Nicotinic acetylcholine receptor alpha 6 subunit

Overview
NameNicotinic acetylcholine receptor alpha 6 subunit
Smed IDSMED30021693
Length (bp)1830
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nicotinic acetylcholine receptor alpha 6 subunit (SMED30021693) t-SNE clustered cells

Violin plots show distribution of expression levels for Nicotinic acetylcholine receptor alpha 6 subunit (SMED30021693) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nicotinic acetylcholine receptor alpha 6 subunit (SMED30021693) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nicotinic acetylcholine receptor alpha 6 subunit (SMED30021693) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021693

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30021693SMESG000000214.1 SMESG000000209.1 dd_Smed_v4_9864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021693SMESG000000214.1 SMESG000000209.1 dd_Smed_v4_9864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021693SMESG000000214.1 SMESG000000209.1 dd_Smed_v4_9864_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 322.013 bits (824), Expect = 8.961e-103
Identity = 194/500 (38.80%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 322.013 bits (824), Expect = 8.961e-103
Identity = 194/500 (38.80%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 322.398 bits (825), Expect = 1.604e-102
Identity = 194/500 (38.80%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   52 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 522          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 318.931 bits (816), Expect = 1.507e-101
Identity = 192/500 (38.40%), Postives = 285/500 (57.00%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVD+K Q++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 318.931 bits (816), Expect = 1.507e-101
Identity = 192/500 (38.40%), Postives = 285/500 (57.00%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVD+K Q++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 275.018 bits (702), Expect = 4.440e-85
Identity = 173/494 (35.02%), Postives = 266/494 (53.85%), Query Frame = 1
Query:  229 EKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPD---SICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTH-NIY---QDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            E+RL + L        +N LERPV N S PV V     L QIIDVDEKNQ++  + WL   WNDY+  W+ +EYG IT +      +W PDVLLYNS D NF++     +++   G + +VPPG+FK +C +D+ WFPFD Q C  KFG+W+YDG  ++L+                G  ++  Y  +GEW L  + + R  + Y CC   + DV   + + RR  YY FN ++PCI+ + + LL F LP DAGEKI+L +T++LS+  F  ++++  P +S ++PLL ++F   M++ T S +FTV VLN H+     H +  + R ++  W+  +L +  P    +  ++ +  S KP    +  I N K +   L+      +D   N Y   Q +     SL    +++  + NG   +V     L  LH    ++  +L+ +T ++ E D+E      WKFAA V+DR C+ +FT+     T GIF+SA
Sbjct:   23 ERRLYEDLMR-----NYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQ-------------PATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFSTKPNRHSESLIRNIKDNEHSLSRANSFDADCRLNQYIMTQSVSNGLTSLGSIPSTMISS-NGTTTDVSQQATLLILH----RIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTIFIIVSTIGIFWSA 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 261.151 bits (666), Expect = 2.726e-79
Identity = 173/555 (31.17%), Postives = 287/555 (51.71%), Query Frame = 1
Query:  199 FFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDHK----VPRFIRVIINQWLAKVLFITPPDSI---------CTISTKASKKPPVIIDKTIYN--SKVSHSLLANVLELSSDTHNIYQDLFK-----KRKSLS----------EFETSVDDAVNG-DCQNVE---DSGMLCSLHED---------------------------LKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
             FR +  G +E+RL   L      + +N L RPV+NES  V VL G    QI+D+DEK+QI+ +++WL + W D++  W+PSE+G I  + +  N +W PDVLLYNS D  F++   V  V+ Y G+++++PP + +S+C +D+ +FPFD Q+CT+KFG+W+Y G   +L                   +    Y  +GEWEL+    +R++  Y CC   + DV  T+ I RR  YY FN +LPC++IS++ALL F LP+D GEK++LGVTI +SL +F +++A+ MPQ+S +LPL+ +YF  +M     S++ TVI LN HH   +    + +F++ ++  WL  +L +  PD +          + + K  ++  + +++ I    +   HS +   + L   T N + D  K     KR S S          +   ++D ++N   C  V    ++G     H+                               +  +L  I+ ++++ +       +W FA+ V+DR C + F+   F  T  I ++A
Sbjct:   15 LFRVIWTGDHERRLYAKL-----AENYNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDL---------------INTTISPATYKPNGEWELLGLTSQRSIFFYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPMNKFLKTLLLGWLPTLLGMERPDVLELSVHGAHYASDNKKKQRQYLIEVERHILTRPNGNGHSAVDKAVHLDLSTGNPHSDAKKSSPSPKRTSASIMGMTGLPTTQMNGALDSSINKYTCTKVTRPLENGSATINHKSSPQINPINNNNIYKCANNQKTQFEDRHFHHILNELRVISARVRKEEAMHALQADWMFASRVVDRVCFLAFSAFLFMCTAIISYNA 549          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 258.84 bits (660), Expect = 2.518e-78
Identity = 171/548 (31.20%), Postives = 284/548 (51.82%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDHK----VPRFIRVIINQWLAKVLFITPPDSI---------CTISTKASKKPPVIIDKTIYN--SKVSHSLLANVLELSSDTHNIYQDLFK-----KRKSLS----------EFETSVDDAVNG-DCQNVE---DSGMLCSLHED---------------------------LKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            G +E+RL   L      + +N L RPV+NES  V VL G    QI+D+DEK+QI+ +++WL + W D++  W+PSE+G I  + +  N +W PDVLLYNS D  F++   V  V+ Y G+++++PP + +S+C +D+ +FPFD Q+CT+KFG+W+Y G   +L                   +    Y  +GEWEL+    +R++  Y CC   + DV  T+ I RR  YY FN +LPC++IS++ALL F LP+D GEK++LGVTI +SL +F +++A+ MPQ+S +LPL+ +YF  +M     S++ TVI LN HH   +    + +F++ ++  WL  +L +  PD +          + + K  ++  + +++ I    +   HS +   + L   T N + D  K     KR S S          +   ++D ++N   C  V    ++G     H+                               +  +L  I+ ++++ +       +W FA+ V+DR C + F+   F  T  I ++A
Sbjct:   28 GDHERRLYAKL-----AENYNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDL---------------INTTISPATYKPNGEWELLGLTSQRSIFFYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPMNKFLKTLLLGWLPTLLGMERPDVLELSVHGAHYASDNKKKQRQYLIEVERHILTRPNGNGHSAVDKAVHLDLSTGNPHSDAKKSSPSPKRTSASIMGMTGLPTTQMNGALDSSINKYTCTKVTRPLENGSATINHKSSPQINPINNNNIYKCANNQKTQFEDRHFHHILNELRVISARVRKEEAMHALQADWMFASRVVDRVCFLAFSAFLFMCTAIISYNA 555          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Match: acr-25 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q65XS8])

HSP 1 Score: 254.603 bits (649), Expect = 7.833e-77
Identity = 165/520 (31.73%), Postives = 264/520 (50.77%), Query Frame = 1
Query:  268 VDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPP-------------DS-------------------ICTISTKASKKPP------VIIDKTIYNSKVSHSLLANVLELSSDTHNIYQD---LFKKRKSLSEFETSVD----DAVN--GDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFS 1677
            ++ + PLERP++N S  V V  G  L QI+DVDEKNQ++  + WL   W DY   W P +YGG+T +      +W PDVL+YNSAD  F++  +  +++  +G ++++PPGL++ +C + V WFPFDVQ C LKFG+W++DG  +NL+I                  ++  Y ++GEW L  + ++R +Q Y CC   + D+  T VI RR  YY FN +LPCI+I+ + L+ F  P DAGEK+SL +TIMLS+ +FQ  +A+  P +S ++P L+ +F   +      +  T + LN HH     H++    R+++ +W+  +L +  P             DS                   I  I+ +++K  P       I+D+   + +    L  + +    D      D    ++   + S+   S      +A N  G+   VE    L  L    ++V   L  I   I+E ++      +WKF+A V+DR C++IFT   F  T  +F S
Sbjct:   34 LEDYEPLERPIENSSEAVMVKMGLVLQQIVDVDEKNQVVDVNAWLKFSWVDYSLKWKPEDYGGVTDLRFRKGQLWTPDVLMYNSADPQFDSRYASNLLVYPNGLVNWMPPGLYRLSCKIQVVWFPFDVQECFLKFGSWTFDGTKLNLEID-------------DNGFDISNYMQNGEWTLEGTTVKRNIQYYQCCPEPYYDLVFTFVIRRRALYYAFNLILPCILITMLTLVGFTFPPDAGEKMSLQITIMLSICIFQNYVAELSPPTSEAVPFLSAFFAVCLFTCACCVTATTLALNFHHRTGKSHQMNNTFRLLMLEWIPWLLMMRRPGYVARCGKIVKQDDSEDEFEERQTRLDQQRIATIISQITVESNKPTPTFPRRVTIVDEVNSDGEAEEPLPPDEVIREEDDDVASMDDPPAWRSTTTTSQPPQSPAHLWWNATNRMGNRVPVEQIAQLLVL----QQVHGHLSEINKHIREREKSKKIEDDWKFSALVVDRICMVIFTSFLFGSTVALFAS 536          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 245.743 bits (626), Expect = 2.228e-74
Identity = 160/513 (31.19%), Postives = 274/513 (53.41%), Query Frame = 1
Query:  184 LSVILFFRDVNAGSY-EKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNT---VWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHH---NDHKVPRFIRVIINQWLAKVLFITPPD------SICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLK-EWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            LS+++   ++  GS  E +L   L     +  +NPLERPV+N S P+EV     L QI+DVDEKNQI+  + WLS  W D+   W P +YGGI  I   P +   +W PDVLLYNSA  +F++     ++  + G++ ++PPG+ K  C +DVTWFPFD Q C +KFG+W++ G  ++L+I +    + +         ++  Y  +GEW++IS++ +R V  Y CC   +  V   + I RR  YY FN ++P ++IS +A+L F+ P DAGEKI+L VTI+L++  F  ++++  P +S ++PL+ ++F   M++ + S++FT++VLN H    + H++   +R ++ ++L  +LF++ P       ++   + K  KKP   +D  + ++   +   A +L                                          +L S+H +L++V              +E  ++++ +W+FAA V+DR C+++FT+        I  SA
Sbjct:   10 LSLVIIHSNLCDGSVAETKLFTDL-----LKGYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIR-FPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQIDDDTNGTQSM--------DLSTYLVNGEWQVISTNAKRVVSYYKCCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLEFLPWLLFMSRPGYKFVKANVIDSTDKMPKKPKNPLDCNLPSNHAGYE--AQIL------------------------------------------LLHSVHTELRRV--------VAFYNKEEHDERIQTDWRFAAMVVDRACLLLFTVFIVISILAIMMSA 456          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079914)

HSP 1 Score: 357.066 bits (915), Expect = 1.231e-116
Identity = 207/511 (40.51%), Postives = 321/511 (62.82%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVN-GDCQNVED--SGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            ++FL++I   ++   G +EKRLL HL +      +N LERPV NES P+EV FG TL QIIDVDEKNQ++ T++WLS+ WNDY+  WN +EYGG+  + + PN +W PDVL+YNSAD  F+      +V+ ++GS  YVPPG+FKSTC +D+TWFPFD Q+C +KFG+W+YDG  ++L +             +    ++  +  +GEW L++   ++    YACC   ++D+  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A+ +PQ S ++PLL  YF  +M +   S++ TV+VLN HH     H++P +I+ +  QWL  +L +  P        K ++K  ++ ++        + S SLLANVL++  D           R ++S  +T++  + + G    VE+  + + C+ H+DL  + K+L+FIT ++++ D+E + + +WKFAA V+DRFC+I+FTL     T  +  SA
Sbjct:   15 LIFLAII---KESCQGPHEKRLLNHLLS-----TYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLN------------SEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRP------GRKITRKTILLSNRMKELELKERSSKSLLANVLDIDDDF----------RHTISGSQTAIGSSASFGRPTTVEEHHTAIGCN-HKDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLLSA 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0303898)

HSP 1 Score: 356.681 bits (914), Expect = 1.663e-116
Identity = 206/511 (40.31%), Postives = 322/511 (63.01%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVN-GDCQNVED--SGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            ++FL++I   ++   G +EKRLL HL +      +N LERPV NES P+EV FG TL QIIDVDEKNQ++ T++WLS+ WNDY+  WN +EYGG+  + + PN +W PDVL+YNSAD  F+      +V+ ++GS  YVPPG+FKSTC +D+TWFPFD Q+C +KFG+W+YDG  ++L +             +    ++  +  +GEW L++   ++    YACC   ++D+  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A++MP +S ++PL+  YF  +M +   S++ TV+VLN HH     H++P +I+ +  QWL  +L +  P        K ++K  ++ ++        + S SLLANVL++  D           R ++S  +T++  + + G    VE+  + + C+ H+DL  + K+L+FIT ++++ D+E + + +WKFAA V+DRFC+I+FTL     T  +  SA
Sbjct:   15 LIFLAII---KESCQGPHEKRLLNHLLS-----TYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLN------------SEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRP------GRKITRKTILLSNRMKELELKERSSKSLLANVLDIDDDF----------RHTISGSQTAIGSSASFGRPTTVEEHHTAIGCN-HKDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLLSA 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079916)

HSP 1 Score: 356.681 bits (914), Expect = 1.663e-116
Identity = 206/511 (40.31%), Postives = 322/511 (63.01%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVN-GDCQNVED--SGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            ++FL++I   ++   G +EKRLL HL +      +N LERPV NES P+EV FG TL QIIDVDEKNQ++ T++WLS+ WNDY+  WN +EYGG+  + + PN +W PDVL+YNSAD  F+      +V+ ++GS  YVPPG+FKSTC +D+TWFPFD Q+C +KFG+W+YDG  ++L +             +    ++  +  +GEW L++   ++    YACC   ++D+  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A++MP +S ++PL+  YF  +M +   S++ TV+VLN HH     H++P +I+ +  QWL  +L +  P        K ++K  ++ ++        + S SLLANVL++  D           R ++S  +T++  + + G    VE+  + + C+ H+DL  + K+L+FIT ++++ D+E + + +WKFAA V+DRFC+I+FTL     T  +  SA
Sbjct:   15 LIFLAII---KESCQGPHEKRLLNHLLS-----TYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLN------------SEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRP------GRKITRKTILLSNRMKELELKERSSKSLLANVLDIDDDF----------RHTISGSQTAIGSSASFGRPTTVEEHHTAIGCN-HKDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLLSA 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079915)

HSP 1 Score: 356.295 bits (913), Expect = 1.832e-116
Identity = 207/511 (40.51%), Postives = 320/511 (62.62%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVN-GDCQNVED--SGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            ++FL++I   ++   G +EKRLL HL +      +N LERPV NES P+EV FG TL QIIDVDEKNQI+ T+ WL++ WNDY+  WN +EYGG+  + + PN +W PDVL+YNSAD  F+      +V+ ++GS  YVPPG+FKSTC +D+TWFPFD Q+C +KFG+W+YDG  ++L +             +    ++  +  +GEW L++   ++    YACC   ++D+  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A+ +PQ S ++PLL  YF  +M +   S++ TV+VLN HH     H++P +I+ +  QWL  +L +  P        K ++K  ++ ++        + S SLLANVL++  D           R ++S  +T++  + + G    VE+  + + C+ H+DL  + K+L+FIT ++++ D+E + + +WKFAA V+DRFC+I+FTL     T  +  SA
Sbjct:   15 LIFLAII---KESCQGPHEKRLLNHLLS-----TYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLN------------SEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRP------GRKITRKTILLSNRMKELELKERSSKSLLANVLDIDDDF----------RHTISGSQTAIGSSASFGRPTTVEEHHTAIGCN-HKDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLLSA 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0331284)

HSP 1 Score: 356.295 bits (913), Expect = 2.424e-116
Identity = 206/511 (40.31%), Postives = 321/511 (62.82%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVN-GDCQNVED--SGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            ++FL++I   ++   G +EKRLL HL +      +N LERPV NES P+EV FG TL QIIDVDEKNQI+ T+ WL++ WNDY+  WN +EYGG+  + + PN +W PDVL+YNSAD  F+      +V+ ++GS  YVPPG+FKSTC +D+TWFPFD Q+C +KFG+W+YDG  ++L +             +    ++  +  +GEW L++   ++    YACC   ++D+  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A++MP +S ++PL+  YF  +M +   S++ TV+VLN HH     H++P +I+ +  QWL  +L +  P        K ++K  ++ ++        + S SLLANVL++  D           R ++S  +T++  + + G    VE+  + + C+ H+DL  + K+L+FIT ++++ D+E + + +WKFAA V+DRFC+I+FTL     T  +  SA
Sbjct:   15 LIFLAII---KESCQGPHEKRLLNHLLS-----TYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLN------------SEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRP------GRKITRKTILLSNRMKELELKERSSKSLLANVLDIDDDF----------RHTISGSQTAIGSSASFGRPTTVEEHHTAIGCN-HKDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLLSA 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 316.62 bits (810), Expect = 8.479e-101
Identity = 193/524 (36.83%), Postives = 294/524 (56.11%), Query Frame = 1
Query:  181 FLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYN--SKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV----------------NGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            F +    +R    G +++RL + L     +  +NPLERPV N++  + V F  +L QI+DVDEKNQ++ T+IWL + W DY+  WN SEY G+T +    + +W PD+LLYNSAD  F+A     V+++  G+  Y+PPG+FKSTC +DV WFPFD+Q C LKFG+W+Y G  ++L++                + ++  Y  +GEW+L+    RR  + Y CC+  + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV VL  H++D    K+P++ RV++  W A  L +  P          +K+P   +     N    V+ S   N+L +           F+   ++  + TS D  V                     +V  SG       +L K+  ++ +I+ + ++ DEE     EWKFAA VIDR C++ F+L     T GI  SA  F
Sbjct:   10 FTTTCCLWRVSLQGEHQRRLYRDL-----MKDYNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQM---------------IDADITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNKQPRSSLSSVDLNISPGVAQSTNGNLLYIG----------FRGMDTI-HYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSG---PGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAPNF 499          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 316.235 bits (809), Expect = 1.570e-100
Identity = 191/511 (37.38%), Postives = 289/511 (56.56%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYN--SKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV----------------NGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL + L        +NPLERPV N++  + V F  +L QI+DVDEKNQ++ T+IWL + W DY+  WN SEY G+T +    + +W PD+LLYNSAD  F+A     V+++  G+  Y+PPG+FKSTC +DV WFPFD+Q C LKFG+W+Y G  ++L++                + ++  Y  +GEW+L+    RR  + Y CC+  + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV VL  H++D    K+P++ RV++  W A  L +  P          +K+P   +     N    V+ S   N+L +           F+   ++  + TS D  V                     +V  SG       +L K+  ++ +I+ + ++ DEE     EWKFAA VIDR C++ F+L     T GI  SA  F
Sbjct:   24 GEHQRRLYRDLMK-----DYNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQM---------------IDADITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNKQPRSSLSSVDLNISPGVAQSTNGNLLYIG----------FRGMDTI-HYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSG---PGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAPNF 500          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 306.22 bits (783), Expect = 8.986e-97
Identity = 193/528 (36.55%), Postives = 294/528 (55.68%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCS--------------------LHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            V FLS+ L +     G Y+++L K L     ++ +N LERPV N+S P+ V  G TL QIIDVDEKNQ++ T+ WL + W D +  WNP  Y G+  +    N +W PD+LLYNSAD  F+A     V+++  G+  Y+PPG+ KSTC +DV WFPFD+Q C LKFG+W+++G  ++L++Q                V++  Y  +GEW+L+    +R    Y CC+  + DV  T+ + RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TV+VL  HH+D    K+PR++RVI+  W A  L +  P      + K  + P          S +   ++      ++ T N + +L+           S+D A    C    DSG+ CS                       ++ ++  ++ +I  + ++ DE      EWKFAA V+DR C++ F+L +   T  I  SA  F
Sbjct:    5 VYFLSIFLSYIGSLQGEYQRKLYKEL-----MENYNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ---------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEERKANFKYDQSPA----HHASASSIQMGVMPGQPSSTNSTTNGHMNLYFGYH-------SIDSAC---CPPSSDSGVSCSGGRVGGSPNEEQREGVRMFAGEPEIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAPNF 498          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 307.375 bits (786), Expect = 9.458e-97
Identity = 187/502 (37.25%), Postives = 288/502 (57.37%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPP--DSI-CTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELS-SDTHNIYQDLFKKRKSLSE--FETSVDDAVNGDCQ---NVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL + L     +  +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ T+IWL + W DY+  WN S+Y G+  +    + +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                N ++  Y  +GEW+L+    RR  + Y CC+  + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  H++D    K+P++ RV++  W A  L +  P  D I      K +++  V   +   +     +   N+L         ++    +    L       S DD +    Q    V    +  +L  +L K+ +++ +I  + ++ D +     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:   54 GEHQRRLYRDL-----MKNYNPLERPVYNDSHSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDLQM---------------INADITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHYHDPDGAKMPKWTRVLLLNWCAWFLRMRRPGEDRIRLACHNKPARRSSVSSVELSVSQGALQAAGGNMLYFGFRGMEGVHYTAHESHSVLCSRLMANSEDDVLLPGAQIRGGVTSGIVGGTLELELAKILEEVRYIAKRFRDQDADESVCNEWKFAAAVIDRLCLMAFSIFTILCTIGILMSAPNF 535          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 305.834 bits (782), Expect = 1.660e-96
Identity = 193/528 (36.55%), Postives = 294/528 (55.68%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCS--------------------LHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            V FLS+ L +     G Y+++L K L     ++ +N LERPV N+S P+ V  G TL QIIDVDEKNQ++ T+ WL + W D +  WNP  Y G+  +    N +W PD+LLYNSAD  F+A     V+++  G+  Y+PPG+ KSTC +DV WFPFD+Q C LKFG+W+++G  ++L++Q                V++  Y  +GEW+L+    +R    Y CC+  + DV  T+ + RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TV+VL  HH+D    K+PR++RVI+  W A  L +  P      + K  + P          S +   ++      ++ T N + +L+           S+D A    C    DSG+ CS                       ++ ++  ++ +I  + ++ DE      EWKFAA V+DR C++ F+L +   T  I  SA  F
Sbjct:   12 VYFLSIFLSYIGSLQGEYQRKLYKEL-----MENYNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ---------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEERKANFKYDQSPA----HHASASSIQMGVMPGQPSSTNSTTNGHMNLYFGYH-------SIDSAC---CPPSSDSGVSCSGGRVGGSPNEEQREGVRMFAGEPEIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAPNF 505          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 330.102 bits (845), Expect = 6.994e-106
Identity = 193/500 (38.60%), Postives = 294/500 (58.80%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNG--DCQNVEDSGMLCSLHE-----DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G Y+++L K L     +  +NPLERPV N+S P+ V FG +L QI+DVDEKNQ++ T+IWL + W DY+  WN SEY G+  +      +W PD+LLYNSAD  F+A+    V+++  G   Y+PPG+FKS+C +DV WFPFD+Q C LKFG+W+Y G  ++L++                  ++  Y  +GEW+L+    +R+   Y CC+  ++DV  TI++ RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D     +P++ R+I+  W A  L +  P           K  PV   K    S  S  +     + SS+ + +Y   F+  + +    T     + G   C   +D  +L ++H      DL K+ ++L +I  + ++ D++     EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   25 GEYQRKLYKEL-----MKNYNPLERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQM---------------LESDISEYISNGEWDLVGVPGKRSENYYECCKEPYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPHGGNMPKWTRIILLNWCAWFLRMKRPGE--------DKVRPVCQHKERRCSMTSVDVNTVSGQQSSNGNMLYIG-FRGLEGIHCTPTPDSGVICGRMTCSPTDDENLLHNVHHSEGDPDLSKILEELRYIANRFRDQDDDESICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAPNF 495          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Match: clca2 (chloride channel accessory 2 [Source:Xenbase;Acc:XB-GENE-980364])

HSP 1 Score: 295.819 bits (756), Expect = 9.302e-93
Identity = 193/515 (37.48%), Postives = 302/515 (58.64%), Query Frame = 1
Query:  193 ILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANV-LELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNG------DCQNVEDSGMLC--SLHEDLKKVKKQLE---FITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFS 1692
            + F +  + G Y+++L + L        +N LERPV N+S P+ V    TL QIIDVDEKNQ++ T+ WL I WND++  W+ +EY G+  +    + +W+PD+LLYNSAD  F+A     V+++  G+  Y+PPG+ KSTC +DV WFPFDVQ C LKFG+W+++G  ++L++                  ++  Y  +GEW+L+    +R    Y CC+  + DV  T+ + RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S+MV+  LS++ TV+VL  HH+D    K+P+ +RVI+  W A  L +  P          +K+P  I  K IY +   HS ++++ + ++    +   ++        E      ++ +G      +C ++EDS ++   SL E + ++ K LE   +I  + +E D   +   EWKFAA VIDR C++ F+L A   T  I  SA  F+
Sbjct:    6 LFFSKGSHQGQYQRKLYRELLR-----NYNRLERPVVNDSQPLLVELQLTLLQIIDVDEKNQVLITNAWLQITWNDFYLTWDQAEYPGVQTLRFPADHIWVPDILLYNSADERFDATFHTNVLVNSTGACQYIPPGILKSTCYIDVRWFPFDVQKCKLKFGSWTHNGWLLDLQMM---------------EADISSYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASIMVIVGLSVVVTVLVLQFHHHDPQAGKMPKMVRVILLNWCAWFLRMRKPGE--------NKRP--IPCKYIYPNH--HSSISSIEMNIAPGHQSTNGNIVYCGYHTLESPCCPPNSDSGVMCARVNCPSLEDSDLIQKKSLKESMPEIVKILEEVQYIARRFREQDAGEEICSEWKFAAAVIDRLCLVAFSLFAIIATFTILMSAPNFT 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.396 bits (690), Expect = 3.975e-83
Identity = 164/493 (33.27%), Postives = 271/493 (54.97%), Query Frame = 1
Query:  241 LKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHE------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFS 1692
            ++H    + + ++NP  RPV N S PV + F  +++Q++ VDE NQI++T++WL  +WNDY   WNPS+YGGI  + +  + +W PD++LYN+A   F+  +  K V+ Y G ++++PP +FKS+C +DVT+FPFD QNC+LKFG+W+YD   +NL +                 + +  +  SGEW +I++   +   +Y CC   + D+  ++ I R   +Y    ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++      L KV+F+T P+         + KP   +D  I +S++           S      YQD       L    TS D A N    +  +S     LH       ++++  + + FI   +K  DE  +   +WK+ A VIDR  + +F L+    T G+F   + FS
Sbjct:   27 VEHRLYEDLLKSYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVM-------------IGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPE-----KQPYALKPQAYLD--ISSSEIR----------SCQDQLFYQDSSCACGQLKRLYTS-DTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFS 488          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.011 bits (689), Expect = 5.363e-83
Identity = 164/493 (33.27%), Postives = 271/493 (54.97%), Query Frame = 1
Query:  241 LKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHE------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFS 1692
            ++H    + + ++NP  RPV N S PV + F  +++Q++ VDE NQI++T++WL  +WNDY   WNPS+YGGI  + +  + +W PD++LYN+A   F+  +  K V+ Y G ++++PP +FKS+C +DVT+FPFD QNC+LKFG+W+YD   +NL +                 + +  +  SGEW +I++   +   +Y CC   + D+  ++ I R   +Y    ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++      L KV+F+T P+         + KP   +D  I +S++           S      YQD       L    TS D A N    +  +S     LH       ++++  + + FI   +K  DE  +   +WK+ A VIDR  + +F L+    T G+F   + FS
Sbjct:   24 VEHRLYEDLLKSYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVM-------------IGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPE-----KQPYALKPQAYLD--ISSSEIR----------SCQDQLFYQDSSCACGQLKRLYTS-DTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFS 485          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.011 bits (689), Expect = 5.544e-83
Identity = 164/493 (33.27%), Postives = 271/493 (54.97%), Query Frame = 1
Query:  241 LKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHE------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFS 1692
            ++H    + + ++NP  RPV N S PV + F  +++Q++ VDE NQI++T++WL  +WNDY   WNPS+YGGI  + +  + +W PD++LYN+A   F+  +  K V+ Y G ++++PP +FKS+C +DVT+FPFD QNC+LKFG+W+YD   +NL +                 + +  +  SGEW +I++   +   +Y CC   + D+  ++ I R   +Y    ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++      L KV+F+T P+         + KP   +D  I +S++           S      YQD       L    TS D A N    +  +S     LH       ++++  + + FI   +K  DE  +   +WK+ A VIDR  + +F L+    T G+F   + FS
Sbjct:   19 VEHRLYEDLLKSYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVM-------------IGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPE-----KQPYALKPQAYLD--ISSSEIR----------SCQDQLFYQDSSCACGQLKRLYTS-DTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFS 480          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 325.094 bits (832), Expect = 3.936e-104
Identity = 195/500 (39.00%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R  + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ R+I+  W A  L +  P           K  P    K    S  S  L A     +S+ + +Y   F+  + +    T     V G   C    D  ++   H      DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRRLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ---------------EADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGE--------DKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIG-FRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 268.855 bits (686), Expect = 1.600e-82
Identity = 160/500 (32.00%), Postives = 279/500 (55.80%), Query Frame = 1
Query:  211 VNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSH-SLLANVLELSSDTHNIYQD-----LFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAV 1683
             +A   E RL ++LF     + +N + RPV N S PV + F  +++Q++ VDE NQI++T++WL  IWNDY   W PS+Y G+  + V    +W PD++LYN+AD +F   +  K ++ Y G ++++PP +FKS+C +DVT+FPFD QNCT+KFG+WSYD   ++L +                ++ +  Y  SGEW +I +   +   +Y CCE  + D+  ++ I R   +Y  N ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++ +    L +V+F+T P S    + K          +  Y +++S+ +  +     S       QD        +R  +S F  ++  + +   ++V+    L +L  ++K+  + +++I   +K  +   +   +WK+ A VIDR  + +F L+    T G+F   +
Sbjct:   28 ASASEAEHRLFQYLF-----EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVL-------------IGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKT---------RNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSS--ESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQPL 498          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 268.855 bits (686), Expect = 1.712e-82
Identity = 160/500 (32.00%), Postives = 279/500 (55.80%), Query Frame = 1
Query:  211 VNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSH-SLLANVLELSSDTHNIYQD-----LFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAV 1683
             +A   E RL ++LF     + +N + RPV N S PV + F  +++Q++ VDE NQI++T++WL  IWNDY   W PS+Y G+  + V    +W PD++LYN+AD +F   +  K ++ Y G ++++PP +FKS+C +DVT+FPFD QNCT+KFG+WSYD   ++L +                ++ +  Y  SGEW +I +   +   +Y CCE  + D+  ++ I R   +Y  N ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++ +    L +V+F+T P S    + K          +  Y +++S+ +  +     S       QD        +R  +S F  ++  + +   ++V+    L +L  ++K+  + +++I   +K  +   +   +WK+ A VIDR  + +F L+    T G+F   +
Sbjct:   23 ASASEAEHRLFQYLF-----EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVL-------------IGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKT---------RNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSS--ESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQPL 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 259.61 bits (662), Expect = 4.468e-79
Identity = 162/501 (32.34%), Postives = 266/501 (53.09%), Query Frame = 1
Query:  193 ILFFRDVNAGSYEKRLLKHLFNPNRVDAH-NPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAV 1683
            +  F+       E++L   LF      AH N   RPV+N S PV V F   +TQ+ +VDE NQI++T++WL  IW DY   W+P+EY GI  + V  + +W PD++LYN+A  +F      K ++ YDG +++ PP +FKS+C MD+T+FPFD QNC+LKFG+W+YD  +++L I                 V+M  +  + EWE++ +   +   +Y CCE  + D+  +  I R   +Y  N ++PC+ IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P++++ I  Q    +L +  P  +         K P    K     K +H   + +L+              KR+S  +    V        +N E S        D++ V + ++FI   +K ++E  +   +WK+ A V+DR  + +F ++    T G+F   +
Sbjct:   22 LALFKGSTGCESEEQLFHRLF------AHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLI-------------IGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKP--LDKTKEAGGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWV-------AENSEHSS-------DVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLFLQPL 487          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 248.825 bits (634), Expect = 2.776e-75
Identity = 133/351 (37.89%), Postives = 217/351 (61.82%), Query Frame = 1
Query:  211 VNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHH---NDHKVPRFIRVIINQWLAKVLFITPPDS 1254
             +A   E RL ++LF     + +N + RPV N S PV + F  +++Q++ VDE NQI++T++WL  IWNDY   W PS+Y G+  + V    +W PD++LYN+AD +F   +  K ++ Y G ++++PP +FKS+C +DVT+FPFD QNCT+KFG+WSYD   ++L +                ++ +  Y  SGEW +I +   +   +Y CCE  + D+  ++ I R   +Y  N ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN H+     H +P +++ +    L +V+F+T P S
Sbjct:   23 ASASEAEHRLFQYLF-----EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVL-------------IGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTS 355          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Match: sp|P22770|ACHA7_CHICK (Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 5.298e-104
Identity = 194/505 (38.42%), Postives = 290/505 (57.43%), Query Frame = 1
Query:  205 RDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNG--DCQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            R+   G ++++L K L        +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ C LKFG+W+Y G  ++L++Q                 ++  Y  +GEW+L+    +RT   Y CC+  + D+  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  +     +  S+ + +Y   F+    +    T+    + G   C   E+  +L S H      DL K+ +++ +I  + ++ DEE     EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   18 RESLQGEFQRKLYKELLK-----NYNPLERPVANDSQPLTVYFTLSLMQIMDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDGLIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGGWSLDLQMQ---------------EADISGYISNGEWDLVGIPGKRTESFYECCKEPYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLSSMEMNTVSGQQCSNGNMLYIG-FRGLDGVHCTPTTDSGVICGRMTCSPTEEENLLHSGHPSEGDPDLAKILEEVRYIANRFRDQDEEEAICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Match: sp|Q05941|ACHA7_RAT (Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 2.199e-103
Identity = 195/500 (39.00%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R  + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ R+I+  W A  L +  P           K  P    K    S  S  L A     +S+ + +Y   F+  + +    T     V G   C    D  ++   H      DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRRLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ---------------EADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGE--------DKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIG-FRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Match: sp|P49582|ACHA7_MOUSE (Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 2.753e-103
Identity = 195/500 (39.00%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R  + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ R+I+  W A  L +  P           K  P    K    S  S  L A     +S+ + +Y   F+  + +    T     V G   C    D  ++   H      DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRRLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ---------------EADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGE--------DKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIG-FRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Match: sp|Q866A2|ACHA7_MACMU (Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 8.467e-103
Identity = 195/500 (39.00%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  SGEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPSGEWDLVGIPGKRSEKFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGMHCAPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Match: sp|P36544|ACHA7_HUMAN (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 322.013 bits (824), Expect = 4.303e-102
Identity = 194/500 (38.80%), Postives = 286/500 (57.20%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGD--CQNVEDSGMLCSLH-----EDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G ++++L K L     V  +NPLERPV N+S P+ V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN SEY G+  +      +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKS+C +DV WFPFDVQ+C LKFG+WSY G  ++L++Q                 ++  Y  +GEW+L+    +R+ + Y CC+  + DV  T+ + RR  YY  N ++PC++ISA+ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF S M++  LS++ TVIVL  HH+D    K+P++ RVI+  W A  L +  P           K  P    K    S  S  + A     +S+ + +Y   F+    +    T     V G   C    D  +L          DL K+ +++ +I  + +  DE      EWKFAA V+DR C++ F++     T GI  SA  F
Sbjct:   23 GEFQRKLYKEL-----VKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ---------------EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE--------DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIG-FRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNF 493          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Match: A0A267EGF0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g1 PE=3 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.144e-120
Identity = 228/541 (42.14%), Postives = 315/541 (58.23%), Query Frame = 1
Query:  217 AGSYEKRLLKHLFNP----NRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXX--------XXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNS------------------KVSHSLLANVLELSSDTHNIYQDLFKKRK---------SLSEFETSVDDAVNGDCQN-----------VEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            AG +E+RLL +LF+P    N ++ HN +ERPVKNES  + V F  +L QIID+DEKNQI+  +IWL + W+DYHF W+P ++GGIT IN+ P  VW PD+LLYNSAD  F+      VVI + G+M+++PPG+F+STC +D TWFPFD Q C LKFG+WSYDG  ++L+++  N + S            S IG  ++  Y  SGEW L   D +RT   Y CC   FID+   I I RR  YY  N ++PC++IS+++LL F+LP DAGEKISLGVTIMLSLSMFQLL+AD MPQ+S S+PL+ +YF   MV+ +LS++FTVIVLN HH D   H VP +++  I  +LA +L +           +  +K PV + +    S                  + S SLLANVL+L  D   +                  S   ++  +  +++G  +                G  CS   +L  V ++L+ IT KI ++  +G+   EWKFAA V+DR C+IIF+      T  I FSA
Sbjct:   22 AGLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCSEIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCPYPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRN-------HHRDEEKEPVYLRRRKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSA 555          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Match: A0A267DHA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g2 PE=3 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.039e-119
Identity = 227/543 (41.80%), Postives = 315/543 (58.01%), Query Frame = 1
Query:  217 AGSYEKRLLKHLFNP----NRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXX--------XXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNS------------------KVSHSLLANVLELSSDTHNIYQDLFKKRK---------SLSEFETSVDDAVNGDCQN-------------VEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            AG +E+RLL +LF+P    N ++ HN +ERPVKNES  + V F  +L QIID+DEKNQI+  +IWL + W+DYHF W+P ++GGIT IN+ P  VW PD+LLYNSAD  F+      VVI + G+M+++PPG+F+STC +D TWFPFD Q C LKFG+WSYDG  ++L+++  N + S            S IG  ++  Y  SGEW L   D +RT   Y CC   FID+   I I RR  YY  N ++PC++IS+++LL F+LP DAGEKISLGVTIMLSLSMFQLL+AD MPQ+S S+PL+ +YF   MV+ +LS++FTVIVLN HH D   H VP +++  I  +LA +L +           +  +K P+ + +    S                  + S SLLANVL+L  D   +                  S   ++  +  +++G  +                  G  CS   +L  V ++L+ IT KI ++  +G+   EWKFAA V+DR C+IIF+      T  I FSA
Sbjct:   22 AGLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCSEIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCPYPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRN-------HHRDEEKEPIYLRRRKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSA 557          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Match: A0A348BSV9 (Nicotinic acetylcholine receptor alpha6 subunit 3 OS=Nilaparvata lugens OX=108931 GN=nAChRa6 PE=2 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 5.459e-116
Identity = 207/499 (41.48%), Postives = 306/499 (61.32%), Query Frame = 1
Query:  202 FRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            F+    G +EKRLL HL N   +D +N LERPV NES  +EV FG TL QIIDVDEKNQ++ T+IWLS+ WNDY+  WN SEYGG+  + + PN +W PDVL+YNSAD  F+      VV+ +DGS  YVPPG+FKSTC MD+TWFPFD QNC +KFG+W+YDG  + L+++            +    ++  +  +GEW L+     + V  Y CC   +IDV  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A++MP +S ++PL+  YF  +M +   S++ TV+VLN HH     H++P +++ +  QWL  +L +  P        K ++K  ++ ++        + S SL+AN+L++  D  +          + S F         G    ++DSG       +L+ + ++L+FIT ++K+ DEE + + +WKFAA V+DRFC+I+FT+     T  +  SA
Sbjct:   17 FQSSMQGPHEKRLLNHLLN---MDTYNTLERPVANESEALEVKFGLTLQQIIDVDEKNQLLITNIWLSLEWNDYNLRWNASEYGGVKDLRITPNKIWRPDVLMYNSADEGFDGTYHTNVVVRHDGSCLYVPPGIFKSTCKMDITWFPFDDQNCKMKFGSWTYDGSQLQLELK------------SEEGGDLSDFITNGEWYLLGMPGVKNVLTYQCCPESYIDVTFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPNWVKSVFLQWLPWILGMNRP------GKKITRKTILMTNRMKELHLPDRSSKSLMANILDIDDDFRHC-------STANSSFMRGGGVGGGGGGITLDDSGPCTLAQRELQLIVRELQFITNRMKKADEEAELISDWKFAAMVVDRFCLIVFTMFTIIATVAVLLSA 487          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Match: A0A2Z4N5S7 (Nicotinic acetylcholine receptor alpha 6 subunit OS=Laodelphax striatellus OX=195883 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 9.656e-116
Identity = 210/510 (41.18%), Postives = 309/510 (60.59%), Query Frame = 1
Query:  169 LNVLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            +  L L V+L F+    G +EKRLL HL N   +D +N LERPV NES  +EV FG TL QIIDVDEKNQI+ T+ WL++ W DY+  WN SEYGG+  + + PN +W PDVL+YNSAD  F+      VV+ +DGS  YVPPG+FKSTC MD+TWFPFD QNC +KFG+W+YDG  + L+++            +    ++  +  +GEW L+     + V  Y CC   +IDV  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A+ +PQ S ++PLL  YF  +M +   S++ TV+VLN HH     H++P +++ +  QWL  +L +  P        K ++K  ++ ++        + S SL+AN+L++  D  +          + S F         G    ++DSG       +L+ + ++L+FIT ++K+ DEE + + +WKFAA V+DRFC+I+FT+     T  +  SA
Sbjct:    6 ITALLLHVVLQFQSSMQGPHEKRLLNHLLN---MDTYNTLERPVANESEALEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWTDYNLMWNASEYGGVKDLRITPNKIWRPDVLMYNSADEGFDGTYHTNVVVRHDGSCLYVPPGIFKSTCKMDITWFPFDDQNCKMKFGSWTYDGSQLQLELK------------SEEGGDLSDFITNGEWYLLGMPGVKNVLTYQCCPESYIDVTFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPNWVKSVFLQWLPWILGMNRP------GKKITRKTILMTNRMKELHLPDRSSKSLMANILDIDDDFRHC------SSTANSSFMRGGSGGGGGGI-TLDDSGPCTLAQRELQLIVRELQFITNRMKKADEEAELISDWKFAAMVVDRFCLIVFTMFTIIATVAVLLSA 487          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Match: A0A348BSV8 (Nicotinic acetylcholine receptor alpha6 subunit 2 OS=Nilaparvata lugens OX=108931 GN=nAChRa6 PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.224e-115
Identity = 207/499 (41.48%), Postives = 304/499 (60.92%), Query Frame = 1
Query:  202 FRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTI---YNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            F+    G +EKRLL HL N   +D +N LERPV NES  +EV FG TL QIIDVDEKNQI+ T+ WL++ WNDY+  WN SEYGG+  + + PN +W PDVL+YNSAD  F+      VV+ +DGS  YVPPG+FKSTC MD+TWFPFD QNC +KFG+W+YDG  + L+++            +    ++  +  +GEW L+     + V  Y CC   +IDV  TI I RR  YY FN ++PC++IS++ALL F LP D+GEK++LGVTI+LSL++F  L+A+ +PQ S ++PLL  YF  +M +   S++ TV+VLN HH     H++P +++ +  QWL  +L +  P        K ++K  ++ ++        + S SL+AN+L++  D  +          + S F         G    ++DSG       +L+ + ++L+FIT ++K+ DEE + + +WKFAA V+DRFC+I+FT+     T  +  SA
Sbjct:   17 FQSSMQGPHEKRLLNHLLN---MDTYNTLERPVANESEALEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNASEYGGVKDLRITPNKIWRPDVLMYNSADEGFDGTYHTNVVVRHDGSCLYVPPGIFKSTCKMDITWFPFDDQNCKMKFGSWTYDGSQLQLELK------------SEEGGDLSDFITNGEWYLLGMPGVKNVLTYQCCPESYIDVTFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPNWVKSVFLQWLPWILGMNRP------GKKITRKTILMTNRMKELHLPDRSSKSLMANILDIDDDFRHC-------STANSSFMRGGGVGGGGGGITLDDSGPCTLAQRELQLIVRELQFITNRMKKADEEAELISDWKFAAMVVDRFCLIVFTMFTIIATVAVLLSA 487          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 318.161 bits (814), Expect = 2.034e-101
Identity = 195/515 (37.86%), Postives = 297/515 (57.67%), Query Frame = 1
Query:  193 ILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV-NGDCQNVEDSGMLCS------------LHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            I  +R    G +++RL + L     +  +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ ++IWL + W D++  WN S+Y G+T +    N +W PD+LLYNSAD  F+A     VV+S DGS  Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                  ++  Y  +GEW+L+    +R  + Y CC   + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV VL  H++D    K+P + R+++  W A  L +  P     +    +K+P   I     ++ V  S   N+L +           F+  +S+  + TS D  V  G   +  +  +L S            +  +L K+ +++ +I+ + ++ DEE     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:   14 ICLWRVSLQGEHQRRLYQDL-----MKNYNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM---------------EADISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGED-RVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIG----------FRGMESMP-YATSPDSGVICGRLVSAGEEDVLLSTNPAPSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPNF 496          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 315.079 bits (806), Expect = 1.835e-100
Identity = 193/506 (38.14%), Postives = 294/506 (58.10%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV-NGDCQNVEDSGMLCSLHE------------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL + L     +  +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ ++IWL + W D++  WN S+Y G+T +    N +W PD+LLYNSAD  F+A     VV+S DGS  Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                  ++  Y  +GEW+L+    +R  + Y CC   + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV VL  H++D    K+P + R+++  W A  L +  P     +    +K+P   I     ++ V  S   N+L +           F+  +S+  + TS D  V  G   +  +  +L S +             +L K+ +++ +I+ + ++ DEE     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:   10 GEHQRRLYQDL-----MKNYNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM---------------EADISGYIANGEWDLVGKG-QRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGED-RVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIG----------FRGMESM-PYATSPDSGVICGRLVSAGEEDVLLSTNPAPSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPNF 482          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 314.309 bits (804), Expect = 2.217e-100
Identity = 189/487 (38.81%), Postives = 285/487 (58.52%), Query Frame = 1
Query:  277 HNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV-NGDCQNVEDSGMLCS------------LHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ ++IWL + W D++  WN S+Y G+T +    N +W PD+LLYNSAD  F+A     VV+S DGS  Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                  ++  Y  +GEW+L+    +R  + Y CC   + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV VL  H++D    K+P + R+++  W A  L +  P     +    +K+P   I     ++ V  S   N+L +           F+  +S+  + TS D  V  G   +  +  +L S            +  +L K+ +++ +I+ + ++ DEE     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:    4 YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM---------------EADISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGED-RVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIG----------FRGMESMP-YATSPDSGVICGRLVSAGEEDVLLSTNPAPSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPNF 463          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Match: ENSAMXT00000053066.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 309.301 bits (791), Expect = 1.406e-98
Identity = 188/481 (39.09%), Postives = 279/481 (58.00%), Query Frame = 1
Query:  277 HNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSL-----HED--LKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ T+IWL + W DY+  WN ++Y G+  +    N +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                + ++  Y  +GEW+L+    RR  + Y CC+  + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  HH+D    K+P++ RV++  W A  L +  P      S   +K+       ++  S    +L  N         N+    F+  + +  + TS             DSG+LC        ED  L K+ ++L +I  + +  DE+     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM---------------DADITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQLHRGSVSSVELSVSQGALQPN-------NSNMLYIGFRGMEGV-HYTTS------------PDSGVLCGRIMGGSEEDTELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAPNF 449          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Match: ENSAMXT00000055784.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 304.294 bits (778), Expect = 3.091e-96
Identity = 187/500 (37.40%), Postives = 282/500 (56.40%), Query Frame = 1
Query:  277 HNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV------NGDCQNVEDSGMLCSLHE--------------------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ T+IWL + W DY+  WN ++Y G+  +    N +W PD+LLYNSAD  F+A     V+++  G   Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                + ++  Y  +GEW+L+    RR  + Y CC+  + DV  T+V+ RR  YY  N ++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  HH+D    K+P++ RV++  W A  L +  P      S   +K+       ++  S    +L  N         N+    F+  + +  + TS D  V       G  ++V   G   S ++                    +L K+ ++L +I  + +  DE+     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM---------------DADITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQLHRGSVSSVELSVSQGALQPN-------NSNMLYIGFRGMEGV-HYTTSPDSGVLCGRIMGGSEEDVLLPGATVSSYQGRVGVGGRVTGGVVGGATETELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAPNF 480          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 254.603 bits (649), Expect = 4.808e-78
Identity = 158/509 (31.04%), Postives = 270/509 (53.05%), Query Frame = 1
Query:  214 NAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVE----------------DSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAV 1683
             A     RL K LF      ++NP  RPV N S PV V F  +++Q++ +DE NQI+ T++WL   WNDY F WNP ++ G+  I V  + +W PD++LYN+AD +F      K ++ YDG++ ++PP +FKS+C +DVT+FPFD QNCT+KFG+W+YD   ++L +                 + +  +  SGEW +I     +   +Y CCE  + D+  ++ + R   +Y  N ++PC++IS + +L F LPSD GEK++L ++++LSL++F L++ + +P +SL +PL+  Y L  M+  TLSI+ T+ VLN H+     H +P ++R +    L K++ + PP    ++ T AS  P  ++ +     +    L A  L  ++ + +         ++ S  E  V        +  +                    LC L  ++++V   +++I   ++  DE  +   +WK+ A V+DR  + +F L+    T G+F   +
Sbjct:    3 RASEAASRLYKTLFT-----SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVL-------------VGTKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQPPKG--SVGTAAS--PDAVVSEA---DQQPACLCAGELSAAAASSSSSCQSGGISRASSSMEAHVSSVRLPRLRAADVMSDELSSSSSTESLDALLALCLLSPEIRQVIDSVKYIAENLRTQDEAKEVCDDWKYVAMVVDRIFLWVFVLVCILGTAGLFLQPL 486          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.195 bits (609), Expect = 6.881e-73
Identity = 147/429 (34.27%), Postives = 231/429 (53.85%), Query Frame = 1
Query:  445 EYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPD----------SICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFS 1692
            E+ G+  +   P+ +W PD+LLYNSAD  F+A     V+++Y G+  ++PPG+ KSTC +DV WFPFDVQ C LKFG+W++DG  ++L++                  +   Y  +GEW+L+    +R    Y CC+  + DV  T+ I RR  YY  N ++PC++ISA++LL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+  YF S M++   S++ TVIVL  HH++    K+P+++RVI+  W A  L +  P           SI   ++  S    ++    I+     H +        +       D        + F ++  +   G+ Q          +  ++ K+  +L +I  + +  DE      EWKFAA V+DR C++ FTL     T  I  SA  F+
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQM---------------LEADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRERHELARRLSILHRNSMVSLDLALLSASGIHKKTNGHGVFIGFTNPDAPQQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDPTAGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISILMSAPHFT 415          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 210.305 bits (534), Expect = 1.249e-61
Identity = 126/339 (37.17%), Postives = 199/339 (58.70%), Query Frame = 1
Query:  229 EKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND----HKVPRFIRVIINQWLAKVL 1233
            E RLLK +        +    RPV   S  VEV FG  + Q++DVDEKNQ++ T++WL   W D +  WNP +YGGI +I V  +++W+PD++LY++AD  F  +   K V+ +DG + + PP ++KS+CT+DVT+FPFD QNC++KFG+W+YDG  V+L                  +V+   Y  +GEWE +++   + V+        +I    + VI R   +Y    ++PC+ +S + +  F LPSD GEKISL  ++++SL++F L++ + +P SS  +PL+  Y L +M+  TLSI+ TV V+N HH      H +  ++R +    L K+L
Sbjct:   35 EDRLLKRMLK-----DYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL-------------IMVNSDVDRGEYFDNGEWEFLNATGNKGVRLDGHRFYPYI--TYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKIL 353          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000149.1 (pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 gene:ENSPMAG00000000129.1 transcript:ENSPMAT00000000149.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.912 bits (520), Expect = 8.238e-60
Identity = 137/445 (30.79%), Postives = 217/445 (48.76%), Query Frame = 1
Query:  550 VKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDH---KVPRFIRVIINQWLAKVLFITPP----DSICTISTKASKKPPVIIDK--------TIYNSKVSHSLLANVLELSSDTHNI-----------YQDLFKKRKSLSEFETSV-------------------------DDAVNGDCQNV--------------EDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
              V++++ G   Y+PPG+ KS+C +DV WFPFDVQ+C LKFG+W++DG  ++L +                + +   Y  +GEW+LI    +R    Y CC+  + DV  T+++ RR  YY  N +LPC++ISA+ALL FLLP+++GEKISLG+T++LSL++F LL+A+ MP +S S+PL+  YF S +++   S++ TV+VL CHH+D     +P ++RV++  W A +L +  P     S     + A  KPP + +          +  +   H+   N     +  HN            Y   F    + S   T+                          +D+    C N+              E     C L   L +V     ++  +++  D       EW+FAA VIDR C+I F+++    T  I  SA +F
Sbjct:   12 TSVLVNHTGGCQYIPPGILKSSCKIDVRWFPFDVQSCDLKFGSWTHDGWLIDLHL---------------LHADTSGYLPNGEWDLIGVVGKRNELFYECCQEPYTDVTYTLLLRRRTLYYALNLLLPCMLISALALLVFLLPAESGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTLMIVGFSVVVTVLVLQCHHHDPDGTNMPTWVRVLLVHWCAWLLRMKQPVRDARSGGPHGSPAPWKPPCLSEHPGTGADRGQVTTATQPHNHSHNNTRGYTGNHNPDNTYAQSQPLNYSQPFNHTHNHSTTITNTQPHSQPPNHTDNHPIAQPRTAAQHHEDSCCPGCPNIAGAAGGEGGGAARQESPLQSCELAGLLAEV----HYLAERMRAADAGARLGGEWRFAAAVIDRLCLIAFSIVTISSTAAILVSAPSF 437          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 199.134 bits (505), Expect = 1.759e-56
Identity = 119/317 (37.54%), Postives = 193/317 (60.88%), Query Frame = 1
Query:  325 VLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVI----INQWLAKVLFITPPDS 1254
            V +    T + D DEKNQ++ T++WL   W+DY   W+P+EY  +T+I V    +W+PD++LYN+AD +F   +  K  + + G + + PP ++KS+C++DVT+FPFD QNCT+KFG+W+YD   ++L              S   +V++  Y  SGEW ++ +      ++Y CC   + D+  + +I R   +Y  N ++PC++IS + +L F LPSD GEKI+L ++++LSL++F LL+ + +P +SL +PL+  Y L  M+  TLSI+ TV VLN HH     H +PR++R +    + +WL  V+   PP  
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL-------------VSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWL--VMRRPPPQQ 302          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Match: EDO42038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N9])

HSP 1 Score: 233.417 bits (594), Expect = 3.481e-69
Identity = 153/498 (30.72%), Postives = 265/498 (53.21%), Query Frame = 1
Query:  229 EKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXX---XVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLN---CHHNDHKVPRFIRVIINQWLAKVLFI---------TPPDSI----CTISTKASKKPPVIIDKTIYNS-KVSHSLLANVLELSSDTHNIY--QDLFKKRKSLSEFET--SVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAF 1650
            E RL + LF       +NP  RPV ++   V V+ G ++ QIIDV EK+QIIKTS W+  IW +    WN + YGGI  INV P  VW PD++LYN+AD + + +      ++++S DG   ++ P +F S+CT+ + +FPFD Q C+LKFG+W++DG  ++LK +                  +  +  +GEW+LI +   R V RY CC   + DV  T+ + RR+ ++LFN ++PC +I  +  L F LP D+GE+IS+ +T +L++++F L++AD +P +S  + ++++++   ++   +++L T IVL    C  + HK+P ++R ++ + L KV            +  D+I    C    +   K P+I     +    V   + ++ ++ +    N+   QD   + +  + + +  ++DD +  +  +      L S  E +    K LE +    +  DEE  +  EWK AA ++D F   +F +  F
Sbjct:   50 EGRLTRDLFA-----GYNPKLRPVFHKRENVTVVLGMSVHQIIDVYEKDQIIKTSFWVRQIWYNPFLRWNETFYGGIKEINVSPLQVWTPDLVLYNNADASTDGSLENFKTRIIVSSDGKNMWLAPVIFSSSCTIKIKYFPFDDQYCSLKFGSWTFDGFHLDLKPEAPQA-------------SLSKFIPNGEWDLIGAPAIRNVLRYDCCPAPYPDVTFTLHLRRRVLFFLFNLIIPCFVIVVLTSLSFYLPPDSGERISVVITNLLAMTVFMLMVADILPPTSDEVSIISIFYSCSIIEVGIALLGTCIVLKYHFCSTSIHKMPPWVRFLVIECLGKVFCRQEHTNDQEDSKSDTIKLDNCKHKLENGLKDPLIKQCNFFGKFGVRERVRSSGMKTTDGGSNLSMTQDDEGRGRGGTPYSSHRNMDDIIAAEASSNSTVFALLSRQESM---VKNLEILAHAQRCQDEEDREKNEWKLAASILDNFFCWLFLMSIF 526          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Match: EDO45564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH5])

HSP 1 Score: 226.483 bits (576), Expect = 6.285e-69
Identity = 128/343 (37.32%), Postives = 203/343 (59.18%), Query Frame = 1
Query:  226 YEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXX---VKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDHKVPRFIRVIINQWLAKVLFITP 1245
            +E +L+  LF   + DA     RPV N+S  V V      +Q+ID+D KNQI+ + +W+  +W +    WNP +YGG+ +INV  N VW PD++LYN+       A      KVVI  DG+ S+  P   KS C +D+T+FPFD Q+C + FG+W+Y G  +NL              +     ++  Y  SGEWEL S+ + R V +Y+CC+  +IDV  TI I R++ +YL N +LPC++++ + +  FLLP  +GE+ISL +TI+L L++F L+  +++P++S  +PL+A Y  ++M    +S+L T +V+  +H +  +P  +R I+   LA VL + P
Sbjct:    1 WEHKLITTLFKDYQRDA-----RPVYNKSEAVRVSLDIAYSQLIDLDGKNQILSSKVWIRQVWRNPFLSWNPDDYGGLESINVNSNLVWKPDIILYNNIGIGQTGAMYNFDTKVVIDSDGTNSWYAPTEIKSICQIDITYFPFDAQSCPIIFGSWTYTGNYLNL-------------VNARNQSDLSKYTISGEWELKSAPVVRNVVKYSCCKHPYIDVTYTINIRRKVLFYLNNLILPCMVLAILTVCSFLLPPASGERISLVITILLGLTVFMLVFTESVPRTSEVIPLIAKYSFAVMCEVAVSLLLTCVVMRIYHKNSPMPLPMRYIVYNILAPVLRMHP 325          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 229.18 bits (583), Expect = 4.016e-68
Identity = 129/357 (36.13%), Postives = 223/357 (62.46%), Query Frame = 1
Query:  205 RDVNAGS-YEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXX---XXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDHK-----VPRFIRVIINQWLAKVLFITPP 1248
            RDVN    +E  LL  L      DAH P+  P+ N++    V FG  L Q+++VD+KNQII T++W+   W +    W+P +YGGIT + +  + +W+PD++LYNSA    +        +V++++DG  ++  P  F+STC +DVT+FPFD Q C +KFG+W+++ VD+++      ++SS              Y +S EW+LI++  +R V+ YACC   F DV +T V  R+  +Y+FN ++PC+II+ + LL F+LP ++GE+I+L +T++L++++F  L A+N+P++S ++P+L ++++++MV   LS++ T  VL+ HH +       VP +++V +  +L K+L +  P
Sbjct:    3 RDVNGSDLHEHTLLGDLLKGYNKDAH-PV--PILNKT-QYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFEVVDLDIFADKSPLHSSQ-------------YMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKKP 342          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 219.935 bits (559), Expect = 1.796e-66
Identity = 125/349 (35.82%), Postives = 212/349 (60.74%), Query Frame = 1
Query:  229 EKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXX---XXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDH------KVPRFIRVIINQWLAKVLFITPP 1248
            E+RL+  L      +A     RPV N +  ++V FG  + QI++V+ +NQII+T++W+   W++    W+PS Y G+  + +   +VW+PD++LY+SAD+ F+         V+IS DGS ++  P  F+STC +DVT+FPFD Q C +KFG+W+Y   DV+++     + SS              Y +S EW+L+S+   R  Q YACC     DV + + I R+  +Y FN + PC+I+  + LL F LP ++GE+I+L +T++L++++F  L+A+ +P++S S+PLL  +++++M    +S++ T  VLN HH +       ++P+++ VI+ +WLA VL +  P
Sbjct:    1 EQRLISDLLQGYSRNA-----RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQASPAPVKSSK-------------YLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCVRQP 331          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Match: EDO32052 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW62])

HSP 1 Score: 217.624 bits (553), Expect = 4.183e-66
Identity = 106/267 (39.70%), Postives = 168/267 (62.92%), Query Frame = 1
Query:  277 HNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXX---VKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQ 1068
            + P  RPV +   PV V  G  L QIIDVDEKNQI+ T++W+ + W D+  +WNP ++GG+ +INV PN VW PD+LLYN  D    +       KV++S DGS +++ P + K+ C +DV  FPFDVQ C LKFG+W++DG+ ++++++                V++  Y+ + EW L  +  RR V+ Y CC   +  V  T+VI RR  +Y++N VLP  +I+ ++L  F LP ++GE++S  +T++LS+S++ +++ +NMPQ
Sbjct:    5 YTPEARPVLHVKDPVVVKMGLMLKQIIDVDEKNQILTTNVWIRLYWKDHLLNWNPEDFGGVKSINVEPNNVWKPDILLYNPTDLRVESLYKKIDTKVILSSDGSAAWLSPAIIKTECKVDVRLFPFDVQYCDLKFGSWTHDGLKIDIQLR------------KTTGVDIDDYSENREWFLKDAPGRRDVKLYNCCPEPYPTVTFTLVIRRRAMFYVYNMVLPTGMIALLSLFSFYLPPNSGERVSFVITVLLSMSVYMIMVTENMPQ 259          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 326.25 bits (835), Expect = 3.236e-104
Identity = 200/517 (38.68%), Postives = 298/517 (57.64%), Query Frame = 1
Query:  187 SVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSL--SEFETSVDDAVNGD---CQNVEDSGMLCSLHE--------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            S+ L+    + G  ++RL   L +      +NPLERPV N+S  + V FG +L QI+DVDEKNQ++ T+IWL + WND++  WN S+Y G+T +    + +W PD+LLYNSAD  F+A     ++++  G+ SY+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++LK+                  ++  Y  +GEW+L+    +R  + Y CC+  ++D+  T+V+ RR  YY  N +LPC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  HH+D    K+P++ RVI+  W A  L +  P      S   +K     +     N+  S SL  N         N+     +  +SL  S   TS D  V       +  ED  +L S H         +L K+  ++ +I  + ++ DE+     EWKFAA V+DR C++ F+L     T GI  SA  F
Sbjct:   36 SLCLYSVVSHQGPNQRRLYSDLMS-----TYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKM---------------LEADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSSLTSMDLNAPTSTSLSTN--------GNLLYVGVRGLESLQYSPGATSPDSGVVCGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPNF 524          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Match: ENSORLT00000046008.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 325.479 bits (833), Expect = 5.121e-104
Identity = 199/510 (39.02%), Postives = 295/510 (57.84%), Query Frame = 1
Query:  214 NAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSL--SEFETSVDDAVNGDCQNV-----EDSGMLCSLHE--------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            + G  ++RL   L +      +NPLERPV N+S  + V FG +L QI+DVDEKNQ++ T+IWL + WND++  WN S+Y G+T +    + +W PD+LLYNSAD  F+A     ++++  G+ SY+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++LK+                  ++  Y  +GEW+L+    +R  + Y CC+  ++D+  T+V+ RR  YY  N +LPC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  HH+D    K+P++ RVI+  W A  L +  P      S   +K     +     N+  S SL  N         N+     +  +SL  S   TS D  V   C  +     ED  +L S H         +L K+  ++ +I  + ++ DE+     EWKFAA V+DR C++ F+L     T GI  SA  F
Sbjct:   42 HQGPNQRRLYSDLMS-----TYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKM---------------LEADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSSLTSMDLNAPTSTSLSTN--------GNLLYVGVRGLESLQYSPGATSPDSGVV--CGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPNF 521          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Match: ENSORLT00000033785.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 323.553 bits (828), Expect = 6.909e-104
Identity = 195/492 (39.63%), Postives = 288/492 (58.54%), Query Frame = 1
Query:  268 VDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSL--SEFETSVDDAVNGDCQNV-----EDSGMLCSLHE--------DLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            +  +NPLERPV N+S  + V FG +L QI+DVDEKNQ++ T+IWL + WND++  WN S+Y G+T +    + +W PD+LLYNSAD  F+A     ++++  G+ SY+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++LK+                  ++  Y  +GEW+L+    +R  + Y CC+  ++D+  T+V+ RR  YY  N +LPC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + MV+  LS++ TV+VL  HH+D    K+P++ RVI+  W A  L +  P      S   +K     +     N+  S SL  N         N+     +  +SL  S   TS D  V   C  +     ED  +L S H         +L K+  ++ +I  + ++ DE+     EWKFAA V+DR C++ F+L     T GI  SA  F
Sbjct:    1 MSTYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKM---------------LEADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSSLTSMDLNAPTSTSLSTN--------GNLLYVGVRGLESLQYSPGATSPDSGVV--CGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPNF 467          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Match: ENSORLT00000023459.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 311.612 bits (797), Expect = 3.132e-99
Identity = 195/524 (37.21%), Postives = 294/524 (56.11%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVD--------------------DAVNG-DCQNVEDSGMLCS--LHED--------LKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL K L     +  +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN S+Y G+T +    + +W PD+LLYNSAD  F+A+    ++++  G   Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                N +   Y  +GEW+L+    +R+ + Y CC+  + DV  T+V+ RR  YY  NF++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + M +  LS++ TV+VL  HH+D     +P++ RV++  W A  L +  P                        +KV   LLA         HN+ +   ++R SLS  E S++                      V G  C +  D   LC+  + ED        L+++ +++ FI  + +  D+E     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:    7 GVHQRRLYKEL-----IRNYNPLERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQM---------------INADTTGYIANGEWDLVEVPGQRSERFYDCCKEPYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRMRRPG----------------------EAKV---LLA--------CHNMGK---RQRGSLSSLELSINPVSVPPQPHVTNSNLLYVGFQGVEGLHCGSATDPEPLCARFIEEDFLRVGEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAPNF 474          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Match: ENSORLT00000023454.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 306.605 bits (784), Expect = 4.026e-97
Identity = 188/512 (36.72%), Postives = 287/512 (56.05%), Query Frame = 1
Query:  220 GSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHND---HKVPRFIRVIINQWLAKVLFITPPD-------------------SICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTF 1689
            G +++RL K L     +  +NPLERPV N+S  + V F  +L QI+DVDEKNQ++ T+IWL + W D++  WN S+Y G+T +    + +W PD+LLYNSAD  F+A+    ++++  G   Y+PPG+FKSTC +DV WFPFDVQ C LKFG+W+Y G  ++L++                N +   Y  +GEW+L+    +R+ + Y CC+  + DV  T+V+ RR  YY  NF++PC++IS +ALL FLLP+D+GEKISLG+T++LSL++F LL+A+ MP +S S+PL+A YF + M +  LS++ TV+VL  HH+D     +P++ RV++  W A  L +  P                    S   +S      PP      + NS + +     V  L   +    + L   R    +F              + DS    +L  +L+++ +++ FI  + +  D+E     EWKFAA VIDR C++ F++     T GI  SA  F
Sbjct:    2 GVHQRRLYKEL-----IRNYNPLERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQM---------------INADTTGYIANGEWDLVEVPGQRSERFYDCCKEPYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRMRRPGEAKVLLACHNMGKRQRGSLSSLELSINPVSVPP---QPHVTNSNLLYVGFQGVEGLHCGSATDPEPLC-ARFIEEDFLRVGGGTRRRQGGVLNDS----ALEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAPNF 485          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Match: SMESG000000214.1 (SMESG000000214.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 400/401 (99.75%), Postives = 400/401 (99.75%), Query Frame = 1
Query:  493 MPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFSG 1695
            MPDVLLYNSADNNFNAANSVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQNVNMNSSNGNDSNIGNVEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQSSLSLPLLALYFLSMMVLSTLSILFTVIVLNCHHNDHKVPRFIRVIINQWLAKVLFITPPDSICTISTKA KKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFSG
Sbjct:    1 MPDVLLYNSADNNFNAANSVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQNVNMNSSNGNDSNIGNVEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQSSLSLPLLALYFLSMMVLSTLSILFTVIVLNCHHNDHKVPRFIRVIINQWLAKVLFITPPDSICTISTKALKKPPVIIDKTIYNSKVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSAVTFSG 401          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 350.132 bits (897), Expect = 1.817e-113
Identity = 213/521 (40.88%), Postives = 315/521 (60.46%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDG--VDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHH---NDHKVPRFIRVIINQWLAKVLFI---TPPDSICTISTKASKKPPVIIDKTIYNSKVSHS--------LLANVLELSSD--THNIYQDLFKKRKSLSEFETSVDDAVNG-DCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
             +F  +++   + + G  EK+LL++LF+ NR DAHN LERP KN+S PVEV     LTQ+IDVDEKNQII T+IWL + W DYHF WNPS YGGI+   +  + VW PD+LL+NSAD+ F+      VV+     M +VPPG+FKSTC +D+TWFPFD QNCT+KFG+W+Y G  +D+ L+  + + N   G  +    + +  Y  +GE++++   + R   +Y+     ++++ MTI + R+  YY+FN ++PC++IS +ALL+F LP DAGEKISLGVTI+LS++MF LL+AD +PQ+S ++ LL +YF  +M + +LSI+FTV+VLN HH   N   VP  I+ I+N WLAKVLF+   + P+    +  K      +I +    N +   S          ++V ++ SD   H I +     R        S   A N    +  + +   C+   +L  +  +L+ IT KIK++++E    KEWKFAA VIDR C+ +F+L     T  +   A
Sbjct:   13 AVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNSEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRA 531          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 349.747 bits (896), Expect = 3.851e-113
Identity = 213/521 (40.88%), Postives = 315/521 (60.46%), Query Frame = 1
Query:  175 VLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDG--VDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHH---NDHKVPRFIRVIINQWLAKVLFI---TPPDSICTISTKASKKPPVIIDKTIYNSKVSHS--------LLANVLELSSD--THNIYQDLFKKRKSLSEFETSVDDAVNG-DCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
             +F  +++   + + G  EK+LL++LF+ NR DAHN LERP KN+S PVEV     LTQ+IDVDEKNQII T+IWL + W DYHF WNPS YGGI+   +  + VW PD+LL+NSAD+ F+      VV+     M +VPPG+FKSTC +D+TWFPFD QNCT+KFG+W+Y G  +D+ L+  + + N   G  +    + +  Y  +GE++++   + R   +Y+     ++++ MTI + R+  YY+FN ++PC++IS +ALL+F LP DAGEKISLGVTI+LS++MF LL+AD +PQ+S ++ LL +YF  +M + +LSI+FTV+VLN HH   N   VP  I+ I+N WLAKVLF+   + P+    +  K      +I +    N +   S          ++V ++ SD   H I +     R        S   A N    +  + +   C+   +L  +  +L+ IT KIK++++E    KEWKFAA VIDR C+ +F+L     T  +   A
Sbjct:   28 AVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNSEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRA 546          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 347.436 bits (890), Expect = 1.085e-112
Identity = 206/516 (39.92%), Postives = 308/516 (59.69%), Query Frame = 1
Query:  214 NAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACC-ETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHN---DHKVPRFIRVIINQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLL----------ANVLELSSD-THNIYQDLFKKRKSLSEFETSVDDA-VNGDCQNV-----------EDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVTGGIFFSA 1680
            + G + KRLL +LFN ++   HN LERPV +E+  +EV F  TL QI+D+DEKNQ++ T+IWL I W DY+F WNP E+G IT + +    VW PD+L+YNSAD  F+      VV++  G M  VPPG+FKSTC +++TWFPFD Q+C +KFGTW+Y G  V+ +++    ++  G   +      L   ++GEWE++     +  + Y CC E+ FID+K  + + R+  YY+FN + PCIIIS ++LL F LP  AGEKI++GVTIMLSL+MF  ++AD +PQ+S S+PL+ LYF  +M++ + S++FTV+VLNCHH    D ++P +++V++N+WLA  L ++P +    ++   ++K  +   ++I    ++HS L           N+    SD + N+        K LS   T  +    N   +N+             S   CS+  +L+ V  +L+ IT KI+E   +  K  EWKFAA VIDRFC+I F L     +  I  SA
Sbjct:   15 HCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFL---KNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNP--QVTNSPTRKIEIQQRRSIL-PNMNHSFLTYENLAPKPYGNITNRKSDGSTNV-----TSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSA 519          
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Match: SMESG000002905.1 (SMESG000002905.1)

HSP 1 Score: 344.739 bits (883), Expect = 1.327e-111
Identity = 199/501 (39.72%), Postives = 296/501 (59.08%), Query Frame = 1
Query:  181 FLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNESLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGITAINVLPNTVWMPDVLLYXXXXXXXXXXXXVKVVISYDGSMSYVPPGLFKSTCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQXXXXXXXXXXXXXXXXXEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITYYLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADNMPQXXXXXXXXXXXXXXMMVLSTLSILFTVIVLNCHHNDH---KVPRFIRVIINQWLAKVLFITPPDSICT---ISTKASKKPPVIIDKTIYNS-------KVSHSLLANVLELSSDTHNIYQDLFKKRKSLSEFETSVDDAV-----NGDCQNVEDSGMLCSLHEDLKKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVI 1629
            F  V++  ++  AG  EK+LL+HLF+  R DAHN LERP K++   + V     L QIIDVDEKNQI+ T++W+ + W DYHF W+P  Y  IT + +  N +W PD+LLYNSAD  F+A     +V+ YDG M  VPPG+FKSTC +++ W+PFD Q C +KFG+W+Y+G  ++L     N  + N          ++    +GEW+++S    R+V +Y CC   +ID+   + I RR  YY FN ++PCIIIS +ALL FL+P DAGEKISLGVTI+LSL++F +++A+ MP +S ++PL+ +YF  +M++ +LS++FTV+VLN HH       VP  +  ++N WLA++LF+ P + + +    S    +         IYN        K S SLLANVL    D  N       +  S S    +V+  V       +   +   G+L      +K++   L  +T+K+ E + +  +  EWKFAA V+DRFC++
Sbjct:    7 FFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIM---ENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGVTILLSLTVFLMMVAEKMPPTSKAIPLIGMYFTCVMIVCSLSLVFTVLVLNFHHRSSDSIDVPESLHKVVNIWLARILFMKPRNKVASEVFESGDLKQNTGQFKRNAIYNRAFQSGSMKGSKSLLANVL----DMENEIWARAAQSVSFSYPSANVNSEVPPYESQNNNGGIMGEGLLPEGRSQIKEILSHLRQVTSKLAETEIQELRANEWKFAARVMDRFCLV 500          
The following BLAST results are available for this feature:
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA78.961e-10338.80cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.18.961e-10338.80cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA71.604e-10238.80cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.11.507e-10138.40cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.11.507e-10138.40cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-164.440e-8535.02Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-192.726e-7931.17AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-192.518e-7831.20AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-257.833e-7731.73AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-112.228e-7431.19AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha61.231e-11640.51gene:FBgn0032151 transcript:FBtr0079914[more]
nAChRalpha61.663e-11640.31gene:FBgn0032151 transcript:FBtr0303898[more]
nAChRalpha61.663e-11640.31gene:FBgn0032151 transcript:FBtr0079916[more]
nAChRalpha61.832e-11640.51gene:FBgn0032151 transcript:FBtr0079915[more]
nAChRalpha62.424e-11640.31gene:FBgn0032151 transcript:FBtr0331284[more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna78.479e-10136.83cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna71.570e-10037.38cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
si:ch73-380n15.28.986e-9736.55si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
FO907089.19.458e-9737.25neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.21.660e-9636.55si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021532.16.994e-10638.60cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
clca29.302e-9337.48chloride channel accessory 2 [Source:Xenbase;Acc:X... [more]
mppe13.975e-8333.27metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe15.363e-8333.27metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe15.544e-8333.27metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna73.936e-10439.00cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna31.600e-8232.00cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna31.712e-8232.00cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna64.468e-7932.34cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna32.776e-7537.89cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22770|ACHA7_CHICK5.298e-10438.42Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|Q05941|ACHA7_RAT2.199e-10339.00Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|P49582|ACHA7_MOUSE2.753e-10339.00Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|Q866A2|ACHA7_MACMU8.467e-10339.00Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|P36544|ACHA7_HUMAN4.303e-10238.80Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EGF06.144e-12042.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DHA42.039e-11941.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A348BSV95.459e-11641.48Nicotinic acetylcholine receptor alpha6 subunit 3 ... [more]
A0A2Z4N5S79.656e-11641.18Nicotinic acetylcholine receptor alpha 6 subunit O... [more]
A0A348BSV81.224e-11541.48Nicotinic acetylcholine receptor alpha6 subunit 2 ... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna72.034e-10137.86neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna71.835e-10038.14neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna72.217e-10038.81neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000053066.11.406e-9839.09neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000055784.13.091e-9637.40neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna34.808e-7831.04cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
ENSPMAT00000008550.16.881e-7334.27pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrnb3b1.249e-6137.17cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
ENSPMAT00000000149.18.238e-6030.79pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 g... [more]
chrna2a1.759e-5637.54cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420383.481e-6930.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455646.285e-6937.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448964.016e-6836.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479691.796e-6635.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320524.183e-6639.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038695.13.236e-10438.68neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000046008.15.121e-10439.02neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000033785.16.909e-10439.63neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000023459.23.132e-9937.21neuronal acetylcholine receptor subunit alpha-7 [S... [more]
ENSORLT00000023454.24.026e-9736.72neuronal acetylcholine receptor subunit alpha-7 [S... [more]
back to top
BLAST of Nicotinic acetylcholine receptor alpha 6 subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000214.10.000e+099.75SMESG000000214.1[more]
SMESG000068777.11.817e-11340.88SMESG000068777.1[more]
SMESG000068777.13.851e-11340.88SMESG000068777.1[more]
SMESG000011827.11.085e-11239.92SMESG000011827.1[more]
SMESG000002905.11.327e-11139.72SMESG000002905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021693 ID=SMED30021693|Name=Nicotinic acetylcholine receptor alpha 6 subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1830bp
ATTTATTTCAATCAATATTTTGGCACTACGATTCCACCAAAGGAAATGAG
ACACACACTCACGCACGCACACAAACATTTGCAATGTGTGCGTGTGTGCG
TGCGTCTTTAGGCTGTTACCAAACCTCAAATTTGTAGATATTAGAAATCT
AATCTGTAAATGAATACTTTAAACGTACTTTTCCTGTCCGTAATTCTATT
TTTTCGAGATGTAAATGCTGGTTCATACGAGAAACGTTTGCTCAAGCATT
TATTTAATCCCAATAGAGTTGATGCTCATAATCCTTTAGAAAGACCAGTT
AAAAATGAAAGTCTACCCGTCGAAGTGTTATTTGGAACAACTCTGACTCA
AATAATTGATGTTGACGAAAAAAATCAAATAATTAAAACGAGCATTTGGC
TGTCAATTATTTGGAATGATTACCATTTCCATTGGAATCCAAGCGAGTAC
GGAGGTATAACTGCTATTAATGTCCTTCCAAACACTGTATGGATGCCAGA
TGTCCTACTGTATAATAGTGCTGACAACAATTTCAACGCGGCAAACTCTG
TAAAAGTCGTCATTTCATACGATGGATCCATGAGTTATGTACCTCCAGGC
TTATTCAAGTCAACCTGTACCATGGATGTTACATGGTTTCCGTTCGATGT
TCAAAACTGTACCCTGAAATTTGGAACTTGGAGTTATGATGGAGTGGATG
TCAATTTAAAAATTCAAAACGTAAATATGAATTCATCCAATGGAAATGAC
TCAAACATCGGGAATGTTGAAATGCTTTATTATGCCCGAAGCGGCGAATG
GGAATTGATCTCTTCCGATTTGCGAAGAACTGTTCAAAGATATGCTTGTT
GCGAAACGGATTTTATAGATGTAAAAATGACAATAGTTATTGGCAGACGC
ATCACTTATTATTTATTCAACTTTGTTTTGCCTTGCATAATTATTTCCGC
CGTTGCCTTGCTCGACTTTCTATTACCATCGGATGCGGGAGAGAAGATTT
CACTAGGTGTGACTATAATGCTATCACTGTCAATGTTCCAGTTGCTGTTG
GCTGATAATATGCCTCAGTCTTCTCTATCACTTCCTTTATTGGCTTTGTA
TTTTCTCTCAATGATGGTGTTAAGCACATTGTCCATATTATTCACTGTCA
TCGTCCTCAATTGCCATCACAATGACCACAAAGTGCCAAGATTTATTCGG
GTGATAATTAATCAATGGCTAGCCAAAGTGCTTTTTATCACTCCTCCAGA
TTCGATTTGCACTATTTCAACGAAAGCATCAAAGAAGCCTCCAGTTATCA
TCGACAAAACGATATATAACTCCAAAGTGTCGCACAGTTTGCTCGCAAAT
GTGCTGGAGCTTTCCAGTGATACGCATAATATTTATCAAGACCTGTTTAA
AAAACGGAAATCACTTTCGGAATTTGAAACCAGCGTTGATGATGCAGTAA
ATGGGGATTGTCAAAACGTTGAAGATAGTGGAATGCTCTGCTCCTTGCAT
GAAGATTTGAAAAAGGTAAAAAAACAATTGGAATTTATTACGACGAAAAT
CAAGGAAAATGACGAAGAAGGTGACAAATTGAAGGAATGGAAATTTGCTG
CTTATGTAATAGACCGATTTTGTGTGATCATTTTTACCCTGCTAGCCTTC
TGTGTGACGGGCGGTATTTTTTTTAGTGCTGTCACTTTTAGTGGTTGATT
TTATGATACAATTTTTGTATTTATTTATTCGAACAGAGTTCCATTTGCAT
TTTTAAAATGACGTAGTTGGTAAATAAATTTTAATTTGGTTTTCTAATAA
AAATAGGATTTTTCCGTTTTAATAAAAAAA
back to top

protein sequence of SMED30021693-orf-1

>SMED30021693-orf-1 ID=SMED30021693-orf-1|Name=SMED30021693-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=513bp
MNTLNVLFLSVILFFRDVNAGSYEKRLLKHLFNPNRVDAHNPLERPVKNE
SLPVEVLFGTTLTQIIDVDEKNQIIKTSIWLSIIWNDYHFHWNPSEYGGI
TAINVLPNTVWMPDVLLYNSADNNFNAANSVKVVISYDGSMSYVPPGLFK
STCTMDVTWFPFDVQNCTLKFGTWSYDGVDVNLKIQNVNMNSSNGNDSNI
GNVEMLYYARSGEWELISSDLRRTVQRYACCETDFIDVKMTIVIGRRITY
YLFNFVLPCIIISAVALLDFLLPSDAGEKISLGVTIMLSLSMFQLLLADN
MPQSSLSLPLLALYFLSMMVLSTLSILFTVIVLNCHHNDHKVPRFIRVII
NQWLAKVLFITPPDSICTISTKASKKPPVIIDKTIYNSKVSHSLLANVLE
LSSDTHNIYQDLFKKRKSLSEFETSVDDAVNGDCQNVEDSGMLCSLHEDL
KKVKKQLEFITTKIKENDEEGDKLKEWKFAAYVIDRFCVIIFTLLAFCVT
GGIFFSAVTFSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR027361Acetylcholine_rcpt_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0060079excitatory postsynaptic potential
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 450..470
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 254..370
e-value: 5.3E-35
score: 122.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 441..511
e-value: 9.8E-9
score: 37.1
NoneNo IPR availablePANTHERPTHR18945:SF799NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA7, ISOFORM Ecoord: 18..507
NoneNo IPR availableCDDcd18997LGIC_ECD_nAChRcoord: 54..247
e-value: 1.36305E-85
score: 260.115
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 249..360
e-value: 1.88602E-32
score: 117.849
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.741
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 279..298
NoneNo IPR availableTMHMMTMhelixcoord: 487..509
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 242..254
score: 29.17
coord: 109..120
score: 43.63
coord: 76..92
score: 26.56
coord: 153..167
score: 56.59
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 23..504
e-value: 9.8E-93
score: 309.3
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 18..507
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 97..111
score: 33.48
coord: 63..79
score: 45.1
coord: 115..127
score: 43.25
coord: 133..151
score: 38.77
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 256..504
e-value: 7.1E-43
score: 147.4
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 24..247
e-value: 2.5E-61
score: 206.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 15..253
e-value: 5.1E-74
score: 250.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 24..247
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 153..167
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 249..510