Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30021685
Length (bp)1701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30021685) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30021685) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30021685) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30021685) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021685

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021685SMESG000080433.1 SMESG000010902.1 Contig1818GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021685SMESG000080433.1 SMESG000010902.1 Contig1818GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021685SMESG000070057.1 dd_Smed_v4_8073_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 164.466 bits (415), Expect = 3.199e-43
Identity = 107/320 (33.44%), Postives = 166/320 (51.88%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQ 1224
            ++FEKL ++CD+    IP+SF++GF+V  VV RWW  +  +PW +++  L+   V G+  E+   +R  LIRY NL  +L++R VS+ V  RFP     S +++++                       ++  E    +K+    L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K    +   L  P+    +F F +GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W K +
Sbjct:   60 LMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFP-----SAQHLVQ--------------------AGFMTPAEHKQLEKLS---LPHN-------MFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNKPE 342          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST1 (bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703])

HSP 1 Score: 164.081 bits (414), Expect = 4.688e-43
Identity = 107/319 (33.54%), Postives = 165/319 (51.72%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQ 1224
            +FEKL ++CD+    IP+SF++GF+V  VV RWW  +  +PW +++  L+   V G+  E+   +R  LIRY NL  +L++R VS+ V  RFP     S +++++                       ++  E    +K+    L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K    +   L  P+    +F F +GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W K +
Sbjct:    1 MFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFP-----SAQHLVQ--------------------AGFMTPAEHKQLEKLS---LPHN-------MFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNKPE 282          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 158.303 bits (399), Expect = 1.893e-42
Identity = 100/297 (33.67%), Postives = 151/297 (50.84%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++CD     IP++F++GF+V  VV RWW  F  +PW +++ FLI   V G   E    +R  L+RY+NL  +L+ R VS+ V  RFP      +     F TT+                    ER++  F  + +  L          ++W+P  W   L  K++  G I D     +L+ E+   R     L     + +PLVYTQVV + VY++F   ++  QFLDP K    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:   62 FEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHG-SDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAG---FMTTD--------------------ERKL--FNHLKSPHL----------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 160.229 bits (404), Expect = 2.168e-41
Identity = 100/297 (33.67%), Postives = 151/297 (50.84%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++CD     IP++F++GF+V  VV RWW  F  +PW +++ FLI   V G   E    +R  L+RY+NL  +L+ R VS+ V  RFP      +     F TT+                    ER++  F  + +  L          ++W+P  W   L  K++  G I D     +L+ E+   R     L     + +PLVYTQVV + VY++F   ++  QFLDP K    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:   62 FEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHG-SDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAG---FMTTD--------------------ERKL--FNHLKSPHL----------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 151.754 bits (382), Expect = 3.829e-39
Identity = 96/297 (32.32%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKLV++CD   + IP+SF++GF+V  VV RWW  +  +P  + +  ++   V GR  ++    R  L+RY  L+ +L++R VS+ V  RFP             +   +++      + R+ F                     EN +  Y  ++W+P  W S L  ++++ G I D      L+ E+   R +   L     I +PLVYTQVV I +YSYFL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ENLNSSYN-KYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-17 (Bestrophin homolog 17 [Source:UniProtKB/Swiss-Prot;Acc:Q22566])

HSP 1 Score: 148.288 bits (373), Expect = 1.644e-38
Identity = 83/309 (26.86%), Postives = 155/309 (50.16%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLD 1197
            +FE++ +  D +   +PL+F++GFFV  V  RW     ++P++  +A  +  L+ G+G+E     R  +IRY+ L  IL+ R +S +VR RFP  +       ++    ++L+ +N++                 S Q                  +W+P+ WA+ L   + +  +I      + +I  I+  R  M++L+    I +P+ Y QVV + V  YF + +++ QFL  +  S        P++ + EF+F++GW+KVA  ++NP G+DD+DF+ + I+D+N+      V      +P+ +D
Sbjct:   83 VFEEISIHTDDRMKYLPLTFMLGFFVTTVFERWRSALNVMPFIESVALSVAVLLPGKGREDRL-TRRAIIRYVVLHQILVFRDISMRVRRRFPTLKYVVDAGFMRQEELDVLESVNQE-----------------SSQT-----------------YWVPINWANSLALVAHQQKLIDQPTAFNNVIFAIKEFRVAMETLIKFDAIPIPIAYPQVVFLAVRVYFAICLVSRQFLISDMKSKTQMDWPVPIMTVLEFIFVIGWMKVAEVLLNPLGEDDDDFEVNSIIDNNISRGMAIVDTTHGYHPDLVD 356          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 148.288 bits (373), Expect = 7.033e-38
Identity = 94/308 (30.52%), Postives = 156/308 (50.65%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYP 1185
            FE L +F D   N IP++F++GF+V+AV  RWWQ+F  I W++     I   + G   E+A  VR   IRY  L   ++ R V++ VR RFP     +  +++                       +++E+E+  F+ + +             ++W P+ W   ++  ++  G+I        L+ ++   R  + SL +   + +PLVYTQVV + V SYFL+ +   Q+L PE N    F     L  P++++ +F+F +GW+KVA  ++NP G+DD+DF+ + ILD NL V    V    + YP
Sbjct:   62 FEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKGE-TERAKCVRRNCIRYSILTQAMVYRDVAASVRKRFP-----TFNHLVT--------------------AGLMTEKEMAEFESIPSP----------HAKYWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYP 333          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 141.739 bits (356), Expect = 6.812e-36
Identity = 91/308 (29.55%), Postives = 159/308 (51.62%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKN---SYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYP 1185
            +FE+L  F D     IP++F++GF+V+ V  RW ++F  + W++  A  I   + G   EKA  +R   +RY+ +A +++ R VS  +R RFP       K++I                       +++E E+  F  + +           + ++W P++W   L+  ++  G+I D      LI ++   R ++ +L+I   + +PLVYTQVV + V +YF++ +   QFL+   N   +     + FP++   + VFI+GWLKV+  ++NP G+DDEDF+T+ I++ NL V +  V      YP
Sbjct:   61 VFEQLCTFFDTFSVFIPVTFMLGFYVSIVYNRWTKVFDNVGWIDTSALTIAQYIRGTS-EKARLIRRNCVRYMIVAQVMVFRDVSPAIRRRFPTI-----KHLIG--------------------AGLLTEDELTEFDAITSP----------QSKYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQFLENNNNIPGAKWKIDIYFPIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYP 332          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 139.428 bits (350), Expect = 1.133e-35
Identity = 85/307 (27.69%), Postives = 151/307 (49.19%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQF-LDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPE 1188
            IFE+   +CDA+   +PL+F++GFF   ++ RW +L+T +  ++ IA  +   V G   ++A ++R  +IRY  ++  L+ R +   VR RFP   + ++                           I+   E+  F  + +++           ++W+   WA  LLN ++    I      + +  EI   R  + ++ +   + +PL+Y Q+V + V++YF + I T QF +  + ++     L  P + I EF+F MGWLKVAM ++NPFG+D +DF  + ++D NL +   SV       PE
Sbjct:  104 IFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRG-TDDRARQIRRNIIRYCVISQCLVFRDIHVGVRRRFPTLEAVAQ-------------------------AGIMLPHELEKFNSIKSRY----------QKYWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSVDDAYDQLPE 374          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-24 (Bestrophin homolog 24 [Source:UniProtKB/Swiss-Prot;Acc:P34672])

HSP 1 Score: 140.969 bits (354), Expect = 2.421e-35
Identity = 87/306 (28.43%), Postives = 158/306 (51.63%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEK-NSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPE 1188
            FE++V +CD++ + IPL+F++GFFV AVV RW  L+ +I +++ I  +    V GR  E+A   R  ++RY  LA +L+ R +S + R RFP                  LD +             +   E   F ++  ++           ++W+P +WA  L  +++K G+I        +  EI+  R  +  +     + +P++Y Q+V + V++YFLV ++  Q++  E  ++     L FP+++  +F+F MGW+KVA  ++NPFG+DD+DF+ + ++D N+ +    V       P+
Sbjct:   62 FERIVQYCDSRLSYIPLNFMLGFFVTAVVNRWTYLYQIIGFIDNIGLMAAEYVRGR-TEQARMYRRNIVRYCELAQVLVFRDISMRTRRRFP-----------------TLDTV--------VAAGFMMPHEKDRFDEIQYKY----------SKYWVPFQWAFSLTYEARKKGLIESDYYQVVVQDEIKKFRTGLAWICNYDWVPIPIMYPQLVCLAVHTYFLVCLLARQYVVSEHADNKTEIDLYFPIMSTLQFIFYMGWMKVAEAMLNPFGEDDDDFECNALIDRNITMVLMMVDQGYDRAPD 331          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 169.474 bits (428), Expect = 1.060e-45
Identity = 94/307 (30.62%), Postives = 162/307 (52.77%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSY-IYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPE 1188
            +FE +V++C +  N IPLSF++GF+V  ++ RWW  +  +PW + +A  +  LV G+  E    +R  ++RY+ LA  +++  +S  ++ RFP      +  ++  +   I+  +  D+K                               P  P++W+P+ WA+ ++ +++K G I+D  +  ++I E+   R     L+    I +PLVYTQVV + VYSYF+  I   Q++D +   Y       FPL +  EF F MGWLKVA  ++ PFGDDD+DF+ + ++D NL V++  V    + +P+
Sbjct:   62 VFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQD-EHGRLMRRTIMRYVCLALTMVLSMISPVIKRRFPTYDQLIEVGLLNANEANIMKAM--DVKF------------------------------PKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQ 335          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 170.629 bits (431), Expect = 4.103e-45
Identity = 101/311 (32.48%), Postives = 163/311 (52.41%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE---KNSYI-YFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1194
            FE +V +CD+ +  IPLSF++GF+V+ V+ RWW  +T IPW + IA  +   V G+  E+   +R  ++RY+ L   +++  VS +V+ RFP   +  +  ++  +   I++ +NK                                  P   + W+P+ WA+ ++ +++K G I D     T+I E+   R Q   L+    I +PLVYTQVV + VYSYFL   M  Q+ D +     +Y+    L FP+    +F F MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:   63 FEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAF--------------------------------PRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 170.629 bits (431), Expect = 5.323e-45
Identity = 101/311 (32.48%), Postives = 163/311 (52.41%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE---KNSYI-YFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1194
            FE +V +CD+ +  IPLSF++GF+V+ V+ RWW  +T IPW + IA  +   V G+  E+   +R  ++RY+ L   +++  VS +V+ RFP   +  +  ++  +   I++ +NK                                  P   + W+P+ WA+ ++ +++K G I D     T+I E+   R Q   L+    I +PLVYTQVV + VYSYFL   M  Q+ D +     +Y+    L FP+    +F F MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:   63 FEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAF--------------------------------PRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 170.244 bits (430), Expect = 5.328e-45
Identity = 101/311 (32.48%), Postives = 163/311 (52.41%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE---KNSYI-YFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1194
            FE +V +CD+ +  IPLSF++GF+V+ V+ RWW  +T IPW + IA  +   V G+  E+   +R  ++RY+ L   +++  VS +V+ RFP   +  +  ++  +   I++ +NK                                  P   + W+P+ WA+ ++ +++K G I D     T+I E+   R Q   L+    I +PLVYTQVV + VYSYFL   M  Q+ D +     +Y+    L FP+    +F F MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:   63 FEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAF--------------------------------PRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 170.244 bits (430), Expect = 7.197e-45
Identity = 101/311 (32.48%), Postives = 163/311 (52.41%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE---KNSYI-YFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHL 1194
            FE +V +CD+ +  IPLSF++GF+V+ V+ RWW  +T IPW + IA  +   V G+  E+   +R  ++RY+ L   +++  VS +V+ RFP   +  +  ++  +   I++ +NK                                  P   + W+P+ WA+ ++ +++K G I D     T+I E+   R Q   L+    I +PLVYTQVV + VYSYFL   M  Q+ D +     +Y+    L FP+    +F F MGWLKVA  ++NPFG+DD+DF+ + ++D NL V++  V      +PE L
Sbjct:   63 FEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQ-DERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAF--------------------------------PRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELL 340          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 166.392 bits (420), Expect = 1.015e-43
Identity = 103/299 (34.45%), Postives = 163/299 (54.52%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKF--PLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FEKL ++CD     IP+SF++GF+V  VV+RWW  F  +PW ++++ L+   V G   E A  +R  L+RY NL+ IL+ R VS+ V  RFP     +  ++++                      +++  E+   Q++ +         P+  +FW+P  W   L  +++  G I +    + ++ E+  LR Q   L     I LPLVYTQVV + VYS+FL  ++  QFLDP +  Y    L F  P+  + +F F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:   61 MFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRG-ADEGARLIRRSLMRYANLSGILIYRSVSTAVYKRFP-----TMSHLVQ--------------------AGLMTAEELRQLQELPS---------PHN-KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQG-YPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 150.984 bits (380), Expect = 2.744e-40
Identity = 92/297 (30.98%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            IF +L   C+     IP+SF++GF+V     RWW  +T  P  + +  ++   V G   E+   +R  L+RY NL+ +L++R +S++VR RF       +     F TT+ L                         +K+ + + D N       ++W+PL W + L ++++K G + D      L+ E+ N R +   L     I +PLVYTQVV + VYS+F   ++  QF+ P  +S  +  L  P+  + EF F  GWLKV   ++NPFG+DD+DF+T++++D N+ V+  +V
Sbjct:   61 IFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGT-DERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAG---FMTTDEL-------------------------RKLNHLYSDFN-------KYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKP-ASSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAV 320          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 150.599 bits (379), Expect = 1.709e-39
Identity = 99/299 (33.11%), Postives = 156/299 (52.17%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVG--FFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++CD   + IP+SF++G  F+V  VV RWW  +T IP  +++  ++   V G   E+   +R  L+RY +L+ +L++R VS+ V  RFP             +   +++      + R+ F                     E+   PY  ++WIP  W + L   ++  G I D  T   L+ E+ N R +   L     I +PLVYTQVV + VYS+FLV ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQG-SDERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ESLHSPYN-KYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 324          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 147.902 bits (372), Expect = 1.739e-39
Identity = 91/292 (31.16%), Postives = 150/292 (51.37%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDV 1146
            IF +L   C+     IP+SF++GF+V     RWW  +T  P  + +  ++   V G   E+   +R  L+RY NL+ +L++R +S++VR RF       +     F TT+ L                         +K+ + + D N       ++W+PL W + L ++++K G + D      L+ E+ N R +   L     I +PLVYTQVV + VYS+F   ++  QF+ P  +S  +  L  P+  + EF F  GWLKV   ++NPFG+DD+DF+T++++D N+ V
Sbjct:   61 IFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHG-TDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAG---FMTTDEL-------------------------RKLNHLYSDFN-------KYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFVKPA-SSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 107.457 bits (267), Expect = 3.118e-25
Identity = 59/144 (40.97%), Postives = 87/144 (60.42%), Query Frame = 1
Query:  736 EFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKF--PLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FW+P  W   L  +++  G I +    + ++ E+  LR Q   L     I LPLVYTQVV + VYS+FL  ++  QFLDP +  Y    L F  P+  + +F F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:   20 KFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQG-YPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 162          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 161.384 bits (407), Expect = 9.159e-44
Identity = 102/303 (33.66%), Postives = 153/303 (50.50%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP-----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            I FEKL ++CD     IP+SF++GF+V  VV+RWW  +  +PW +++  L+   V G   E+   +R  L+RY NL  +L++R VS+ V  RFP  +       +  +     DGL                  + S  K                 FW+P  W + L   ++  G I D      ++ E+ +LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFLDP+K     +P     L  P+  + +F F  GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:   60 IYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGT-DERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGL------------------VSSHNK-----------------FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKG----YPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 160.999 bits (406), Expect = 1.480e-43
Identity = 102/303 (33.66%), Postives = 153/303 (50.50%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP-----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            I FEKL ++CD     IP+SF++GF+V  VV+RWW  +  +PW +++  L+   V G   E+   +R  L+RY NL  +L++R VS+ V  RFP  +       +  +     DGL                  + S  K                 FW+P  W + L   ++  G I D      ++ E+ +LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFLDP+K     +P     L  P+  + +F F  GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:   60 IYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGT-DERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGL------------------VSSHNK-----------------FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKG----YPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 161.384 bits (407), Expect = 2.193e-43
Identity = 102/303 (33.66%), Postives = 153/303 (50.50%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP-----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            I FEKL ++CD     IP+SF++GF+V  VV+RWW  +  +PW +++  L+   V G   E+   +R  L+RY NL  +L++R VS+ V  RFP  +       +  +     DGL                  + S  K                 FW+P  W + L   ++  G I D      ++ E+ +LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFLDP+K     +P     L  P+  + +F F  GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:   60 IYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGT-DERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGL------------------VSSHNK-----------------FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKG----YPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 161.384 bits (407), Expect = 4.613e-43
Identity = 102/303 (33.66%), Postives = 153/303 (50.50%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP-----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            I FEKL ++CD     IP+SF++GF+V  VV+RWW  +  +PW +++  L+   V G   E+   +R  L+RY NL  +L++R VS+ V  RFP  +       +  +     DGL                  + S  K                 FW+P  W + L   ++  G I D      ++ E+ +LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFLDP+K     +P     L  P+  + +F F  GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:   60 IYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGT-DERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGL------------------VSSHNK-----------------FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKG----YPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 163.31 bits (412), Expect = 1.002e-42
Identity = 101/299 (33.78%), Postives = 152/299 (50.84%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            I FEKL ++CD     IP+SF++GF+V  VV+RWW  +  +PW +++  L+   V G   E+   +R  L+RY NL  +L++R VS+ V  RFP  +       +  +     DGL                  + S  K                 FW+P  W + L   ++  G I D      ++ E+ +LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFLDP+K    +   L  P+  + +F F  GWLKVA  ++NPFG DD+DF+T+ ++D NL V+  +V
Sbjct:   60 IYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGT-DERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGL------------------VSSHNK-----------------FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 166.777 bits (421), Expect = 1.890e-45
Identity = 107/303 (35.31%), Postives = 160/303 (52.81%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFP-----LKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            ++FEKL ++CD+    IP+SF++GF+V  VV+RWW  +  +PW +++   +   V G+  E+   +R  LIRY  L  +L++R +S+ V  RFP                 +L G              ++  E    QK+G   L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K+    +P     L  P+  I +F+F MGWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  SV
Sbjct:   60 LLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGK-DEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHL------------VLAGF-------------MTHGEHKQLQKLG---LPHN-------TFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKD----YPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 168.318 bits (425), Expect = 5.057e-45
Identity = 106/301 (35.22%), Postives = 159/301 (52.82%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTA 1167
            ++FEKL ++CD+    IP+SF++GF+V  VV+RWW  +  +PW +++   +   V G+  E+   +R  LIRY  L  +L++R +S+ V  RFP                 +L G              ++  E    QK+G   L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K+   +   L  P+  I +F+F MGWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  SV  
Sbjct:   60 LLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGK-DEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHL------------VLAGF-------------MTHGEHKQLQKLG---LPHN-------TFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDG 324          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 154.066 bits (388), Expect = 3.856e-40
Identity = 97/297 (32.66%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKLV++CD   + IP+SF++GF+V  VV RWW  +  +P  + +  ++   V GR  ++    R  L+RY  L+ +L++R VS+ V  RFP             +   +++      + R+ F                     EN +  Y  ++W+P  W S L  ++++ G I D      L+ E+   R +   L     I +PLVYTQVV I VYSYFL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ENLNSSYN-KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 154.066 bits (388), Expect = 3.856e-40
Identity = 97/297 (32.66%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKLV++CD   + IP+SF++GF+V  VV RWW  +  +P  + +  ++   V GR  ++    R  L+RY  L+ +L++R VS+ V  RFP             +   +++      + R+ F                     EN +  Y  ++W+P  W S L  ++++ G I D      L+ E+   R +   L     I +PLVYTQVV I VYSYFL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ENLNSSYN-KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 154.066 bits (388), Expect = 3.856e-40
Identity = 97/297 (32.66%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKLV++CD   + IP+SF++GF+V  VV RWW  +  +P  + +  ++   V GR  ++    R  L+RY  L+ +L++R VS+ V  RFP             +   +++      + R+ F                     EN +  Y  ++W+P  W S L  ++++ G I D      L+ E+   R +   L     I +PLVYTQVV I VYSYFL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ENLNSSYN-KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O88870|BEST1_MOUSE (Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=2 SV=3)

HSP 1 Score: 168.318 bits (425), Expect = 3.537e-44
Identity = 106/301 (35.22%), Postives = 159/301 (52.82%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTA 1167
            ++FEKL ++CD+    IP+SF++GF+V  VV+RWW  +  +PW +++   +   V G+  E+   +R  LIRY  L  +L++R +S+ V  RFP                 +L G              ++  E    QK+G   L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K+   +   L  P+  I +F+F MGWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  SV  
Sbjct:   60 LLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGK-DEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHL------------VLAGF-------------MTHGEHKQLQKLG---LPHN-------TFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDG 324          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O76090|BEST1_HUMAN (Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.536e-42
Identity = 107/320 (33.44%), Postives = 166/320 (51.88%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQ 1224
            ++FEKL ++CD+    IP+SF++GF+V  VV RWW  +  +PW +++  L+   V G+  E+   +R  LIRY NL  +L++R VS+ V  RFP     S +++++                       ++  E    +K+    L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K    +   L  P+    +F F +GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V       P  ++P   W K +
Sbjct:   60 LMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFP-----SAQHLVQ--------------------AGFMTPAEHKQLEKLS---LPHN-------MFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPR-MEPDMYWNKPE 342          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6UY87|BEST1_MACFA (Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BEST1 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.908e-42
Identity = 103/299 (34.45%), Postives = 159/299 (53.18%), Query Frame = 1
Query:  268 IIFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            ++FEKL ++CD+    IP+SF++GF+V  VV RWW  +  +PW +++  L+   V G+  E+   +R  LIRY NL  +L++R VS+ V  RFP     S +++++                       ++  E    +K+    L  N        FW+P  W + L  K+   G I D     +L+ E+  LR Q   L     I +PLVYTQVV + VYS+FL  ++  QFL+P K    +   L  P+    +F F +GWLKVA  ++NPFG+DD+DF+T+ I+D NL V+  +V
Sbjct:   60 LMFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGK-DEQGRLLRRTLIRYANLGNVLILRSVSTAVYKRFP-----SAQHLVQ--------------------AGFMTPAEHKQLEKLS---LPHN-------MFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8N1M1|BEST3_HUMAN (Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.041e-40
Identity = 100/297 (33.67%), Postives = 151/297 (50.84%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++CD     IP++F++GF+V  VV RWW  F  +PW +++ FLI   V G   E    +R  L+RY+NL  +L+ R VS+ V  RFP      +     F TT+                    ER++  F  + +  L          ++W+P  W   L  K++  G I D     +L+ E+   R     L     + +PLVYTQVV + VY++F   ++  QFLDP K    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+  +D NL V+  +V
Sbjct:   62 FEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHG-SDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAG---FMTTD--------------------ERKL--FNHLKSPHL----------KYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.593e-39
Identity = 97/297 (32.66%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKLV++CD   + IP+SF++GF+V  VV RWW  +  +P  + +  ++   V GR  ++    R  L+RY  L+ +L++R VS+ V  RFP             +   +++      + R+ F                     EN +  Y  ++W+P  W S L  ++++ G I D      L+ E+   R +   L     I +PLVYTQVV I VYSYFL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGR-DDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFP-------------TIDHVVEAGFMTREERKKF---------------------ENLNSSYN-KYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAV 322          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267E0S0 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007515g1 PE=3 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 2.693e-77
Identity = 153/436 (35.09%), Postives = 244/436 (55.96%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGK--EKATKVRLVLIRYINLAWILLMRQVSSQVRNRF----PP-------------------------------------CRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDP----------------------EKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP--NKCLNFLKCISCG 1377
            FE +V  C+    SIPLSF++GFFVA V+ RWWQ++  IPWLN+I+FL   ++ G  +  E+A ++RL ++RY+N+ WILLM  +S +V ++F    PP                                      +SRS+K  I++    +L+ +N+  ++R  F K+++E EI +F++  ++++ +    PY P++W+PL+WA  L  K+   G   D R+   L+ EIE++R  MQ+L+I + +++PLVYTQVVII VYSYFL+Q+ + QF++P                      E +      + FP+  +F+F+F+MGWLKVAMCVMNPFGDDDEDF T ++LD NL+++ R   A SS +PE L   +M W +     + D L D++   +S+  +  + + E+ +  +   P     L    C+ CG
Sbjct:   62 FELVVKLCNEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFLSYGILTGTRENFEQARRLRLSMMRYLNIGWILLMHSISEKVMHQFSDVKPPDETEEGNSAGEGLLTRIRYVMDRLAGTNQMAAQLRANSKSRSQKG-IRY----LLESINRCTRVRLHFPKLVTETEIQAFERAESEYVSKY-WRPYVPDYWLPLQWAVLLCKKAMVHGFC-DPRSMVKLMEEIEDVRGMMQTLVIYNEVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKWTAEALGRLTNTSVLPISTGSEHHHGEVIDMYFPVFTVFQFLFLMGWLKVAMCVMNPFGDDDEDFHTLEMLDYNLEISSRCSEAPSSQFPEGLSEASMEWIRRSPGSEADSLFDYLASAESEFRQAGEPSQEERLHEILAKPALRHRLRAGCCLHCG 490          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FEW0 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017118g1 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 6.609e-77
Identity = 152/436 (34.86%), Postives = 244/436 (55.96%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGK--EKATKVRLVLIRYINLAWILLMRQVSSQVRNRF----PP-------------------------------------CRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDP----------------------EKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP--NKCLNFLKCISCG 1377
            FE +V  C+    SIPLSF++GFFVA V+ RWWQ++  IPWLN+I+FL   ++ G  +  E+A ++RL ++RY+N+ WILLM  +S +V ++F    PP                                      +SRS+K  I++    +L+ +N+  ++R  F K+++E EI +F++  ++++ +    PY P++W+PL+WA  L  K+   G   D R+   L+ EIE++R  MQ+L+I + +++PLVYTQVVII VYSYFL+Q+ + QF++P                      E +      + FP+  +F+F+F+MGWLKVAMCVMNPFGDDDEDF T ++LD NL+++ R   A  S +PE L   +M W +     + D L D++   +S+  +  + + E+ +  +   P   + L    C+ CG
Sbjct:   62 FELVVKLCNEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFLSYGILTGTRENFEQARRLRLSMMRYLNIGWILLMHSISEKVMHQFSDVKPPDETEEGNSAGEGLLTRIRYVMDRLAGTNQMAAQLHANSKSRSQKG-IRY----LLESINRCTRVRLHFPKLVTETEIQAFERAESEYISKY-WRPYVPDYWLPLQWAVLLCKKAMVHGFC-DPRSMVKLMEEIEDVRGMMQTLVIYNEVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKWTAEALGRLTNTSVLPISTGSEHHHGEVIDMYFPVFTVFQFLFLMGWLKVAMCVMNPFGDDDEDFHTLEMLDYNLEISSRCSEAPPSQFPEGLSEASMEWIRRSPGSEADSLFDYLASAESEFRQAGEPSQEERLHEILAKPALRQRLRAGCCLHCG 490          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267H4Q9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017118g2 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 1.144e-76
Identity = 152/436 (34.86%), Postives = 244/436 (55.96%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGK--EKATKVRLVLIRYINLAWILLMRQVSSQVRNRF----PP-------------------------------------CRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDP----------------------EKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITP--NKCLNFLKCISCG 1377
            FE +V  C+    SIPLSF++GFFVA V+ RWWQ++  IPWLN+I+FL   ++ G  +  E+A ++RL ++RY+N+ WILLM  +S +V ++F    PP                                      +SRS+K  I++    +L+ +N+  ++R  F K+++E EI +F++  ++++ +    PY P++W+PL+WA  L  K+   G   D R+   L+ EIE++R  MQ+L+I + +++PLVYTQVVII VYSYFL+Q+ + QF++P                      E +      + FP+  +F+F+F+MGWLKVAMCVMNPFGDDDEDF T ++LD NL+++ R   A  S +PE L   +M W +     + D L D++   +S+  +  + + E+ +  +   P   + L    C+ CG
Sbjct:   62 FELVVKLCNEMDKSIPLSFILGFFVAGVIGRWWQMYLNIPWLNRISFLSYGILTGTRENFEQARRLRLSMMRYLNIGWILLMHSISEKVMHQFSDIKPPDETEEGNSAGEGLLTRIRYVMDRLAGTNQMAAQLHANSKSRSQKG-IRY----LLESINRCTRVRLHFPKLVTETEIQAFERAESEYVSKY-WRPYVPDYWLPLQWAVLLCKKAMVHGFC-DPRSMVKLMEEIEDVRGMMQTLVIYNEVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKWTAEALGRLTNTSVLPISTGSEHHHGEVIDMYFPVFTVFQFLFLMGWLKVAMCVMNPFGDDDEDFHTLEMLDYNLEISSRCSEAPPSQFPEGLSEASMEWIRRSPGSEADSLFDYLASAESEFRQAGEPSQEERLHEILAKPALRQRLRAGCCLHCG 490          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FNT5 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025133g2 PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.002e-73
Identity = 143/380 (37.63%), Postives = 220/380 (57.89%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGK--EKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE--------KNSYIYFPLK--------------FPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1335
            FE +V FC     +IPLSF++GFFVA V+ RWW+++  IPWLN+IAF    L+ G     E A ++R  L+RY+NLAWILLM  +S ++ +RF      +           +L+ +N+  K++  F K+++E EI +F +   ++  +   + Y P++W+PL WA+ L  K+   G   D R+   ++ E+E +R  M +L I + +++PLVYTQVVII VYSYFL+Q+ + QF++P+        + +    P+               FP+  + +F+F+MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:   62 FELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADE--NGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKY-QKKYVPDYWLPLHWAALLSKKAMIHGYC-DPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 437          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A1I8HMQ9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.916e-73
Identity = 143/380 (37.63%), Postives = 220/380 (57.89%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGK--EKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE--------KNSYIYFPLK--------------FPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSS-MYPEHLDPPAM-WYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT 1335
            FE +V FC     +IPLSF++GFFVA V+ RWW+++  IPWLN+IAF    L+ G     E A ++R  L+RY+NLAWILLM  +S ++ +RF      +           +L+ +N+  K++  F K+++E EI +F +   ++  +   + Y P++W+PL WA+ L  K+   G   D R+   ++ E+E +R  M +L I + +++PLVYTQVVII VYSYFL+Q+ + QF++P+        + +    P+               FP+  + +F+F+MGWLKVAMCVMNPFGDDDEDF TS ILD NL++T R V   S+  YPE L  P+M W K     + D + +++   + +         EK +  L++T
Sbjct:   76 FELVVRFCSGMDKNIPLSFILGFFVAGVIGRWWEMYMNIPWLNRIAFCCYGLITGTKDTFEVAKQIRCSLMRYMNLAWILLMHSISERIVHRFSNTEEAAADE--NGGVRALLENINRCDKVQLHFRKLVTENEIDAFARAEAEYKIKY-QKKYVPDYWLPLHWAALLSKKAMIHGYC-DPRSMVMIMREVERVRCMMHTLNIYNDVMIPLVYTQVVIIAVYSYFLLQLFSQQFVNPKLTAEMMSARTNATVMPVTVTSSSSTGDVIDMYFPIFTVLQFLFLMGWLKVAMCVMNPFGDDDEDFHTSDILDYNLEITSRCVEGQSAPHYPEGLTEPSMEWLKKSAGSEGDNMLEYLDAAEMEFSVVPPPPPEKFLEPLQMT 451          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 170.629 bits (431), Expect = 4.618e-45
Identity = 104/299 (34.78%), Postives = 155/299 (51.84%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKF--PLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FEKL ++CD     IP+SF++GF+V  VV+RWW  F  +PW +++A L+   V G   E A  +R  L+RY NL+ +L+ R +S+ V  RFP      +  ++       LD L                                    P+  +FW+P  W   L  +++  G I +    S ++ E+  LR Q   L     I LPLVYTQVV + VYS+FL  ++  QFLDP +  Y    L F  P+  + +F F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:   61 LFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRG-ADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDL----------------------------------PSPHN-KFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQG-YSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 155.606 bits (392), Expect = 4.039e-40
Identity = 99/297 (33.33%), Postives = 154/297 (51.85%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++C+   + IP+SF++GF+V  +V RWW  +T IP  + I  ++   + G G E+   +R  L+RY +LA +L++R VS+ V  RFP                        D  +   F   ++  E   F+ +           PY  ++WIP  W + L   ++  G I D  T   L+ E+   R +   L     I +PLVYTQVV + VYS+FLV ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQG-GDERGRLLRRTLMRYASLASLLILRSVSTAVFKRFP----------------------TMDHVVEAGF---MTREERKKFESL---------HSPYN-KYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 140.198 bits (352), Expect = 1.962e-36
Identity = 88/300 (29.33%), Postives = 153/300 (51.00%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQ-VVIIVVYSYFLVQIMTSQFLDPEKNS--YIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FE+    C+     IP+SF++ F+V     RWW  +T  P  + +  ++   V G   E+   +R  L+RY NL+ +L++R +S++V  RFP             +   I+D               ++E E+ +   + + F           ++W+PL W + L +K+++ G + D      L+ E+ N R +   L     I +PLVYTQ VV + VYS+F   ++  QF+ PE+     ++  L  P+  + EF F  GWLKV   ++NPFG+DD+DF+T++++D N+ V+  +V
Sbjct:   61 LFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHG-SDERGRLLRRTLMRYANLSSVLILRSISTRVHKRFP-------------TLQHIVDAF-------------MTEEEMRTLDHLYSDF----------NKYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVHVDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 138.272 bits (347), Expect = 3.876e-34
Identity = 91/299 (30.43%), Postives = 141/299 (47.16%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKF--PLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FEKL ++CD     IP+SF++GF+V  VV+RWW  F  +PW +++A L+   V G   E A  +R  L+RY NL+ +L+ R +S+ V  RFP      +  ++       LD L                                    P+  +FW+P  W   L  +++  G I +    S ++                           VV + VYS+FL  ++  QFLDP +  Y    L F  P+  + +F F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:   61 LFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRG-ADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDL----------------------------------PSPHN-KFWVPCMWFVNLALRARTEGRINNDVALSAIL--------------------------NVVTVAVYSFFLACLIGRQFLDPTQG-YSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSV 296          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 105.145 bits (261), Expect = 8.259e-24
Identity = 54/143 (37.76%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  736 EFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            ++WIP  W + L +K++K G I D     T++ E+   R    +L     + +PLVYTQVV + VY++F   I+  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+ +  +D NL V+  +V
Sbjct:  102 KYWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAV 244          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 157.532 bits (397), Expect = 2.492e-43
Identity = 93/296 (31.42%), Postives = 148/296 (50.00%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++C+     IP+SF++GF+V  VV+RWW  +  +PW +++  L+ C V G   E+   +R  L+RY NL+ +L++R VS+ V  RFP      +   +  +     DGL                                    P+  +FW+P  W + L  +++  G I D  +   ++ ++ N R     L     + +PLVYTQVV + VYS+FL  ++  QFL P+        L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+ +  +D NL V+   V
Sbjct:   62 FEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHG-ADERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTPAERRKFDGLR----------------------------------SPHN-KFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGPQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLMGV 321          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 147.132 bits (370), Expect = 1.736e-38
Identity = 96/298 (32.21%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FEKL ++C+   N IP+    GF+VA VV+RWW  +T IP  +++   +   V G   E+   +R  L+RY NL+ +L++R VS+ V  RFP      +   +     +  DGL      R ++ K                             +W+P  W S L  +++  G + D      L+ E+   R     L     I +PLVYTQVV + VYS+FL  ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  +V
Sbjct:   61 LFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGV-DERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTRDERKRFDGL------RCSYNK-----------------------------YWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 160.999 bits (406), Expect = 8.364e-42
Identity = 103/300 (34.33%), Postives = 166/300 (55.33%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKV-RLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIYFPLKF--PLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FE+L ++CD     IP+SF++ F+V  VV+RWW  F  IPW +++A L+   V  RG ++A+++ R  L+RY+NL+ +L+ R VS+ V  RFP              TTE L               +++  E+  F+++           P+  +FW+P  W   L  +++  G I +    + ++ E+ +LR +   L     I LPLVYTQV  + VYS+FL  ++  QFLDP +  Y    + F  P+  + +F F +GWLKVA  ++NPFG+DD+DF+T+ ++D NL V+  SV
Sbjct:   60 LFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHV--RGTDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRFP--------------TTEHL------------VQALMTSEELRHFEEL---------PSPHN-KFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQG-YPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSV 319          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 159.458 bits (402), Expect = 1.855e-41
Identity = 98/298 (32.89%), Postives = 155/298 (52.01%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            +FEKL ++CD     IP++F++GF+V  VV RWW  F  +PW +++ F I   V G+  E    +R  L+RYINL  +L+ R VS+ V  RFP             +   +++      + R+ F                     EN   P+  ++WIP+ W S L +++++ G I D      ++ E+   R    +L     + +PLVYTQVV + VY++F   I+  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+ + I+D NL V+  +V
Sbjct:   61 LFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGK-DEYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRFP-------------TIDHVVEAGFMTPEERKVF---------------------ENIRSPHL-KYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAV 322          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 150.984 bits (380), Expect = 9.303e-39
Identity = 92/297 (30.98%), Postives = 151/297 (50.84%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSV 1161
            FEKL ++C+   + IP+SF++GF+V  +V RWW  +T IP  ++I  ++   + G   E+   +R  ++RY +L+ +L++R VS+ V  RFP      +   +     +  +GL+                                   PY  ++WIP  W + L   ++  G I D      L+ E+   R +   L     + +PLVYTQVV + VYS+FLV ++  QFLDP +    +   L  P+  + +F F  GWLKVA  ++NPFG+DD+DF+T+ ++D N  V+  +V
Sbjct:   62 FEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQGN-DERGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFEGLHS----------------------------------PYN-KYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV 322          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 281/423 (66.43%), Postives = 336/423 (79.43%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE-KNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGXXXXXXXXXXKAKFFRKHKQNVPQDNIIIEESIDNPKDVLVQKV 1539
            FE++V FCD  KN+IP+SFL+GFFV  V+ARW+QL+  IP+LN++AFL + L+ G  KEK  K+R  L+RY+NL+WIL MRQVS Q+  RF   +   + N  +          N+D KI+ TF KII++ E+ +F+ +  +   +   + + PEFW+P++W+SRLL K+   G I D RT +++I +++ LR QM +L I S I++PLVYTQV+II VYSYFL Q+  SQF+DPE K +     L  P+  IF+F+F MGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPT TTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKD+LVQKV
Sbjct:   64 FEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSK-FPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 482          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000070057.1 (SMESG000070057.1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 281/423 (66.43%), Postives = 336/423 (79.43%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPE-KNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGXXXXXXXXXXKAKFFRKHKQNVPQDNIIIEESIDNPKDVLVQKV 1539
            FE++V FCD  KN+IP+SFL+GFFV  V+ARW+QL+  IP+LN++AFL + L+ G  KEK  K+R  L+RY+NL+WIL MRQVS Q+  RF   +   + N  +          N+D KI+ TF KII++ E+ +F+ +  +   +   + + PEFW+P++W+SRLL K+   G I D RT +++I +++ LR QM +L I S I++PLVYTQV+II VYSYFL Q+  SQF+DPE K +     L  P+  IF+F+F MGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPT TTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKD+LVQKV
Sbjct:   64 FEEIVKFCDNMKNNIPISFLLGFFVTGVIARWFQLYLYIPYLNRMAFLSEGLINGGDKEKCLKIRQTLMRYLNLSWILCMRQVSDQIDIRF---KHNDENNNEEHHFRHTFINFNRDKKIQSTFRKIITDAEVRAFENIAAKNYSKTKSK-FPPEFWVPIQWSSRLLQKAFVHGFISDPRTLNSIISDLDVLRGQMHTLQIFSGIMIPLVYTQVIIIAVYSYFLCQLFASQFVDPESKITGHEVDLYVPIFTIFQFLFFMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGSPTITTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDLLVQKV 482          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000065100.1 (SMESG000065100.1)

HSP 1 Score: 356.681 bits (914), Expect = 8.823e-118
Identity = 177/338 (52.37%), Postives = 244/338 (72.19%), Query Frame = 1
Query:  271 IFEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDPEKNSYIY-FPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDL 1281
            IFE++V FCD+KKN+IPLSFL+GFFVA ++ RWW+++  IPWLNKIAF+ Q ++IG G  K+ +VRL+++RY+NLAWILLMR +S+Q++ RF   ++       +    EIL+ +N D +IR+TF KII+  EI +F+ +  ++   N    YEPEFW+P++WASR+++K    G I D RT ++L  E+E LREQMQ+L I S IL+PLVYTQVV+I VYSYFLV +  +QF+DP +    +      P+  IF+F+F+MGWLKVAMCVMNPFGDDDEDFQTS++LD NLD++FRS  A   MYP  L P  M Y+ Q   DED L DF+ D++++L
Sbjct:   62 IFEEIVKFCDSKKNNIPLSFLLGFFVAGIIGRWWKMYLCIPWLNKIAFICQSIIIGNGPVKSRRVRLIIMRYMNLAWILLMRNISAQIKVRFQQHKNMKVNYRSENYIKEILENINADERIRQTFKKIITVSEIRAFENIALKYNTRNKIR-YEPEFWVPIQWASRIIHKCFIHGFISDPRTMTSLNEEVEELREQMQNLQIYSNILIPLVYTQVVVIAVYSYFLVHLFAAQFVDPGQRIVGHEVDFYIPVFTIFQFLFMMGWLKVAMCVMNPFGDDDEDFQTSEMLDYNLDISFRSSEASEEMYPSLLKPAIMKYRLQDAVDEDNLPDFIDDVENNL 398          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 317.775 bits (813), Expect = 2.145e-102
Identity = 166/368 (45.11%), Postives = 240/368 (65.22%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDP-EKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT---PNKCLNFLKC 1365
            F K+V F D  K +IP  FL+GFFV+ V+ RW +++ LIPWL++ AFL Q  + G     + ++R  ++RY+NLAWIL MRQ+S Q+  RF   +  +  N ++ +  +I    NKD KI+ T+GKII++ EI +F+ +  +  D N    Y PE+W+P++WASR++ KS     + D RT + +I E++ +R  MQ+L +   I++PLVYTQVVII VYS+FL ++  SQF+DP EK          P+  IF+F+F+MGWLKVAMCVMNPFGDDDEDFQTS+ILD+NLD T+RSV+ +  M+PE LDPP M Y+     + D L+ F+ +ID DLE+    +   +V  LE+    P K +N+ K 
Sbjct:   46 FVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIK-SDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDLEDLDCTSETNEVKTLEMKDSIPKKIINYFKS 412          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000055094.1 (SMESG000055094.1)

HSP 1 Score: 317.39 bits (812), Expect = 4.493e-102
Identity = 166/368 (45.11%), Postives = 240/368 (65.22%), Query Frame = 1
Query:  274 FEKLVVFCDAKKNSIPLSFLVGFFXXXXXXRWWQLFTLIPWLNKIAFLIQCLVIGRGKEKATKVRLVLIRYINLAWILLMRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIISEREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDLRTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMTSQFLDP-EKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDFQTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFMKDIDSDLEETVQLNNEKDVTNLEIT---PNKCLNFLKC 1365
            F K+V F D  K +IP  FL+GFFV+ V+ RW +++ LIPWL++ AFL Q  + G     + ++R  ++RY+NLAWIL MRQ+S Q+  RF   +  +  N ++ +  +I    NKD KI+ T+GKII++ EI +F+ +  +  D N    Y PE+W+P++WASR++ KS     + D RT + +I E++ +R  MQ+L +   I++PLVYTQVVII VYS+FL ++  SQF+DP EK          P+  IF+F+F+MGWLKVAMCVMNPFGDDDEDFQTS+ILD+NLD T+RSV+ +  M+PE LDPP M Y+     + D L+ F+ +ID DLE+    +   +V  LE+    P K +N+ K 
Sbjct:   63 FVKMVQFADEMKGNIPFFFLLGFFVSGVIGRWIKMYLLIPWLHRQAFLFQGCINGNEPAMSLRLRRTILRYLNLAWILQMRQISDQISLRFRNNKINNSTNSVETTIRDIFINFNKDPKIQNTYGKIITDAEIRAFEAIAIK-SDSNGKPNYVPEYWVPIQWASRVIQKSFIHKYVSDPRTVNKMIEELDRVRNNMQNLQVFCGIMIPLVYTQVVIIAVYSFFLCELFASQFIDPREKVKGHELDFYVPIFTIFQFLFLMGWLKVAMCVMNPFGDDDEDFQTSEILDNNLDTTYRSVSGELEMFPERLDPPKMNYECLLKTEPDNLETFLDEIDYDLEDLDCTSETNEVKTLEMKDSIPKKIINYFKS 429          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST13.199e-4333.44bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST14.688e-4333.54bestrophin 1 [Source:HGNC Symbol;Acc:HGNC:12703][more]
BEST31.893e-4233.67bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST32.168e-4133.67bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST23.829e-3932.32bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-171.644e-3826.86Bestrophin homolog 17 [Source:UniProtKB/Swiss-Pro... [more]
best-37.033e-3830.52Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-46.812e-3629.55Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-51.133e-3527.69Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
best-242.421e-3528.43Bestrophin homolog 24 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best31.060e-4530.62gene:FBgn0036492 transcript:FBtr0075618[more]
Best14.103e-4532.48gene:FBgn0040238 transcript:FBtr0082183[more]
Best15.323e-4532.48gene:FBgn0040238 transcript:FBtr0114590[more]
Best15.328e-4532.48gene:FBgn0040238 transcript:FBtr0337020[more]
Best17.197e-4532.48gene:FBgn0040238 transcript:FBtr0306023[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best11.015e-4334.45bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best42.744e-4030.98bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best21.709e-3933.11bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best41.739e-3931.16bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best13.118e-2540.97bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best19.159e-4433.66bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.480e-4333.66bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best12.193e-4333.66bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best14.613e-4333.66bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best11.002e-4233.78bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best11.890e-4535.31bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best15.057e-4535.22bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best23.856e-4032.66bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best23.856e-4032.66bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best23.856e-4032.66bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88870|BEST1_MOUSE3.537e-4435.22Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=... [more]
sp|O76090|BEST1_HUMAN1.536e-4233.44Bestrophin-1 OS=Homo sapiens OX=9606 GN=BEST1 PE=1... [more]
sp|Q6UY87|BEST1_MACFA2.908e-4234.45Bestrophin-1 OS=Macaca fascicularis OX=9541 GN=BES... [more]
sp|Q8N1M1|BEST3_HUMAN1.041e-4033.67Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE2.593e-3932.66Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E0S02.693e-7735.09Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FEW06.609e-7734.86Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267H4Q91.144e-7634.86Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FNT52.002e-7337.63Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A1I8HMQ93.916e-7337.63Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best14.618e-4534.78bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best24.039e-4033.33bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best41.962e-3629.33bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best13.876e-3430.43bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST38.259e-2437.76bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best12.492e-4331.42bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best21.736e-3832.21bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
best18.364e-4234.33bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
BEST31.855e-4132.89bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best29.303e-3930.98bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070057.10.000e+066.43SMESG000070057.1[more]
SMESG000070057.10.000e+066.43SMESG000070057.1[more]
SMESG000065100.18.823e-11852.37SMESG000065100.1[more]
SMESG000055094.12.145e-10245.11SMESG000055094.1[more]
SMESG000055094.14.493e-10245.11SMESG000055094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021685 ID=SMED30021685|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1701bp
TTATACTTGTTACTTTTCAATCTGAAAATCAGTATAGTGGATCATATACA
CTGTATATGACGATCATATATTTAGATCAAATCTAACAGGAAACAACACT
ATATACAATCTTCCAACAAGTATTCTGGATCTTTCAGCAATCAATAAACA
TGATGAATCCATAATAAAAAAAGAAAACTGTTATACAATCATTGAGGATG
ATGTTGTTATTGATACCGATGAAGATGAAATAATATCTATAAAGGATTAA
GAATCTGATTCTGATGAATAATTTTCGAGAAGTTAGTTGTATTTTGTGAT
GCGAAAAAGAATAGTATTCCATTATCATTTTTGGTTGGATTTTTTGTTGC
TGCAGTAGTTGCTCGTTGGTGGCAACTTTTCACCTTGATACCTTGGTTAA
ATAAAATTGCGTTTTTAATCCAATGTTTAGTTATTGGTCGAGGAAAAGAG
AAAGCAACAAAAGTTCGATTAGTATTAATTCGATACATAAATTTGGCTTG
GATTTTACTCATGCGACAAGTTAGCAGTCAAGTACGAAATCGTTTTCCAC
CCTGTCGAAGTCGCTCAAAAAAGAATATGATTAAGTTTTCAACCACAGAA
ATACTAGATGGCTTGAATAAAGATTTAAAAATTAGAAGAACTTTTGGTAA
AATTATTTCTGAACGAGAAATAGGTTCCTTTCAAAAAATGGGCAATCAAT
TTCTTGATGAAAATCCAGATGAACCTTATGAACCTGAATTTTGGATACCT
TTGCGATGGGCTTCTAGACTTTTAAACAAATCTCAAAAGTGCGGAATTAT
CTATGATTTGAGAACAACATCAACATTAATTCTGGAAATAGAAAATCTTC
GAGAACAAATGCAATCTCTTCTCATTCAGAGTAGAATACTTTTACCATTA
GTCTATACTCAAGTTGTAATTATTGTCGTTTATTCATATTTTCTTGTGCA
AATTATGACATCACAATTTCTGGATCCAGAAAAAAATTCGTATATATATT
TCCCGTTGAAATTTCCTTTGCTGAATATTTTTGAATTCGTTTTTATTATG
GGTTGGTTAAAAGTAGCTATGTGTGTCATGAATCCATTTGGAGATGACGA
TGAAGATTTTCAAACTTCGAAAATTCTCGATGACAACCTCGATGTTACTT
TTCGCTCAGTTACAGCTGACTCATCAATGTATCCAGAACATCTCGACCCT
CCCGCAATGTGGTATAAAACGCAGAAAAATTGCGACGAAGACCTTTTAGA
TGATTTTATGAAAGATATAGACAGTGACTTAGAAGAAACCGTTCAGTTAA
ACAATGAAAAAGATGTCACTAATCTAGAAATAACTCCAAATAAATGCTTA
AATTTTCTAAAATGTATTTCATGTGGCCTGTGTAAATTTGTTCGGCATAA
CATTGGATCTCCAACCACCACAACTCCAACTAGTCCTAAAGCCAAATTTT
TCAGAAAACATAAACAAAATGTTCCACAGGATAATATTATTATTGAGGAA
AGCATAGATAATCCAAAAGATGTGCTCGTGCAAAAGGTATGAAGCAAGTG
AAGACTAGAAGCATATCAGAAAGTTTTTAATGATAAATGCAGCAAAGCTC
CAGATGAAATATAAAATATTATTAAATTTTTCTTCAATCTTTTTCAGCAT
TTATCTGATCTTGGGGGATTCATTTATATTTATTACGTTAAAATTTAGAG
G
back to top

protein sequence of SMED30021685-orf-1

>SMED30021685-orf-1 ID=SMED30021685-orf-1|Name=SMED30021685-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=344bp
MRQVSSQVRNRFPPCRSRSKKNMIKFSTTEILDGLNKDLKIRRTFGKIIS
EREIGSFQKMGNQFLDENPDEPYEPEFWIPLRWASRLLNKSQKCGIIYDL
RTTSTLILEIENLREQMQSLLIQSRILLPLVYTQVVIIVVYSYFLVQIMT
SQFLDPEKNSYIYFPLKFPLLNIFEFVFIMGWLKVAMCVMNPFGDDDEDF
QTSKILDDNLDVTFRSVTADSSMYPEHLDPPAMWYKTQKNCDEDLLDDFM
KDIDSDLEETVQLNNEKDVTNLEITPNKCLNFLKCISCGLCKFVRHNIGS
PTTTTPTSPKAKFFRKHKQNVPQDNIIIEESIDNPKDVLVQKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 58..198
e-value: 2.6E-29
score: 102.6
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..198
NoneNo IPR availableTMHMMTMhelixcoord: 161..183
NoneNo IPR availableTMHMMTMhelixcoord: 124..146