Transducin-like enhancer protein 3

Overview
NameTransducin-like enhancer protein 3
Smed IDSMED30021696
Length (bp)3230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transducin-like enhancer protein 3 (SMED30021696) t-SNE clustered cells

Violin plots show distribution of expression levels for Transducin-like enhancer protein 3 (SMED30021696) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transducin-like enhancer protein 3 (SMED30021696) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transducin-like enhancer protein 3 (SMED30021696) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30021696h1SMcG0012827 SmedASXL_013891SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30021696h1SMcG0012827 dd_Smed_v4_5131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Match: TLE4 (TLE family member 4, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11840])

HSP 1 Score: 355.14 bits (910), Expect = 3.509e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  380 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 704          

HSP 2 Score: 150.599 bits (379), Expect = 8.605e-37
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Match: TLE4 (TLE family member 4, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11840])

HSP 1 Score: 355.14 bits (910), Expect = 9.982e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  424 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 748          

HSP 2 Score: 122.865 bits (307), Expect = 7.322e-28
Identity = 56/102 (54.90%), Postives = 73/102 (71.57%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQ 376
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQE Q Q
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEQQLQ 109          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Match: TLE4 (TLE family member 4, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11840])

HSP 1 Score: 355.525 bits (911), Expect = 1.288e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  449 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 150.984 bits (380), Expect = 1.129e-36
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Match: TLE3 (TLE family member 3, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11839])

HSP 1 Score: 340.502 bits (872), Expect = 2.497e-107
Identity = 170/353 (48.16%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P++ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++       +  P  + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:   29 YSFHVSADGQMQPVPFPHDALAGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLH------HTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 353          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Match: TLE4 (TLE family member 4, transcriptional corepressor [Source:HGNC Symbol;Acc:HGNC:11840])

HSP 1 Score: 355.14 bits (910), Expect = 3.436e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  481 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 805          

HSP 2 Score: 150.599 bits (379), Expect = 1.418e-36
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Celegans
Match: unc-37 (Transcription factor unc-37 [Source:UniProtKB/Swiss-Prot;Acc:O02482])

HSP 1 Score: 273.092 bits (697), Expect = 1.350e-79
Identity = 141/353 (39.94%), Postives = 217/353 (61.47%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   G   P   P D        P  L+     NHGEVVCA  + +    V++GGKG +K+WD+ ++ I G++   +R P+ASL CL  ++YIRS KL  +G+  +IGGE + + +WD+    +  K  +++ D+ ACYAL ++PD K  F+C +DGNI + DIHN+  +     H +GASC+++S DGT LW+GGLD++VR WD+    +E+   +F +Q+FS+G           P  +W+AVG+EN+ ++++  +         +E Y+L  H++CVLSL+FAH   +FI+T KD+ +NA   P G ++ Q KE  SVL+ DIS DD  +VTGSG++KATLY V Y
Sbjct:  284 YSFKIVDGGVPTPTSFPPDAQKGPG-IPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATV-VNRPPIASLDCLK-ENYIRSCKLFEDGNTLLIGGEASTVALWDLT---TETKTLDLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQ-RKEVAKHDFASQVFSLGCC---------PNDEWVAVGMENNYVEVLSTT--------GKEKYQLTQHESCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY 612          

HSP 2 Score: 55.0694 bits (131), Expect = 2.408e-7
Identity = 33/101 (32.67%), Postives = 53/101 (52.48%), Query Frame = 2
Query:  122 KLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNA-ILNQLIPYLSQEHQGQISTAIERAKQVTMQE 421
            K S  ET DRIK+E +   +  +    + EK+  E+  M R  + Y E+++ L  ++ +  EI KRL   I+  L P LSQ++Q     A+E  K  + +E
Sbjct:    2 KASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRKAEEINKRLQEFIMQSLAPQLSQDNQANCLAALEAFKTASPRE 102          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Celegans
Match: unc-37 (Transcription factor unc-37 [Source:UniProtKB/Swiss-Prot;Acc:O02482])

HSP 1 Score: 273.092 bits (697), Expect = 1.350e-79
Identity = 141/353 (39.94%), Postives = 217/353 (61.47%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   G   P   P D        P  L+     NHGEVVCA  + +    V++GGKG +K+WD+ ++ I G++   +R P+ASL CL  ++YIRS KL  +G+  +IGGE + + +WD+    +  K  +++ D+ ACYAL ++PD K  F+C +DGNI + DIHN+  +     H +GASC+++S DGT LW+GGLD++VR WD+    +E+   +F +Q+FS+G           P  +W+AVG+EN+ ++++  +         +E Y+L  H++CVLSL+FAH   +FI+T KD+ +NA   P G ++ Q KE  SVL+ DIS DD  +VTGSG++KATLY V Y
Sbjct:  284 YSFKIVDGGVPTPTSFPPDAQKGPG-IPTGLKKKMELNHGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATV-VNRPPIASLDCLK-ENYIRSCKLFEDGNTLLIGGEASTVALWDLT---TETKTLDLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDNSVRCWDLAQ-RKEVAKHDFASQVFSLGCC---------PNDEWVAVGMENNYVEVLSTT--------GKEKYQLTQHESCVLSLKFAHSGKFFISTGKDNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY 612          

HSP 2 Score: 55.0694 bits (131), Expect = 2.408e-7
Identity = 33/101 (32.67%), Postives = 53/101 (52.48%), Query Frame = 2
Query:  122 KLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNA-ILNQLIPYLSQEHQGQISTAIERAKQVTMQE 421
            K S  ET DRIK+E +   +  +    + EK+  E+  M R  + Y E+++ L  ++ +  EI KRL   I+  L P LSQ++Q     A+E  K  + +E
Sbjct:    2 KASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRKAEEINKRLQEFIMQSLAPQLSQDNQANCLAALEAFKTASPRE 102          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Celegans
Match: prp-19 (Pre-mRNA-processing factor 19 [Source:UniProtKB/Swiss-Prot;Acc:Q10051])

HSP 1 Score: 51.2174 bits (121), Expect = 3.398e-6
Identity = 27/80 (33.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query: 1898 ACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTI 2137
            A +++   PDG    +  +D  + + D+ NQTV   F  H      I  S +G YL TG  D  V+ WD+R   + LKT 
Sbjct:  340 AVHSIEFHPDGLIFGTGAADAVVKIWDLKNQTVAAAFPGHTAAVRSIAFSENGYYLATGSEDGEVKLWDLRKL-KNLKTF 418          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0337057)

HSP 1 Score: 346.28 bits (887), Expect = 2.865e-105
Identity = 169/353 (47.88%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   GS++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P +++PV+ L CL  D+YIRS+KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HN+ ++ QFQ H +GASCI+IS DG+ LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          DWLAVG+ENS ++++  S          + Y+L LH++CVLSLRFA    WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  374 YSFHMNGEGSLQPVPFPPDALVGVG-IPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI--------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLA-SPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYCPTG---------DWLAVGMENSHVEVLHAS--------KPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 698          

HSP 2 Score: 137.887 bits (346), Expect = 4.462e-33
Identity = 68/130 (52.31%), Postives = 96/130 (73.85%), Query Frame = 2
Query:   74 MFPN--RAPV---PPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGL 448
            M+P+  R P    PP  G   K +I +T +RIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN ++NQL+P+L  +HQ Q+  A+ERAKQVTMQELN  +++G+
Sbjct:    1 MYPSPVRHPAAGGPPPQGP-IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELN--LIIGI 127          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0305047)

HSP 1 Score: 346.28 bits (887), Expect = 3.529e-105
Identity = 169/353 (47.88%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   GS++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P +++PV+ L CL  D+YIRS+KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HN+ ++ QFQ H +GASCI+IS DG+ LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          DWLAVG+ENS ++++  S          + Y+L LH++CVLSLRFA    WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  385 YSFHMNGEGSLQPVPFPPDALVGVG-IPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI--------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLA-SPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYCPTG---------DWLAVGMENSHVEVLHAS--------KPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 709          

HSP 2 Score: 137.117 bits (344), Expect = 8.287e-33
Identity = 67/123 (54.47%), Postives = 91/123 (73.98%), Query Frame = 2
Query:   74 MFPN--RAPV---PPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELN 427
            M+P+  R P    PP  G   K +I +T +RIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN ++NQL+P+L  +HQ Q+  A+ERAKQVTMQELN
Sbjct:    1 MYPSPVRHPAAGGPPPQGP-IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELN 122          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084962)

HSP 1 Score: 346.28 bits (887), Expect = 4.983e-105
Identity = 169/353 (47.88%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   GS++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P +++PV+ L CL  D+YIRS+KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HN+ ++ QFQ H +GASCI+IS DG+ LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          DWLAVG+ENS ++++  S          + Y+L LH++CVLSLRFA    WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  395 YSFHMNGEGSLQPVPFPPDALVGVG-IPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI--------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLA-SPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYCPTG---------DWLAVGMENSHVEVLHAS--------KPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 137.117 bits (344), Expect = 9.055e-33
Identity = 67/123 (54.47%), Postives = 91/123 (73.98%), Query Frame = 2
Query:   74 MFPN--RAPV---PPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELN 427
            M+P+  R P    PP  G   K +I +T +RIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN ++NQL+P+L  +HQ Q+  A+ERAKQVTMQELN
Sbjct:    1 MYPSPVRHPAAGGPPPQGP-IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELN 122          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084965)

HSP 1 Score: 346.28 bits (887), Expect = 4.983e-105
Identity = 169/353 (47.88%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   GS++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P +++PV+ L CL  D+YIRS+KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HN+ ++ QFQ H +GASCI+IS DG+ LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          DWLAVG+ENS ++++  S          + Y+L LH++CVLSLRFA    WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  395 YSFHMNGEGSLQPVPFPPDALVGVG-IPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI--------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLA-SPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYCPTG---------DWLAVGMENSHVEVLHAS--------KPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 137.117 bits (344), Expect = 9.055e-33
Identity = 67/123 (54.47%), Postives = 91/123 (73.98%), Query Frame = 2
Query:   74 MFPN--RAPV---PPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELN 427
            M+P+  R P    PP  G   K +I +T +RIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN ++NQL+P+L  +HQ Q+  A+ERAKQVTMQELN
Sbjct:    1 MYPSPVRHPAAGGPPPQGP-IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELN 122          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Match: gro (gene:FBgn0001139 transcript:FBtr0084964)

HSP 1 Score: 346.28 bits (887), Expect = 4.983e-105
Identity = 169/353 (47.88%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ +   GS++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P +++PV+ L CL  D+YIRS+KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HN+ ++ QFQ H +GASCI+IS DG+ LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          DWLAVG+ENS ++++  S          + Y+L LH++CVLSLRFA    WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  395 YSFHMNGEGSLQPVPFPPDALVGVG-IPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDI--------SQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLA-SPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYCPTG---------DWLAVGMENSHVEVLHAS--------KPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY 719          

HSP 2 Score: 137.117 bits (344), Expect = 9.055e-33
Identity = 67/123 (54.47%), Postives = 91/123 (73.98%), Query Frame = 2
Query:   74 MFPN--RAPV---PPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELN 427
            M+P+  R P    PP  G   K +I +T +RIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN ++NQL+P+L  +HQ Q+  A+ERAKQVTMQELN
Sbjct:    1 MYPSPVRHPAAGGPPPQGP-IKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELN 122          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 340.502 bits (872), Expect = 8.362e-108
Identity = 169/353 (47.88%), Postives = 241/353 (68.27%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P+A L CLN D+YIRS K++ +G   ++GGE + + IWD+A + +P  K E+   APACYAL ++PD K CFSC SDGNI + D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR WD+R+ GR+L+  +F +QIFS+G           P  +WLAVG+E+S+++++ VS          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE  SVL+ D+S DDKY+VTGSGD+KAT+Y+VVY
Sbjct:    2 YSFHVSADGQMQPVPFPPDALLGPG-IPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI--------SQPGSKSPMAQLDCLNRDNYIRSCKILPDGRTLIVGGEASTLSIWDLA-TPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-GRQLQQHDFTSQIFSLGYC---------PTGEWLAVGMESSNVEVLHVS--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 326          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 350.517 bits (898), Expect = 6.079e-106
Identity = 170/353 (48.16%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  +          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  447 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHT--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 771          

HSP 2 Score: 154.451 bits (389), Expect = 5.106e-38
Identity = 79/159 (49.69%), Postives = 108/159 (67.92%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV-GLSNTLYVILLKQHTEEAKCSKFFNGGNFGFP 538
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+ + V GL N   + L +Q  +    S   +G     P
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGVRGLPN---LPLTQQQLQAQHLSHAAHGPPVQLP 155          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 350.517 bits (898), Expect = 6.079e-106
Identity = 170/353 (48.16%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  +          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  447 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHT--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 771          

HSP 2 Score: 154.451 bits (389), Expect = 5.106e-38
Identity = 79/159 (49.69%), Postives = 108/159 (67.92%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV-GLSNTLYVILLKQHTEEAKCSKFFNGGNFGFP 538
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+ + V GL N   + L +Q  +    S   +G     P
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGVRGLPN---LPLTQQQLQAQHLSHAAHGPPVQLP 155          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Match: tle3b (TLE family member 3, transcriptional corepressor b [Source:NCBI gene;Acc:100007463])

HSP 1 Score: 349.747 bits (896), Expect = 6.775e-106
Identity = 172/353 (48.73%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L    P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  432 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHHTKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 116.316 bits (290), Expect = 4.877e-26
Identity = 65/158 (41.14%), Postives = 92/158 (58.23%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGLSNTLYVILLKQHTEEAKCSKFFNGGNFGFP 538
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +M                EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+  ++G+     + L +Q  +    S   +G     P
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVM---------------TEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNA--IIGVRGLPNLPLTQQQLQAQHLSHAAHGPPVQLP 140          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Match: tle3a (TLE family member 3, transcriptional corepressor a [Source:NCBI gene;Acc:30206])

HSP 1 Score: 349.747 bits (896), Expect = 8.689e-106
Identity = 170/353 (48.16%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  +          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  438 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHT--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 762          

HSP 2 Score: 154.066 bits (388), Expect = 5.681e-38
Identity = 74/131 (56.49%), Postives = 99/131 (75.57%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV-GLSN 454
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+ + V GL N
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGVRGLPN 130          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 354.369 bits (908), Expect = 4.878e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  375 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 699          

HSP 2 Score: 147.132 bits (370), Expect = 9.211e-36
Identity = 69/123 (56.10%), Postives = 90/123 (73.17%), Query Frame = 2
Query:   74 MFP-NRAPVPP-GSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P  P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 130          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 353.599 bits (906), Expect = 9.448e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  381 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 705          

HSP 2 Score: 112.079 bits (279), Expect = 1.255e-24
Identity = 52/97 (53.61%), Postives = 69/97 (71.13%), Query Frame = 2
Query:   74 MFP-NRAPVPP-GSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLS 358
            M+P  R P  P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LS
Sbjct:    1 MYPQTRHPAAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLS 97          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Match: tle1 (transducin like enhancer of split 1 [Source:NCBI gene;Acc:100101799])

HSP 1 Score: 353.214 bits (905), Expect = 1.020e-107
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  372 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SQPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISIDDKYIVTGSGDKKATVYEVIY 696          

HSP 2 Score: 75.0998 bits (183), Expect = 4.926e-13
Identity = 44/121 (36.36%), Postives = 61/121 (50.41%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            MFP +R P P   +G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +M+                                    Q Q++ A+ERAKQVTM ELN+
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMH------------------------------------QQQVAQAVERAKQVTMAELNA 85          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 353.599 bits (906), Expect = 1.647e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  393 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 717          

HSP 2 Score: 67.3958 bits (163), Expect = 1.203e-10
Identity = 31/46 (67.39%), Postives = 37/46 (80.43%), Query Frame = 2
Query:  299 QMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:   33 QAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 78          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Match: fbxw4 (F-box and WD repeat domain containing 4 [Source:Xenbase;Acc:XB-GENE-852986])

HSP 1 Score: 353.984 bits (907), Expect = 1.647e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  415 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 739          

HSP 2 Score: 147.517 bits (371), Expect = 9.880e-36
Identity = 66/111 (59.46%), Postives = 87/111 (78.38%), Query Frame = 2
Query:  119 YKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGLS 451
            +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ + V +S
Sbjct:   24 FKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGVCVS 134          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Match: Tle4 (transducin-like enhancer of split 4 [Source:MGI Symbol;Acc:MGI:104633])

HSP 1 Score: 355.525 bits (911), Expect = 9.800e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  449 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 150.984 bits (380), Expect = 7.752e-37
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Match: Tle4 (transducin-like enhancer of split 4 [Source:MGI Symbol;Acc:MGI:104633])

HSP 1 Score: 355.14 bits (910), Expect = 1.293e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  449 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 150.984 bits (380), Expect = 7.098e-37
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Match: Tle1 (transducin-like enhancer of split 1 [Source:MGI Symbol;Acc:MGI:104636])

HSP 1 Score: 353.984 bits (907), Expect = 3.466e-107
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  446 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 770          

HSP 2 Score: 152.91 bits (385), Expect = 1.776e-37
Identity = 71/121 (58.68%), Postives = 93/121 (76.86%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            MFP +R P P   +G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN I  Q+IP+LSQEHQ Q++ A+ERAKQVTM ELN+
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNA 121          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Match: Tle1 (transducin-like enhancer of split 1 [Source:MGI Symbol;Acc:MGI:104636])

HSP 1 Score: 353.599 bits (906), Expect = 4.552e-107
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  456 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 780          

HSP 2 Score: 153.68 bits (387), Expect = 1.029e-37
Identity = 72/125 (57.60%), Postives = 95/125 (76.00%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV 442
            MFP +R P P   +G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN I  Q+IP+LSQEHQ Q++ A+ERAKQVTM ELN+ + V
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGV 125          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Match: Tle1 (transducin-like enhancer of split 1 [Source:MGI Symbol;Acc:MGI:104636])

HSP 1 Score: 353.599 bits (906), Expect = 4.669e-107
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  446 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 770          

HSP 2 Score: 152.91 bits (385), Expect = 1.873e-37
Identity = 71/121 (58.68%), Postives = 93/121 (76.86%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            MFP +R P P   +G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN I  Q+IP+LSQEHQ Q++ A+ERAKQVTM ELN+
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNA 121          
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Match: sp|Q04727|TLE4_HUMAN (Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3)

HSP 1 Score: 355.525 bits (911), Expect = 6.185e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  449 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 150.984 bits (380), Expect = 5.423e-36
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Match: sp|Q62441|TLE4_MOUSE (Transducin-like enhancer protein 4 OS=Mus musculus OX=10090 GN=Tle4 PE=1 SV=4)

HSP 1 Score: 355.525 bits (911), Expect = 6.855e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  449 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 773          

HSP 2 Score: 150.984 bits (380), Expect = 5.423e-36
Identity = 69/122 (56.56%), Postives = 90/122 (73.77%), Query Frame = 2
Query:   74 MFP-NRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            M+P  R P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    8 MYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 129          
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Match: sp|O42478|TLE4_XENLA (Transducin-like enhancer protein 4 OS=Xenopus laevis OX=8355 GN=tle4 PE=1 SV=2)

HSP 1 Score: 355.14 bits (910), Expect = 8.475e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  448 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 772          

HSP 2 Score: 145.591 bits (366), Expect = 2.648e-34
Identity = 64/106 (60.38%), Postives = 84/106 (79.25%), Query Frame = 2
Query:  119 YKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:   25 FKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAII 130          
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Match: sp|Q07141|TLE4_RAT (Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 1.103e-106
Identity = 171/353 (48.44%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI D        P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF+   KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  424 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDITD--------PGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVRPGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 748          

HSP 2 Score: 110.153 bits (274), Expect = 3.010e-23
Identity = 50/93 (53.76%), Postives = 66/93 (70.97%), Query Frame = 2
Query:   74 MFPNRA-PVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIP 349
            M+  RA P P      +K +I E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP
Sbjct:    8 MYRRRAHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIP 100          
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Match: sp|Q04724|TLE1_HUMAN (Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 2.450e-106
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  446 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 770          

HSP 2 Score: 153.295 bits (386), Expect = 1.023e-36
Identity = 71/121 (58.68%), Postives = 93/121 (76.86%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            MFP +R P P   +G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLN I  Q+IP+LSQEHQ Q++ A+ERAKQVTM ELN+
Sbjct:    1 MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNA 121          
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Match: A0A1S3PKN1 (transducin-like enhancer protein 4 OS=Salmo salar OX=8030 GN=LOC106585991 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.685e-107
Identity = 176/353 (49.86%), Postives = 242/353 (68.56%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V   G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN DSYIRS +L+ +G   +IGGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          E Y+L LH++CVLSLRFAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  184 YSFHVSTEGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDSYIRSCRLLHDGRTLIIGGEASTLSIWDLA-SPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLRQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPEKYQLHLHESCVLSLRFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISGDDKYIVTGSGDKKATVYEVIY 508          
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Match: V9KIQ6 (Transducin-like enhancer protein 4-like protein OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.552e-107
Identity = 173/353 (49.01%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:   20 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 344          
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Match: A0A2P4SZ01 (Uncharacterized protein (Fragment) OS=Bambusicola thoracicus OX=9083 GN=CIB84_006904 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 6.506e-107
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:   48 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 372          
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Match: A0A1A6HBQ1 (Uncharacterized protein (Fragment) OS=Neotoma lepida OX=56216 GN=A6R68_17829 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 4.448e-106
Identity = 173/353 (49.01%), Postives = 245/353 (69.41%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G           P  +WLAVG+E+S++++     L +N P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:    2 YSFHVTADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYC---------PTGEWLAVGMESSNVEV-----LHVNKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 326          
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Match: L9L142 (Transducin-like enhancer protein 4 OS=Tupaia chinensis OX=246437 GN=TREES_T100013026 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 4.973e-106
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G           P  +WLAVG+ENS+++++ V+          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  118 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYC---------PTGEWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 442          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000040766.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:7193346:7202398:-1 gene:ENSAMXG00000032101.1 transcript:ENSAMXT00000040766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.043 bits (876), Expect = 3.167e-108
Identity = 171/353 (48.44%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G           P  +WLAVG+E+S+++++       +  P  + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:   20 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYC---------PTGEWLAVGMESSNVEVLH------HTKP--DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 344          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Match: tle3a (TLE family member 3, transcriptional corepressor a [Source:NCBI gene;Acc:30206])

HSP 1 Score: 349.747 bits (896), Expect = 5.801e-106
Identity = 170/353 (48.16%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  +          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  432 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHT--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 152.525 bits (384), Expect = 1.577e-37
Identity = 71/126 (56.35%), Postives = 96/126 (76.19%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV 442
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+ + V
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGV 125          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Match: tle2a (TLE family member 2, transcriptional corepressor a [Source:ZFIN;Acc:ZDB-GENE-030131-2826])

HSP 1 Score: 347.436 bits (890), Expect = 2.036e-105
Identity = 168/353 (47.59%), Postives = 241/353 (68.27%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P+A L CLN D+YIRS KL+ +G   ++GGE + + IWD+A   +P  K E+   APACYAL ++PD K CFSC SDGNI + D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++ VS          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DD+++VTGSGD+KAT+Y+V+Y
Sbjct:  396 YSFHVSADGQMQPVPFPPDALLGPG-IPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI--------SQPGSKSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLATP-TPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHVS--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGSSIFQSKESSSVLSCDISPDDQFIVTGSGDKKATVYEVIY 720          

HSP 2 Score: 121.709 bits (304), Expect = 8.216e-28
Identity = 54/91 (59.34%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  164 FSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
            F + Q Q H+  +E EK+  E++E+QR  +MYYEM++GLN+EMH+Q EIAKRLN I  QLIP+LSQEHQ Q+  A+ERAKQVTM ELN+++
Sbjct:    1 FQFLQTQYHSLKLECEKLATEKTEIQRHYVMYYEMSYGLNIEMHKQTEIAKRLNVICAQLIPFLSQEHQQQVVQAMERAKQVTMGELNASI 91          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 332.798 bits (852), Expect = 4.387e-105
Identity = 170/353 (48.16%), Postives = 242/353 (68.56%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P+A L CLN D+YIRS KL+ +G   ++GGE + + IWD+A + +P  K E+   APACYAL ++PD K CFSC SDGNI + D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR WD+R+ GR+L+  +F +QIFS+G           P  +WLAVG+E+S+++++ VS          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ D+S DDKY+VTGSGD+KAT+Y+VVY
Sbjct:    2 YSFHVSADGQMQPVPFPSDALLGPG-IPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI--------SQPGSKSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLA-TPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLV-QFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-GRQLQQHDFTSQIFSLGYC---------PTGEWLAVGMESSNVEVLHVSK--------PDKYQLHLHESCVLSLKFAYCK-WFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 324          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Match: tle2b (TLE family member 2, transcriptional corepressor b [Source:ZFIN;Acc:ZDB-GENE-050208-677])

HSP 1 Score: 316.62 bits (810), Expect = 1.578e-98
Identity = 163/353 (46.18%), Postives = 230/353 (65.16%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P+A L CLN D+YIRS KL+ +G   ++GGE + + IWD+A + +P  K E+   APACYAL ++PD K CFSC SDGNI + D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ V           LK  +    IFS+G           P  +WLAVG+E+S+++++ VS          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ D+S DDKY+VTGSGD+KAT+Y+VVY
Sbjct:   38 YSFHVSADGQMQPVPFPSDALLGPG-IPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI--------SQPGSKSPMAQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLA-TPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTV-----------LKQQQHQGIIFSLGYC---------PTGEWLAVGMESSNVEVLHVS--------KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 352          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002530.1 (pep scaffold:Pmarinus_7.0:GL486002:914:6103:1 gene:ENSPMAG00000002307.1 transcript:ENSPMAT00000002530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.813 bits (878), Expect = 4.407e-109
Identity = 170/353 (48.16%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R +++  HGEVVCAV +   T  V++GGKG +K+WDI D        PA + PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DG  LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++             + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:   30 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQISTLGHGEVVCAVTISNPTRHVYTGGKGCVKVWDIRD--------PAGKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLSIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGMKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHCM--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISGDDKYIVTGSGDKKATVYEVIY 354          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002582.1 (pep scaffold:Pmarinus_7.0:GL476407:354021:372810:-1 gene:ENSPMAG00000002262.1 transcript:ENSPMAT00000002582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 352.058 bits (902), Expect = 1.843e-107
Identity = 172/353 (48.73%), Postives = 240/353 (67.99%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R +++  HGEVVCAV +   T  V++GGKG +K+WDI          P ++ PV+ L CLN D+YIRS KL+ +G   ++GGE + I IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  S          + Y+L LH++CVLSL+FAH   WF++T KD+L+NA   P G +I Q+KE  SVL+ DIS DDKY+VTGSGD+KATLY+V+Y
Sbjct:  436 YSFHVSADGQMQPVPFPPDALMGPG-IPRHARQISTLPHGEVVCAVTISNPTRHVYTGGKGCVKIWDIGQ--------PGTKTPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTISIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHS--------KPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDYLLNAWRTPYGASIFQSKETSSVLSCDISVDDKYIVTGSGDKKATLYEVIY 760          

HSP 2 Score: 147.132 bits (370), Expect = 1.655e-36
Identity = 65/104 (62.50%), Postives = 83/104 (79.81%), Query Frame = 2
Query:  119 YKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            +K +I ETCDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+QMEI KRLNAI  Q+IP+LS EHQ Q+  A+ERAKQVTM ELN+
Sbjct:    3 FKFAINETCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQMEIVKRLNAICAQIIPFLSPEHQQQVIQAVERAKQVTMSELNA 106          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002471.1 (pep scaffold:Pmarinus_7.0:GL476407:90601:137795:1 gene:ENSPMAG00000002146.1 transcript:ENSPMAT00000002471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 347.051 bits (889), Expect = 1.506e-105
Identity = 169/353 (47.88%), Postives = 241/353 (68.27%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R +++  HGEVVCAV +   T  V++GGKG +K+WDI          P ++ PV+ L CLN ++YIRS KL+ +G   ++GGE + I IWD+AA  +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++  S          + Y+L LH++CVLS++FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KATLY+V+Y
Sbjct:  433 YSFHVSADGQMQPVPFPPDALMGPG-IPRHARQISTLPHGEVVCAVTISNPTRHVYTGGKGCVKIWDIGQ--------PGTKTPVSQLDCLNRENYIRSCKLLPDGRTLIVGGEASTISIWDLAAP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHHS--------KPDKYQLHLHESCVLSIKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATLYEVIY 757          

HSP 2 Score: 145.206 bits (365), Expect = 8.106e-36
Identity = 67/114 (58.77%), Postives = 87/114 (76.32%), Query Frame = 2
Query:   95 VPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAM 436
             P  +G  +K ++ ETCDRIKEEF  FQ Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+ +
Sbjct:    1 APHQAGQPFKFTVTETCDRIKEEFQ-FQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIVKRLNAICAQVIPFLSQEHQQQVIQAVERAKQVTMSELNAII 113          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 57.7658 bits (138), Expect = 1.057e-8
Identity = 50/206 (24.27%), Postives = 87/206 (42.23%), Query Frame = 2
Query: 1601 HGEVVCAVAM---HQQTVFSGGKGTLKLWDIN--------DNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKD 2185
            H + V A+A     +Q   +G    + LWD+N        +N +  SS   ++D + SL+ +N            G+  V G    ++ +WD       +K   +K       AL +  DG  C S  SDG I +  +  Q  I  ++ H EG   ++++   T +++GG D  V   D+R+    +   E  A +  + L  + D
Sbjct:  116 HKDYVKALAYAKDKEQVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLA-MNQ----------MGTIIVSGSTEKVLRVWDPRTCAKLMK---LKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVHDEGVWALQVNDTFTQVYSGGRDRKVYCTDLRNPDIRVLICEEKAPVLKLELDRSAD 307          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 57.7658 bits (138), Expect = 1.191e-8
Identity = 50/206 (24.27%), Postives = 87/206 (42.23%), Query Frame = 2
Query: 1601 HGEVVCAVAM---HQQTVFSGGKGTLKLWDIN--------DNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKD 2185
            H + V A+A     +Q   +G    + LWD+N        +N +  SS   ++D + SL+ +N            G+  V G    ++ +WD       +K   +K       AL +  DG  C S  SDG I +  +  Q  I  ++ H EG   ++++   T +++GG D  V   D+R+    +   E  A +  + L  + D
Sbjct:  116 HKDYVKALAYAKDKEQVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLA-MNQ----------MGTIIVSGSTEKVLRVWDPRTCAKLMK---LKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVHDEGVWALQVNDTFTQVYSGGRDRKVYCTDLRNPDIRVLICEEKAPVLKLELDRSAD 307          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Nematostella
Match: EDO29280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T433])

HSP 1 Score: 342.813 bits (878), Expect = 3.337e-107
Identity = 173/353 (49.01%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +  SN  P+H R +   NHGEVVCAV +   T  V++GGKG +K+WDI        S  + ++ V++L CL  D+YIRS +L+ +G   ++GGE + + IWD+A+S  P  K E+  +APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G           P  DWLAVG+ENS+++++  +          + Y+L LHD+CVLSL+FA+   WFITT KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KATLY+V++
Sbjct:  145 YSFHVAGDGQMQPVPFPPDALMGSN-IPRHARQINQLNHGEVVCAVTISHPTRHVYTGGKGCVKVWDI--------SQASGKNLVSTLECLR-DNYIRSCRLLPDGRTLIVGGEASTLTIWDLASS-QPRIKAELTSNAPACYALAMSPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQIFSLGYC---------PSGDWLAVGMENSNVEVLHQT--------KPDKYQLHLHDSCVLSLKFAYSGSWFITTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATLYEVMF 468          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Nematostella
Match: EDO42310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W8])

HSP 1 Score: 223.016 bits (567), Expect = 1.067e-61
Identity = 110/226 (48.67%), Postives = 156/226 (69.03%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQI 2155
            Y++ V  +G ++P   P D +  SN  P+H R +   NHGEVVCAV +   T  V++GGKG +K+WDI        S  + ++ V++L CL  D+YIRS +L+ +G   ++GGE + + IWD+A+S  P  K E+  +APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QI
Sbjct:  455 YSFHVAGDGQMQPVPFPPDALMGSN-IPRHARQINQLNHGEVVCAVTISHPTRHVYTGGKGCVKVWDI--------SQASGKNLVSTLECLR-DNYIRSCRLLPDGRTLIVGGEASTLTIWDLASS-QPRIKAELTSNAPACYALAMSPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISPDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFSSQI 668          

HSP 2 Score: 149.058 bits (375), Expect = 4.557e-37
Identity = 64/108 (59.26%), Postives = 88/108 (81.48%), Query Frame = 2
Query:  107 SGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            SG  +K ++ ++CDRIKEEF++ Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAI  Q+IP+LSQ+HQ Q++ A+ERAKQVTM ELN+
Sbjct:   13 SGQPFKFTVADSCDRIKEEFNFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNAICAQIIPFLSQDHQQQVAAAVERAKQVTMSELNA 120          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Match: ENSORLT00000002067.2 (transducin-like enhancer protein 4 [Source:NCBI gene;Acc:100125464])

HSP 1 Score: 354.369 bits (908), Expect = 8.230e-108
Identity = 172/353 (48.73%), Postives = 244/353 (69.12%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +   N  P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+A   +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+ENS+++++ V+          + Y+L LH++CVLSLRFAH   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  412 YSFHVSADGQMQPVPFPPDALIGPN-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKTPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLATP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMENSNVEVLHVT--------KPDKYQLHLHESCVLSLRFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISIDDKYIVTGSGDKKATVYEVIY 736          

HSP 2 Score: 119.783 bits (299), Expect = 3.722e-27
Identity = 52/93 (55.91%), Postives = 69/93 (74.19%), Query Frame = 2
Query:   80 PNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLS 358
            P R PVP   G  +K ++ E+CDRIKEEF + Q Q H+  +E EK+  E++EMQR  +MYYEM++GLN+EMH+Q EI KRLNAI  Q+IP+LS
Sbjct:   11 PARHPVPHQPGQPFKFTVTESCDRIKEEFQFLQAQYHSLKMECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLS 103          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Match: TLE3 (transducin-like enhancer protein 3-B [Source:NCBI gene;Acc:101168352])

HSP 1 Score: 349.362 bits (895), Expect = 5.358e-106
Identity = 172/353 (48.73%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L    P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  414 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHHTKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 738          

HSP 2 Score: 83.1889 bits (204), Expect = 9.085e-16
Identity = 44/100 (44.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQE 364
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +M   +            EIAKRLNAIL Q++P+LSQE
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMVSAII----------TEIAKRLNAILAQIMPFLSQE 89          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Match: TLE3 (transducin-like enhancer protein 3-B [Source:NCBI gene;Acc:101168352])

HSP 1 Score: 350.517 bits (898), Expect = 5.911e-106
Identity = 172/353 (48.73%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ PV+ L CLN D+YIRS KL+ +G   ++GGE + + IWD+A S +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S++++     L    P   + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS+DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  459 YSFHVSADGQMQPVPFPPDALIGPG-IPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDI--------SQPGSKSPVSQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLA-SQTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEV-----LHHTKP---DKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY 783          

HSP 2 Score: 154.836 bits (390), Expect = 3.497e-38
Identity = 79/159 (49.69%), Postives = 108/159 (67.92%), Query Frame = 2
Query:   74 MFPN-RAPVP--PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMV-GLSNTLYVILLKQHTEEAKCSKFFNGGNFGFP 538
            M+P  R P P  PG    +K ++ E+CDRIK+EF + Q Q H+  VE +K+  E++EMQR  +MYYEM++GLN+EMH+Q EIAKRLNAIL Q++P+LSQEHQ Q++ A+ERAKQVTM ELN+ + V GL N   + L +Q  +    S   +G     P
Sbjct:    1 MYPQGRHPAPHQPGQ-PGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNAILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGVRGLPN---LPLTQQQLQAQHLSHAAHGPPVQLP 155          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Match: TLE4 (transducin-like enhancer protein 1 [Source:NCBI gene;Acc:100125463])

HSP 1 Score: 348.977 bits (894), Expect = 1.079e-105
Identity = 169/353 (47.88%), Postives = 243/353 (68.84%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + NHGEVVCAV +   T  V++GGKG +K+WDI        S P ++ PV+ L CLN D+YIRS +L+ +G   ++GGE + + IWD+A   +P  K E+   APACYAL ++PD K CFSC SDGNIA+ D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR+WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++ V+          + Y+L LH++CVLSL+FA+   WF++T KD+L+NA   P G +I Q+KE+ SVL+ DIS DDKY+VTGSGD+KAT+Y+V+Y
Sbjct:  432 YSFHVAADGQMQPVPFPPDALVGPG-IPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDI--------SHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLATP-TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHVT--------KPDKYQLHLHESCVLSLQFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 756          

HSP 2 Score: 85.1149 bits (209), Expect = 2.356e-16
Identity = 46/100 (46.00%), Postives = 60/100 (60.00%), Query Frame = 2
Query:   74 MFP-NRAPVP-PGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMY-YEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQE 364
            MFP  R P P    G  +K +IPE+ DRIKEEF + Q Q H+  +E EK+  E++EMQR  +M  + +          Q EIAKRLN I  Q+IP+LSQE
Sbjct:    1 MFPQGRHPTPHQAPGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMVSFFLFFVPPPFFLHQTEIAKRLNTICAQVIPFLSQE 100          
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Match: tle2b (transducin-like enhancer protein 4 [Source:NCBI gene;Acc:101157442])

HSP 1 Score: 347.821 bits (891), Expect = 1.291e-105
Identity = 169/353 (47.88%), Postives = 241/353 (68.27%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQT--VFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++ V  +G ++P   P D +      P+H R + + +HGEVVCAV +   T  V++GGKG +K+WDI        S P S+ P+A L CLN D+YIRS K++ +G   ++GGE + + IWD+A + +P  K E+   APACYAL ++PD K CFSC SDGNI + D+HNQT++ QFQ H +GASCI+IS+DGT LWTGGLD+ VR WD+R+ GR+L+  +F +QIFS+G   T          +WLAVG+E+S+++++ VS          + Y+L LH++CVLSL+FA    WF++T KD+L+NA   P G +I Q+KE+ SVL+ D+S DDKY+VTGSGD+KAT+Y+VVY
Sbjct:  390 YSFHVSADGQMQPVPFPPDALLGPG-IPRHARQIHTLSHGEVVCAVTISTSTRHVYTGGKGCVKVWDI--------SQPGSKSPMAQLDCLNRDNYIRSCKILPDGRTLIVGGEASTLSIWDLA-TPTPRIKAELTSSAPACYALAISPDNKVCFSCCSDGNIVVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRCWDLRE-GRQLQQHDFTSQIFSLGYCPTG---------EWLAVGMESSNVEVLHVS--------KPDKYQLHLHESCVLSLKFAFCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDVSPDDKYIVTGSGDKKATVYEVVY 714          

HSP 2 Score: 92.0485 bits (227), Expect = 1.317e-18
Identity = 40/58 (68.97%), Postives = 50/58 (86.21%), Query Frame = 2
Query:  257 YYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNS 430
            YYEM++GLN+EMH+Q EI KRL+AI  Q+IP+LSQEHQ Q+  A+ERAKQVTM ELN+
Sbjct:    9 YYEMSYGLNIEMHKQAEIVKRLSAICAQIIPFLSQEHQQQVVQAVERAKQVTMAELNA 66          
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Match: SMESG000073091.1 (SMESG000073091.1)

HSP 1 Score: 1019.99 bits (2636), Expect = 0.000e+0
Identity = 581/581 (100.00%), Postives = 581/581 (100.00%), Query Frame = 2
Query:  809 MASGTSXXXXXXXXXXXXXXXXXXXXXXXXXXSSGQQXXXXXXXXXXXXXKQEADKHMNDDKQKDSSFSRPPSANDKLHNLSRDNLSNHISEVHEKRRKLDMKIXXXXXXXXXXXXRCSTLNGNGKLKDNEWRHMDNLPISPRSVGSSTPGLNKKKSSKNALDLSQGPGANSSNDGYXXXXXXXXXXXXGSLIPIGSRSSEANNLSATKXXXXXXXXXXXXXXXXHYNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQTVFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVYPNNDC 2551
            MASGTSGFGQNALAANAALAGNPAAANFFLNASSGQQLNTNNLNLASALLKQEADKHMNDDKQKDSSFSRPPSANDKLHNLSRDNLSNHISEVHEKRRKLDMKIEHKDEDEHYDDKRCSTLNGNGKLKDNEWRHMDNLPISPRSVGSSTPGLNKKKSSKNALDLSQGPGANSSNDGYPTTCSAPTTPATGSLIPIGSRSSEANNLSATKSKNHSGKSLSQSSSKKHYNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQTVFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVYPNNDC
Sbjct:  232 MASGTSGFGQNALAANAALAGNPAAANFFLNASSGQQLNTNNLNLASALLKQEADKHMNDDKQKDSSFSRPPSANDKLHNLSRDNLSNHISEVHEKRRKLDMKIEHKDEDEHYDDKRCSTLNGNGKLKDNEWRHMDNLPISPRSVGSSTPGLNKKKSSKNALDLSQGPGANSSNDGYPTTCSAPTTPATGSLIPIGSRSSEANNLSATKSKNHSGKSLSQSSSKKHYNYVVKPNGSVEPRLMPIDTITNSNQYPQHLRHLASFNHGEVVCAVAMHQQTVFSGGKGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVYPNNDC 812          

HSP 2 Score: 330.872 bits (847), Expect = 1.502e-98
Identity = 158/172 (91.86%), Postives = 158/172 (91.86%), Query Frame = 2
Query:   74 MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGLSNTLYVILLKQHTEEAKCSKFFNGGNFGFPDQLEFYKHMLNAAATLN 589
            MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMM              HTEEAKCSKFFNGGNFGFPDQLEFYKHMLNAAATLN
Sbjct:    1 MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMM--------------HTEEAKCSKFFNGGNFGFPDQLEFYKHMLNAAATLN 158          
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Match: SMESG000026880.1 (SMESG000026880.1)

HSP 1 Score: 330.872 bits (847), Expect = 2.761e-98
Identity = 167/372 (44.89%), Postives = 244/372 (65.59%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTIT-NSNQYPQHLRHLASFNHGEVVCAVAMH--QQTVFSGGKGTLKLWDINDNVIRGSSSPASRDP--------------VASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCG----RELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++++  N ++ P  +PI+  + +S  YP+++R L +  HGEVVCAV ++   + V++GGKG +K+WD+      GSSS A   P              + S+ CL  DSYIRSIKL+ +    ++GGE++ + IWD+  S +P  KGE+ I APACYAL ++ +GK CF+C+SDG IA+ DIHNQ++I  FQ H +GASCI+I+  G  LWTGGLD+ VR WDIR+ G    R++   +F +QIFS+G           P  DWLAVG+E+S ++++ +S   +      E Y+L LHD+CVLSL++A    WF +T KDHL+NA   P G N+ Q+ E+ SVL+ DIS+D+KY+VTGSGD+KATLY+V++
Sbjct:  482 YSFLINDNHNMAP--VPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLG-SPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYC---------PSGDWLAVGMESSQVEILNISKQNL------EKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 835          

HSP 2 Score: 187.193 bits (474), Expect = 1.714e-48
Identity = 91/165 (55.15%), Postives = 113/165 (68.48%), Query Frame = 2
Query:   74 MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGLSNTLYVILLKQHTEEAKCSKFFNGGNFGF-PDQLEFYKHM 565
            MFP R P     G S+   IPE CDRIKE+F+Y QQQ H+   E +K++QE++EMQR  IMYYEM++GLN+EMH+Q EI+KRL AIL Q+IP+LSQEHQ Q++ A+ERAKQVTM +LNS M  G               + K  KF NGGNFGF P+  EFYK M
Sbjct:    1 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQVTMPDLNSLMSQG---------------DEKYPKFHNGGNFGFGPEHFEFYKQM 146          
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Match: SMESG000026880.1 (SMESG000026880.1)

HSP 1 Score: 330.102 bits (845), Expect = 3.237e-98
Identity = 167/372 (44.89%), Postives = 244/372 (65.59%), Query Frame = 2
Query: 1487 YNYVVKPNGSVEPRLMPIDTIT-NSNQYPQHLRHLASFNHGEVVCAVAMHQ--QTVFSGGKGTLKLWDINDNVIRGSSSPASRDP--------------VASLSCLNSDSYIRSIKLI-NGSAAVIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCG----RELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISSDDKYVVTGSGDRKATLYDVVY 2536
            Y++++  N ++ P  +PI+  + +S  YP+++R L +  HGEVVCAV ++   + V++GGKG +K+WD+      GSSS A   P              + S+ CL  DSYIRSIKL+ +    ++GGE++ + IWD+  S +P  KGE+ I APACYAL ++ +GK CF+C+SDG IA+ DIHNQ++I  FQ H +GASCI+I+  G  LWTGGLD+ VR WDIR+ G    R++   +F +QIFS+G           P  DWLAVG+E+S ++++ +S   +      E Y+L LHD+CVLSL++A    WF +T KDHL+NA   P G N+ Q+ E+ SVL+ DIS+D+KY+VTGSGD+KATLY+V++
Sbjct:  471 YSFLINDNHNMAP--VPINPESVHSPGYPRNVRQLNTLLHGEVVCAVTINNAMKHVYTGGKGCVKVWDMQSATAGGSSSGAPTPPNSSGSTISSGSKLLLNSMDCLQKDSYIRSIKLVPDARTMIVGGESSTLTIWDLG-SPTPRSKGEITISAPACYALAISANGKFCFNCYSDGYIAVWDIHNQSMIKHFQGHNDGASCIDITPKGNNLWTGGLDNTVRCWDIREMGRADNRQISKYDFQSQIFSLGYC---------PSGDWLAVGMESSQVEILNISKQNL------EKYQLTLHDSCVLSLKYAASGKWFASTGKDHLLNAWRMPYGANLFQSNESSSVLSCDISADEKYIVTGSGDKKATLYEVLF 824          

HSP 2 Score: 167.933 bits (424), Expect = 2.415e-42
Identity = 83/165 (50.30%), Postives = 104/165 (63.03%), Query Frame = 2
Query:   74 MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQGQISTAIERAKQVTMQELNSAMMVGLSNTLYVILLKQHTEEAKCSKFFNGGNFGF-PDQLEFYKHM 565
            MFP R P     G S+   IPE CDRIKE+F+Y QQQ H+   E +K++QE++EMQR  IMYYEM++GLN+EMH+Q EI+KRL AIL Q+IP+LSQEHQ Q++ A+ERAKQ                            + K  KF NGGNFGF P+  EFYK M
Sbjct:    1 MFPTRPP----PGQSFNFKIPEACDRIKEDFAYMQQQYHSLKCEYDKVLQEKTEMQRHYIMYYEMSYGLNVEMHKQSEISKRLGAILVQVIPFLSQEHQTQVAAAVERAKQ--------------------------QGDEKYPKFHNGGNFGFGPEHFEFYKQM 135          
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Match: SMESG000030483.1 (SMESG000030483.1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.366e-7
Identity = 52/193 (26.94%), Postives = 83/193 (43.01%), Query Frame = 2
Query: 1619 AVAMHQQTVFSGG-KGTLKLWDINDNVIRGSSSPASRDPVASLSCLNSDSYIRSIKLINGSAAVI--GGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDN 2188
            A A  ++ V S G    + LWDIN      ++  A+ + V + S   S   I S+ + N SA VI  G    +I IWD       +K   ++        L V PDGK   S  SDG + +  +  Q  +  ++ H  G   +++ +D T  ++ G D  V    I DC  +    E +A +  + L    +N
Sbjct:  126 AYAKDKEEVASAGLDKAIFLWDIN----TLTALTAANNTVTTSSLTGSKEGIYSLAM-NHSANVIAAGSTERLIRIWDPRTCQKLMK---LRGHTDNVRDLIVRPDGKEILSASSDGTVKLWSLGMQRCVQTWRLHECGVWSLQVDADWTTFYSAGKDKRVWGARIADCETQWLICEENAPVVKLLLVPQHNN 310          
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.255e-6
Identity = 50/196 (25.51%), Postives = 81/196 (41.33%), Query Frame = 2
Query: 1805 VIGGETNIIDIWDMAASGSPIKKGEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVEGASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLTSTKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDNCVLSLRFAHHNDWFITTSKDHLI 2392
            V G +   I +W M          E K +   C  +  + DG+   S   D  I + D HNQ  I+ FQ H      +    +G+Y+ +GG DS V  WDIR   + L+    H        TS  +     P  ++L    ++S + +  +  LE  +      Y +Q H+  +L   F+H  + F +   DH +
Sbjct:  114 VTGSDDKTIKVWKMHRQKFSYSLNEHK-NWVRC--VRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR-MNKLLQHYTSH--------TSPVNAVSFHPSGNFLISSSDDSSMKIYDL--LEGRLL-----YTVQGHEGPILGTAFSHCGEMFASGGADHQV 290          
The following BLAST results are available for this feature:
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLE43.509e-10848.73TLE family member 4, transcriptional corepressor [... [more]
TLE49.982e-10848.73TLE family member 4, transcriptional corepressor [... [more]
TLE41.288e-10748.73TLE family member 4, transcriptional corepressor [... [more]
TLE32.497e-10748.16TLE family member 3, transcriptional corepressor [... [more]
TLE43.436e-10748.73TLE family member 4, transcriptional corepressor [... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
unc-371.350e-7939.94Transcription factor unc-37 [Source:UniProtKB/Swi... [more]
unc-371.350e-7939.94Transcription factor unc-37 [Source:UniProtKB/Swi... [more]
prp-193.398e-633.75Pre-mRNA-processing factor 19 [Source:UniProtKB/S... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gro2.865e-10547.88gene:FBgn0001139 transcript:FBtr0337057[more]
gro3.529e-10547.88gene:FBgn0001139 transcript:FBtr0305047[more]
gro4.983e-10547.88gene:FBgn0001139 transcript:FBtr0084962[more]
gro4.983e-10547.88gene:FBgn0001139 transcript:FBtr0084965[more]
gro4.983e-10547.88gene:FBgn0001139 transcript:FBtr0084964[more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tle2b8.362e-10847.88TLE family member 2, transcriptional corepressor b... [more]
tle3b6.079e-10648.16TLE family member 3, transcriptional corepressor b... [more]
tle3b6.079e-10648.16TLE family member 3, transcriptional corepressor b... [more]
tle3b6.775e-10648.73TLE family member 3, transcriptional corepressor b... [more]
tle3a8.689e-10648.16TLE family member 3, transcriptional corepressor a... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw44.878e-10848.73F-box and WD repeat domain containing 4 [Source:Xe... [more]
fbxw49.448e-10848.73F-box and WD repeat domain containing 4 [Source:Xe... [more]
tle11.020e-10749.01transducin like enhancer of split 1 [Source:NCBI g... [more]
fbxw41.647e-10748.73F-box and WD repeat domain containing 4 [Source:Xe... [more]
fbxw41.647e-10748.73F-box and WD repeat domain containing 4 [Source:Xe... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tle49.800e-10848.73transducin-like enhancer of split 4 [Source:MGI Sy... [more]
Tle41.293e-10748.73transducin-like enhancer of split 4 [Source:MGI Sy... [more]
Tle13.466e-10749.01transducin-like enhancer of split 1 [Source:MGI Sy... [more]
Tle14.552e-10749.01transducin-like enhancer of split 1 [Source:MGI Sy... [more]
Tle14.669e-10749.01transducin-like enhancer of split 1 [Source:MGI Sy... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q04727|TLE4_HUMAN6.185e-10748.73Transducin-like enhancer protein 4 OS=Homo sapiens... [more]
sp|Q62441|TLE4_MOUSE6.855e-10748.73Transducin-like enhancer protein 4 OS=Mus musculus... [more]
sp|O42478|TLE4_XENLA8.475e-10748.73Transducin-like enhancer protein 4 OS=Xenopus laev... [more]
sp|Q07141|TLE4_RAT1.103e-10648.44Transducin-like enhancer protein 4 OS=Rattus norve... [more]
sp|Q04724|TLE1_HUMAN2.450e-10649.01Transducin-like enhancer protein 1 OS=Homo sapiens... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3PKN13.685e-10749.86transducin-like enhancer protein 4 OS=Salmo salar ... [more]
V9KIQ64.552e-10749.01Transducin-like enhancer protein 4-like protein OS... [more]
A0A2P4SZ016.506e-10748.73Uncharacterized protein (Fragment) OS=Bambusicola ... [more]
A0A1A6HBQ14.448e-10649.01Uncharacterized protein (Fragment) OS=Neotoma lepi... [more]
L9L1424.973e-10648.73Transducin-like enhancer protein 4 OS=Tupaia chine... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040766.13.167e-10848.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tle3a5.801e-10648.16TLE family member 3, transcriptional corepressor a... [more]
tle2a2.036e-10547.59TLE family member 2, transcriptional corepressor a... [more]
tle2b4.387e-10548.16TLE family member 2, transcriptional corepressor b... [more]
tle2b1.578e-9846.18TLE family member 2, transcriptional corepressor b... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002530.14.407e-10948.16pep scaffold:Pmarinus_7.0:GL486002:914:6103:1 gene... [more]
ENSPMAT00000002582.11.843e-10748.73pep scaffold:Pmarinus_7.0:GL476407:354021:372810:-... [more]
ENSPMAT00000002471.11.506e-10547.88pep scaffold:Pmarinus_7.0:GL476407:90601:137795:1 ... [more]
wdr48a1.057e-824.27WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
wdr48a1.191e-824.27WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO292803.337e-10749.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423101.067e-6148.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002067.28.230e-10848.73transducin-like enhancer protein 4 [Source:NCBI ge... [more]
TLE35.358e-10648.73transducin-like enhancer protein 3-B [Source:NCBI ... [more]
TLE35.911e-10648.73transducin-like enhancer protein 3-B [Source:NCBI ... [more]
TLE41.079e-10547.88transducin-like enhancer protein 1 [Source:NCBI ge... [more]
tle2b1.291e-10547.88transducin-like enhancer protein 4 [Source:NCBI ge... [more]
back to top
BLAST of Transducin-like enhancer protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073091.11.502e-98100.00SMESG000073091.1[more]
SMESG000026880.12.761e-9844.89SMESG000026880.1[more]
SMESG000026880.13.237e-9844.89SMESG000026880.1[more]
SMESG000030483.13.366e-726.94SMESG000030483.1[more]
SMESG000024482.11.255e-625.51SMESG000024482.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021696 ID=SMED30021696|Name=Transducin-like enhancer protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3230bp
GTTAATTTTGAATGCTTGAACAAAAAAACAATTACTTATCAAATTTTTAA
ATTATTAGTTAAATATTTATATAATGTTTCCAAACCGAGCTCCTGTACCT
CCAGGTTCTGGTTCTTCTTATAAATTGTCAATTCCAGAAACATGTGATAG
AATTAAAGAAGAATTTTCCTATTTTCAACAACAAACTCATAACTTTCATG
TTGAAAGGGAGAAGATAATCCAGGAAAGAAGTGAAATGCAAAGATTATGT
ATTATGTATTACGAAATGGCGCATGGACTTAACTTAGAAATGCACCGACA
GATGGAAATAGCAAAGCGGTTGAATGCAATTCTCAATCAGTTAATACCTT
ATTTATCACAAGAGCATCAGGGTCAGATTTCAACTGCAATCGAACGTGCT
AAACAGGTAACAATGCAAGAATTAAATTCAGCAATGATGGTAGGTTTGTC
AAATACTTTATATGTAATACTTTTAAAACAGCACACGGAAGAAGCAAAAT
GCTCAAAGTTTTTTAATGGTGGTAATTTTGGATTTCCAGATCAATTAGAA
TTCTATAAACATATGCTTAATGCTGCTGCAACTTTGAATCCTTCTGGAGG
ATCTAGTACTGTTACATCTGGTGGATCATCATCTGCCAGTGGTTTTCCTT
TACCTTCGCCTGCTCCACTCATGTCAAATTCTCTTAGTGGAGGTGGTGTT
TCTTCAGTTCCATCACAAGTTCCCAATGTTCCACCTCTTCCTCCAGTTTC
AGCTGGCGCTAATGCTTCATCATTAGCTGCTGGTGCTGCAAGCTTTTTTG
CTAATCTTATGGCATCTGGAACATCAGGATTTGGCCAAAATGCATTAGCC
GCAAATGCTGCCTTGGCAGGGAATCCTGCTGCTGCAAACTTCTTTTTAAA
TGCTTCATCAGGCCAGCAATTGAATACTAACAATCTCAATTTAGCATCAG
CTCTTTTAAAACAAGAAGCTGATAAACACATGAATGATGATAAACAGAAA
GATTCCAGTTTCAGTCGCCCACCAAGTGCTAATGATAAACTGCACAACTT
GAGTCGTGACAATTTATCCAATCATATATCAGAGGTTCATGAAAAGCGTA
GAAAATTAGACATGAAAATTGAACATAAAGATGAAGATGAACATTATGAT
GATAAACGGTGCAGCACATTGAATGGAAATGGAAAATTAAAAGACAATGA
ATGGCGGCATATGGATAATTTACCAATTTCTCCTAGAAGTGTAGGTAGCA
GCACTCCAGGATTAAATAAAAAAAAATCCAGTAAAAATGCGTTAGATCTT
AGTCAGGGTCCGGGAGCAAATTCATCAAACGATGGATATCCAACAACATG
TAGTGCTCCTACTACTCCCGCAACCGGAAGTCTCATACCTATCGGCAGTC
GTAGTTCAGAAGCTAATAATCTCAGTGCAACTAAATCCAAAAATCATTCT
GGAAAATCACTTTCCCAATCATCCTCTAAAAAGCATTATAATTATGTTGT
CAAACCCAACGGCTCCGTGGAACCTCGGTTAATGCCTATTGATACAATTA
CTAACTCAAACCAATATCCTCAGCATTTGCGTCATTTAGCATCTTTCAAC
CACGGTGAAGTAGTATGTGCAGTTGCCATGCACCAACAAACTGTATTTTC
CGGGGGAAAGGGTACACTAAAATTATGGGACATTAATGACAATGTAATAC
GAGGATCATCGTCACCGGCTTCCAGAGATCCTGTTGCTTCTTTGAGTTGT
TTAAATTCAGATTCATATATTCGTTCAATTAAATTAATAAATGGTAGTGC
TGCAGTTATTGGAGGTGAAACGAATATTATTGATATATGGGATATGGCAG
CCAGCGGTTCTCCAATTAAAAAGGGTGAGGTGAAAATAGACGCTCCTGCT
TGTTATGCACTCACTGTGGCCCCAGATGGTAAAACGTGTTTCAGCTGTTT
CTCGGATGGAAATATTGCAATGATTGATATTCACAATCAAACGGTAATTA
ATCAATTCCAAGCTCACGTAGAAGGAGCATCTTGTATTGAGATTAGCTCT
GATGGCACTTATCTCTGGACTGGTGGACTTGATAGTGCTGTTAGAGCCTG
GGATATTAGAGATTGTGGTCGAGAATTAAAAACAATTGAATTTCACGCGC
AAATTTTCTCAATCGGTCTAACTTCAACTAAAGATAATCGATTTGTTAGA
CCAGGCTATGATTGGCTAGCTGTTGGTCTTGAAAATTCCGATATTGATTT
AGTTAGAGTTTCTCCACTTGAAATCAACGTGCCACCACCTCAAGAGCATT
ATAGATTACAGTTACATGATAATTGCGTTTTATCATTACGGTTCGCTCAT
CATAACGATTGGTTTATAACTACGAGCAAGGATCACCTCATCAATGCTAT
TACTTGCCCCAGCGGTATCAACATCTTGCAGACCAAAGAAGCTGGTTCAG
TGTTGACCAGTGATATTTCTTCCGATGACAAATATGTTGTCACTGGTTCT
GGTGATCGGAAAGCGACTCTCTATGACGTGGTTTATCCGAATAATGATTG
TTGAGATAGAGTGCAATGTAAATAATACGTTTACGAATTCTGTCAAATAA
TTAATTATCATTTATCTTAATGATAATAATAACAATTTACAATAAACTTT
GCTATTTCAATATTCTTGATTTTCATTTACAATTCGGCAGCTGCATTCTT
TTACCATATAGTTTCATCATATATATACATAATTTACGAATATTATTCGA
TGATTCTATTCCATTTTTAATGATTTTCACTGTTGGTGGGGATGTTGATA
ATGGCAATCTATGTACAACTTATAAATAGAGAAAACCGTAAGTAATATTT
GGATATTTATTTGTTTTATAACTATATTAAACAATTAAATGATGTGCGTG
CGCGTATAACTGAATTTCAGTTTTTATGCTCCTGCGCATCTCTGTGTGGC
GGGGTTTTGGTAGATAAACTTAGTCAAATTGTGTCCGATGAGAGGATTTT
GCGTGTATAGAAACATTGTAGTAAAAGACACAAGAATTAGAGATTCAATT
AATCTGTTTTCTTTTCGATTGCAGTTCAGTAATATGTGAATTGTTATATT
TATTTTGAAAATATGATTTTCTTGTTTTATCCCATTTGAAAGATCTGGAA
TGTGTTGTTATTTATCTAAAATATTTATTGACATTTTCAAAATGCATATA
CTGTAGATCTCAATTGAATGATTTGCTAAT
back to top

protein sequence of SMED30021696-orf-1

>SMED30021696-orf-1 ID=SMED30021696-orf-1|Name=SMED30021696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=827bp
MFPNRAPVPPGSGSSYKLSIPETCDRIKEEFSYFQQQTHNFHVEREKIIQ
ERSEMQRLCIMYYEMAHGLNLEMHRQMEIAKRLNAILNQLIPYLSQEHQG
QISTAIERAKQVTMQELNSAMMVGLSNTLYVILLKQHTEEAKCSKFFNGG
NFGFPDQLEFYKHMLNAAATLNPSGGSSTVTSGGSSSASGFPLPSPAPLM
SNSLSGGGVSSVPSQVPNVPPLPPVSAGANASSLAAGAASFFANLMASGT
SGFGQNALAANAALAGNPAAANFFLNASSGQQLNTNNLNLASALLKQEAD
KHMNDDKQKDSSFSRPPSANDKLHNLSRDNLSNHISEVHEKRRKLDMKIE
HKDEDEHYDDKRCSTLNGNGKLKDNEWRHMDNLPISPRSVGSSTPGLNKK
KSSKNALDLSQGPGANSSNDGYPTTCSAPTTPATGSLIPIGSRSSEANNL
SATKSKNHSGKSLSQSSSKKHYNYVVKPNGSVEPRLMPIDTITNSNQYPQ
HLRHLASFNHGEVVCAVAMHQQTVFSGGKGTLKLWDINDNVIRGSSSPAS
RDPVASLSCLNSDSYIRSIKLINGSAAVIGGETNIIDIWDMAASGSPIKK
GEVKIDAPACYALTVAPDGKTCFSCFSDGNIAMIDIHNQTVINQFQAHVE
GASCIEISSDGTYLWTGGLDSAVRAWDIRDCGRELKTIEFHAQIFSIGLT
STKDNRFVRPGYDWLAVGLENSDIDLVRVSPLEINVPPPQEHYRLQLHDN
CVLSLRFAHHNDWFITTSKDHLINAITCPSGINILQTKEAGSVLTSDISS
DDKYVVTGSGDRKATLYDVVYPNNDC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR009146Groucho_enhance
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR005617Groucho/TLE_N
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003714transcription corepressor activity
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001707mesoderm formation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0017053transcriptional repressor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 738..777
e-value: 0.42
score: 19.4
coord: 501..536
e-value: 1.4
score: 16.0
coord: 781..818
e-value: 1.5
score: 15.9
coord: 550..590
e-value: 260.0
score: 1.7
coord: 638..677
e-value: 3.9E-5
score: 33.0
coord: 594..635
e-value: 11.0
score: 10.4
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 645..679
score: 12.113
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 462..821
e-value: 1.9E-82
score: 278.7
IPR005617Groucho/TLE, N-terminal Q-rich domainPFAMPF03920TLE_Ncoord: 1..121
e-value: 1.2E-52
score: 177.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 447..473
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 374..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 333..348
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 313..332
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..348
NoneNo IPR availablePANTHERPTHR10814:SF21PROTEIN GROUCHOcoord: 16..127
coord: 281..821
IPR009146Groucho/transducin-like enhancerPANTHERPTHR10814TRANSDUCIN-LIKE ENHANCER PROTEINcoord: 16..127
coord: 281..821
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 664..678
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 507..686
score: 13.817
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 499..819