372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S2])

HSP 1 Score: 314.309 bits (804), Expect = 4.249e-108
Identity = 154/236 (65.25%), Postives = 194/236 (82.20%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQK--DPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDA 752
            M D+E  VY AKLAEQAERYD+MV++M++VAKM  EL+ E+RNLLSVAYKNVIG+RRASWRI++SIEQK E K  D ++L +I+ YR  +E+ELK +C +I+SLLD+ ++  +   E+KVF+ KMKGDY+RY++EF+ +  R  AA+ S TAYKEA  IA   L  THPIRLGLALNFSVFYYEI N+ ++AC+LAK+AFDDAI+ELD+L EESYKDSTLIMQLLRDNLTLWTSD+
Sbjct:    1 MADKEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRIITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFYNKMKGDYHRYVAEFSKEG-RDEAAKQSETAYKEAQTIATEHLAKTHPIRLGLALNFSVFYYEIQNAPEKACKLAKEAFDDAISELDSLQEESYKDSTLIMQLLRDNLTLWTSDS 235          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S252])

HSP 1 Score: 271.937 bits (694), Expect = 2.993e-91
Identity = 143/245 (58.37%), Postives = 177/245 (72.24%), Query Frame = 3
Query:   39 SIVKMTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLP-LIKAYRSQVEKELKEVCADIISLLDEHMLVAAS---GGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            + V    RE  ++ AK+AEQAERYD+MV+AM  V K    LN EERNLLSVAYKNV+G+RR+SWR++SS+EQKA    P  +  L K YR  +  EL   CA+++ +L+ ++L         EAKVF+LKM+GDY+RYL E    + RK   E S  AYK+A+A AE +L P+HPIRLGLALNFSVFYYEI N    AC+LAK+AFDDAI  LDNL +ESYKDSTLIMQLLRDNLTLWTS+ DQ+
Sbjct:    4 NFVSKCSREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGARRSSWRVISSMEQKA----PEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDINTEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDASAKAE-ELSPSHPIRLGLALNFSVFYYEIENKPPEACKLAKEAFDDAIAVLDNLKDESYKDSTLIMQLLRDNLTLWTSEQDQE 243          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E0])

HSP 1 Score: 268.855 bits (686), Expect = 3.612e-90
Identity = 134/240 (55.83%), Postives = 173/240 (72.08%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESD--LQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            M  +E  V  AK AEQAERY++M  AM++  +++  L  EERNLLSVAYKNV+G++R+SWR++SSIEQK E  +  +    + YR  +E EL EVC  ++ LL+  ++  A   E+KVF+LKMKGDYYRY  E    + R+   + ++ AY EA  IAE D  L PT PIRLGLALNFSVFYYEI+  + +AC LAKKAFDDAI ELD+LNE+ YKDSTLIMQLLRDNLTLW+S+  +D+
Sbjct:    1 MASKEELVQMAKYAEQAERYEDMAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQN-TETYRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREVVQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAKKAFDDAIAELDSLNEDQYKDSTLIMQLLRDNLTLWSSENQEDQ 239          
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Match: EDO42821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E3])

HSP 1 Score: 190.274 bits (482), Expect = 6.628e-59
Identity = 110/268 (41.04%), Postives = 153/268 (57.09%), Query Frame = 3
Query:   60 RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWR-IMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERK----------------------------------------AAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLW 740
            R   V  AKLAEQ ER+++++  M+   ++   LN E RNLLSV YKNV+GS+R +WR +     Q       S+L  I  Y+ ++E ELK +C +I++L++  +L AA   EAKVF+ KM GDY+RYL+E     ++K                                         AAE SL AYK A++ A   L PT P+RLGLALNF+VFY EILN A+ A   +K+A+  A+ E+D+L+EE Y+DS LIM LL DN+T+W
Sbjct:    5 RNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFAWRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREILTLIETCLLDAAEDAEAKVFYDKMTGDYWRYLAEIYSGKQQKDSYGTAVEHEDACDNYDASDNYIACGNYDACDIDNWYDDDEAAERSLGAYKHASSTAAEYLSPTDPVRLGLALNFAVFYKEILNEAEMAIMHSKQAYAAALPEMDSLSEEVYRDSNLIMHLLNDNITIW 272          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ywhae2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101175099])

HSP 1 Score: 344.739 bits (883), Expect = 2.291e-118
Identity = 168/238 (70.59%), Postives = 199/238 (83.61%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DR+  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SS+EQK E K    +L +I+ YR  VEKELK +C DI+ +LD+H+++AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA  +L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK+AFD+AI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:   71 MADRDNLVYQAKLAEQAERYDEMVESMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSLEQKEENKGGEDKLKMIREYRKTVEKELKSICNDILDVLDKHLILAATTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKEAFDNAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDIQGD 308          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ywhae2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101175099])

HSP 1 Score: 344.739 bits (883), Expect = 4.134e-118
Identity = 168/238 (70.59%), Postives = 199/238 (83.61%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQD 761
            M DR+  VY+AKLAEQAERYDEMV++M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SS+EQK E K    +L +I+ YR  VEKELK +C DI+ +LD+H+++AA+ GE+KVF+ KMKGDY+RYL+EF   N+RK AAENSL AYK A+ IA  +L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK+AFD+AI ELD L+EESYKDSTLIMQLLRDNLTLWTSD   D
Sbjct:   71 MADRDNLVYQAKLAEQAERYDEMVESMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSLEQKEENKGGEDKLKMIREYRKTVEKELKSICNDILDVLDKHLILAATTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMIELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKEAFDNAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDIQGD 308          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ENSORLT00000012247.2 (14-3-3 protein epsilon [Source:NCBI gene;Acc:101165659])

HSP 1 Score: 333.954 bits (855), Expect = 3.284e-115
Identity = 166/234 (70.94%), Postives = 191/234 (81.62%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS-RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSD 749
            M +RE  VY+AKLAEQAERYDEMV +M+ VA M  EL +EERNLLSVAYKNVIG+RRASWRI+SSIEQ+ E K    +L +I+ YR  VEKELK +C DI+  L+ H+L +A  GE+KVF+ KMKGDY+RYL+EF   N RK AAENSL AYK AT +A  +L PTHPIRLGLALNFSVFYYEILNS DRAC+LAK AFDDAI ELD L+E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    1 MGEREDLVYQAKLAEQAERYDEMVVSMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQREESKGGEDKLKMIREYRQTVEKELKTICGDILDALERHLLPSAVMGESKVFYNKMKGDYHRYLAEFATGNNRKEAAENSLVAYKTATDLAMLELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSD 234          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: YWHAB (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101167287])

HSP 1 Score: 303.138 bits (775), Expect = 3.178e-103
Identity = 148/244 (60.66%), Postives = 188/244 (77.05%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE-KACDEEN 785
            D+   V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  D  +  + + YR ++E EL+++C D++ LLD  ++  AS  E+KVF+LKMKGDYYRYLSE    + +K   +NS  AY++A  I++ ++QPTHPIRLGLALNFSVFYYEILN+ D+AC LAK AFD+AI ELD LNE+SYKDSTLIMQLLRDNLTLWTS+   DE +  D EN
Sbjct:    2 DKNDLVQKAKLAEQAERYDDMAAAMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKKQ-QMAREYREKIETELQDICHDVLGLLDNFLIANASSAESKVFYLKMKGDYYRYLSEVASGDIKKDTVDNSQQAYQQAFDISKGEMQPTHPIRLGLALNFSVFYYEILNNPDKACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQADEGETGDGEN 244          
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Match: ENSORLT00000024336.2 (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101154846])

HSP 1 Score: 301.982 bits (772), Expect = 1.011e-102
Identity = 150/244 (61.48%), Postives = 190/244 (77.87%), Query Frame = 3
Query:   57 DRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE-KACDEEN 785
            D+   V +AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+G+RR+SWR++SSIEQK E  +  R  +   YR ++E EL+E+C D+++LLD+ ++  AS  E+KVF+LKMKGDY+RYLSE    + +K   ENS  AY++A  I++ D+QPTHPIRLGLALNFSVFYYEILNS ++AC LAK+AFD+AI ELD LNE+SYKDSTLIMQLLRDNLTLWTS+   DE +  D EN
Sbjct:    2 DKNDLVQKAKLAEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKR-QMASDYRVKIEAELQEICHDVLNLLDKFLIPNASQAESKVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEPETGDGEN 244          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000047644.1 (SMESG000047644.1)

HSP 1 Score: 504.212 bits (1297), Expect = 0.000e+0
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 788
            MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN
Sbjct:    1 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 246          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 397.897 bits (1021), Expect = 1.498e-140
Identity = 191/242 (78.93%), Postives = 219/242 (90.50%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACD 776
            M DRE KVY+AKLAEQAERY+EMVDAMR+VA+M  +L +EERNLLSVAYKNVIGSRRASWRI+SSIEQKAEQKDP +LP+IK +R Q+E+EL +VC DII +LD ++L +A+  EA+VFFLKMKGDYYRYL+EFTVD ERK AAENSL+AYK+A+ IA+S+LQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAI ELDNL+EESYKDSTLIMQLLRDNLTLWTSD   +EK+ D
Sbjct:    1 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMATEEKSKD 242          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.715e-139
Identity = 189/238 (79.41%), Postives = 216/238 (90.76%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 764
            M DRE KVY+AKLAEQAERY+EMVDAMR+VA+M  +L +EERNLLSVAYKNVIGSRRASWRI+SSIEQKAEQKDP +LP+IK +R Q+E+EL +VC DII +LD ++L +A+  EA+VFFLKMKGDYYRYL+EFTVD ERK AAENSL+AYK+A+ IA+S+LQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAI ELDNL+EESYKDSTLIMQLLRDNLTLWTSD   +E
Sbjct:    1 MGDREEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMATEE 238          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000076939.1 (SMESG000076939.1)

HSP 1 Score: 313.923 bits (803), Expect = 2.172e-107
Identity = 160/242 (66.12%), Postives = 188/242 (77.69%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPS--RLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLN-EESYKDSTLIMQLLRDNLTLWTSDADQDEK 767
            M DRE  VYRAKLAEQAERYDEMV +M+ VA    EL++EERNLLSVA+KNVIGSRRASWRI+S+IEQ+ E K  S  R+ L KAYR QVEKEL EVC +++ +LD  +L  AS  E++VF+LKMKGDYYRY +EF VD ER+  A+ SL AY+ A   AES L  THPIRLGLALNFSVFY+EI+ + ++AC LAK AFD AI ELDNL  EE+YKDSTLIMQLLRDNLTLW S  + D K
Sbjct:    1 MADREENVYRAKLAEQAERYDEMVKSMKCVAASDSELSVEERNLLSVAFKNVIGSRRASWRILSTIEQREEAKGSSQMRIELAKAYRKQVEKELAEVCDEVVKVLDTQLLPKASNTESQVFYLKMKGDYYRYRAEFAVDKEREEVAQKSLAAYESAMTEAES-LSATHPIRLGLALNFSVFYFEIMGNPEKACSLAKTAFDQAIGELDNLTEEENYKDSTLIMQLLRDNLTLWNSGEEDDNK 241          
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Match: SMESG000058073.1 (SMESG000058073.1)

HSP 1 Score: 307.375 bits (786), Expect = 5.436e-105
Identity = 151/235 (64.26%), Postives = 192/235 (81.70%), Query Frame = 3
Query:   51 MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQK--DPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEE-SYKDSTLIMQLLRDNLTLWTS 746
            MTDR+  VY+AKL+EQAERYDEMV +++ VA+   EL +EERNLLSVAYKNVIGSRR+SWRI+SSIEQK E K    SR+ + + YR QVEKEL  +C ++I +LD+H++  AS  E+KVF+LKMKGDYYRY +EF+++ +R+  AE S  AY EA  ++E +L  THPIRLGLALN+SVF+YEI+ S+++AC+LAKKAFD AI+ELD+L EE SYKDSTLIMQLLRDNLTLWT+
Sbjct:    1 MTDRDDNVYKAKLSEQAERYDEMVKSIKLVAESGVELTVEERNLLSVAYKNVIGSRRSSWRILSSIEQKEESKAISTSRIEIARNYRKQVEKELSGICIEVIKILDDHLIKVASTTESKVFYLKMKGDYYRYNAEFSIEKDRQEIAEKSNQAYSEALQLSE-ELGATHPIRLGLALNYSVFFYEIMGSSEKACELAKKAFDKAISELDSLTEEDSYKDSTLIMQLLRDNLTLWTA 234          
The following BLAST results are available for this feature:
BLAST of 14-3-3 protein epsilon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YWHAE7.210e-11971.43tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE7.210e-11971.43tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE4.525e-10670.37tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAE4.525e-10670.37tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAB1.997e-10259.84tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ftt-21.261e-10661.8914-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-21.261e-10661.8914-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-21.261e-10661.8914-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
par-51.107e-10563.6414-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
par-51.107e-10563.6414-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
14-3-3epsilon2.308e-12270.45gene:FBgn0020238 transcript:FBtr0083566[more]
14-3-3epsilon3.391e-12271.13gene:FBgn0020238 transcript:FBtr0083565[more]
14-3-3epsilon5.403e-12270.33gene:FBgn0020238 transcript:FBtr0083568[more]
14-3-3epsilon8.668e-12272.22gene:FBgn0020238 transcript:FBtr0083567[more]
14-3-3zeta5.861e-10763.71gene:FBgn0004907 transcript:FBtr0088413[more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae12.253e-12272.69tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae12.253e-12272.69tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae12.253e-12272.69tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae22.940e-11870.17tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb8.846e-10561.70tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae4.003e-11971.13tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae4.658e-11971.43tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae4.745e-11971.43tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhab5.155e-10261.34tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
insm11.734e-10059.44insulinoma associated 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ywhae4.950e-11971.43tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhab4.313e-10359.84tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaq1.921e-10261.70tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaq1.921e-10261.70tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz1.282e-10159.75tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P92177|1433E_DROME3.399e-12171.1314-3-3 protein epsilon OS=Drosophila melanogaster ... [more]
sp|P62262|1433E_SHEEP3.463e-11871.4314-3-3 protein epsilon OS=Ovis aries OX=9940 GN=YW... [more]
sp|P62260|1433E_RAT3.463e-11871.4314-3-3 protein epsilon OS=Rattus norvegicus OX=101... [more]
sp|P62259|1433E_MOUSE3.463e-11871.4314-3-3 protein epsilon OS=Mus musculus OX=10090 GN... [more]
sp|P62258|1433E_HUMAN3.463e-11871.4314-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H8YRY61.693e-12275.2114-3-3 epsilon-like transcript variant 1 OS=Penaeu... [more]
A0A232F5J33.836e-12270.2414_3_3 domain-containing protein OS=Trichomalopsis... [more]
G8XR264.638e-12275.2114-3-3 epsilon OS=Penaeus monodon OX=6687 PE=2 SV=... [more]
A0A0M8ZTX18.015e-12273.9514-3-3 protein epsilon OS=Melipona quadrifasciata ... [more]
E2B5271.488e-12173.1114-3-3 protein epsilon OS=Harpegnathos saltator OX... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae14.241e-12271.97tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae11.252e-12172.27tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhae21.984e-10968.33tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb1.755e-10562.7714-3-3 protein beta/alpha-like [Source:NCBI gene;A... [more]
ywhabl4.900e-10463.6414-3-3 protein beta/alpha-A-like [Source:NCBI gene... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007337.11.674e-12170.12pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 g... [more]
ENSPMAT00000006708.13.189e-11071.43pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 ge... [more]
ENSPMAT00000005915.12.073e-10260.08pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1... [more]
ywhaqb3.453e-10260.25tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ENSPMAT00000011016.11.225e-9060.28pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gen... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BMH13.542e-11265.8414-3-3 protein, major isoform; controls proteome a... [more]
BMH25.179e-11267.6714-3-3 protein, minor isoform; controls proteome a... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO413724.249e-10865.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421752.993e-9158.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428593.612e-9055.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428216.628e-5941.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhae22.291e-11870.5914-3-3 protein epsilon [Source:NCBI gene;Acc:10117... [more]
ywhae24.134e-11870.5914-3-3 protein epsilon [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000012247.23.284e-11570.9414-3-3 protein epsilon [Source:NCBI gene;Acc:10116... [more]
YWHAB3.178e-10360.6614-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000024336.21.011e-10261.4814-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of 14-3-3 protein epsilon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047644.10.000e+0100.00SMESG000047644.1[more]
SMESG000075252.11.498e-14078.93SMESG000075252.1[more]
SMESG000075252.11.715e-13979.41SMESG000075252.1[more]
SMESG000076939.12.172e-10766.12SMESG000076939.1[more]
SMESG000058073.15.436e-10564.26SMESG000058073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021698 ID=SMED30021698|Name=14-3-3 protein epsilon|organism=Schmidtea mediterranea sexual|type=transcript|length=971bp
TTTATATTCACTTTTATAGCTAGCGAGAGGAAGTTGATTCAATTGTAAAA
ATGACTGACAGAGAAACTAAAGTATATAGAGCTAAGTTAGCCGAACAAGC
TGAACGTTACGATGAAATGGTTGATGCTATGAGAGATGTAGCTAAAATGA
CAGGTGAGTTAAACATGGAAGAGCGTAATTTGTTATCGGTTGCATACAAA
AATGTAATTGGAAGTAGGAGAGCATCTTGGAGAATCATGAGTAGTATTGA
ACAAAAAGCGGAACAAAAAGACCCTTCGAGACTTCCACTTATTAAAGCTT
ATAGAAGTCAAGTAGAAAAAGAACTAAAAGAAGTCTGTGCTGACATTATA
TCACTTCTTGACGAACATATGTTGGTTGCAGCTAGTGGAGGAGAAGCCAA
AGTTTTCTTCTTAAAAATGAAAGGAGATTATTATCGATATTTATCTGAAT
TCACTGTCGATAACGAAAGGAAGGCTGCGGCTGAAAATAGTTTAACTGCT
TATAAAGAGGCTACTGCCATTGCAGAAAGTGATCTACAACCAACTCACCC
CATTAGACTCGGATTGGCGTTGAACTTCTCTGTATTTTATTATGAAATTT
TAAATTCAGCTGATCGGGCCTGTCAATTGGCTAAAAAGGCTTTTGACGAT
GCCATAACCGAATTAGATAATTTAAATGAAGAAAGTTATAAAGATTCCAC
TCTTATAATGCAATTGTTAAGAGACAATTTGACTTTGTGGACTTCTGATG
CCGATCAAGACGAGAAAGCCTGCGACGAAGAAAATAATTAAGCCAGTTGT
AGTGGTTAATTTTTCAAATCAAGAACATTAATTAGTGTTGATAATGACTA
TATTTTGTATTTCATAATAAAATTAATAGTCGTGATACTATGGCTTTGAA
TATTCTGTTTTAAATAATATATTTTATTAATTTGTACTAAAAATAAAATT
TGGTTTGAATTTAAAAAAAAA
back to top

protein sequence of SMED30021698-orf-1

>SMED30021698-orf-1 ID=SMED30021698-orf-1|Name=SMED30021698-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MTDRETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYK
NVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADII
SLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTA
YKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDD
AITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0034504protein localization to nucleus
GO:0034605cellular response to heat
GO:0046827positive regulation of protein export from nucleus
GO:0000077DNA damage checkpoint
GO:0007088regulation of mitotic nuclear division
GO:0007093mitotic cell cycle checkpoint
GO:0007095mitotic G2 DNA damage checkpoint
GO:0007280pole cell migration
GO:0007294germarium-derived oocyte fate determination
GO:0007411axon guidance
GO:0007444imaginal disc development
GO:0008103oocyte microtubule cytoskeleton polarization
GO:0008340determination of adult lifespan
GO:0009314response to radiation
GO:0009411response to UV
GO:0040008regulation of growth
GO:0045927positive regulation of growth
GO:0046579positive regulation of Ras protein signal transduction
GO:0048190wing disc dorsal/ventral pattern formation
GO:0070374positive regulation of ERK1 and ERK2 cascade
Vocabulary: cellular component
TermDefinition
GO:0042470melanosome
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005875microtubule associated complex
GO:0005886plasma membrane
GO:0045172germline ring canal
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000103central nervous system
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR03681514-3-3_dom_sf
IPR00030814-3-3
IPR02341014-3-3_domain
IPR02340914-3-3_CS
Vocabulary: molecular function
TermDefinition
GO:0019904protein domain specific binding
GO:0005515protein binding
GO:0046982protein heterodimerization activity
GO:0050815phosphoserine binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 169..189
NoneNo IPR availablePANTHERPTHR18860:SF7014-3-3-LIKE PROTEIN GF14 IOTAcoord: 1..225
IPR00030814-3-3 proteinPRINTSPR003051433ZETAcoord: 14..43
score: 82.36
coord: 155..181
score: 76.49
coord: 182..211
score: 91.2
coord: 93..115
score: 68.57
coord: 62..86
score: 44.57
coord: 128..154
score: 71.9
IPR00030814-3-3 proteinPIRSFPIRSF00086814-3-3coord: 1..220
e-value: 1.0E-102
score: 340.2
IPR00030814-3-3 proteinPANTHERPTHR1886014-3-3 PROTEINcoord: 1..225
IPR02341014-3-3 domainSMARTSM001011433_4coord: 1..222
e-value: 1.8E-125
score: 432.8
IPR02341014-3-3 domainPFAMPF0024414-3-3coord: 1..209
e-value: 2.6E-95
score: 318.2
IPR03681514-3-3 domain superfamilyGENE3DG3DSA:1.20.190.20coord: 1..221
e-value: 5.5E-107
score: 358.8
IPR03681514-3-3 domain superfamilySUPERFAMILYSSF4844514-3-3 proteincoord: 2..216
IPR02340914-3-3 protein, conserved sitePROSITEPS007961433_1coord: 20..30
IPR02340914-3-3 protein, conserved sitePROSITEPS007971433_2coord: 191..210