Fibrillar collagen NC1 domain-containing protein

Overview
NameFibrillar collagen NC1 domain-containing protein
Smed IDSMED30021684
Length (bp)5010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibrillar collagen NC1 domain-containing protein (SMED30021684) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30021684) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibrillar collagen NC1 domain-containing protein (SMED30021684) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30021684) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021684

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30021684h1SMcG0015560 SmedASXL_018434SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30021684h1SMcG0015560 Contig39521newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021684h1SMcG0015560 Contig39521uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
muscle cellSMED30021684h1SMcG0015560 dd_Smed_v4_8075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021684h1SMcG0015560 dd_Smed_v4_8075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30021684h1SMcG0015560 dd_Smed_v4_8075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021684h1SMcG0015560 dd_Smed_v6_8075_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30021684h1SMcG0015560 dd_Smed_v4_8075_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL24A1 (collagen type XXIV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:20821])

HSP 1 Score: 344.739 bits (883), Expect = 9.154e-96
Identity = 409/1194 (34.25%), Postives = 540/1194 (45.23%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQG------------------DIGMDGDRGPAGPK------------------------------GPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLL------------------GDFGIMGFPGPRGPTGLRGSSGPEGI------------KGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGK---RGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGP---HGLPGDKGI----------------SGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGI------------PGKIGTQGK---------PGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGL---PGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEP---GLKGVKGELGLPGQDGEPGL------------------------IKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRI-KDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFD--SVCF 4892
            +QG PG  GN G+       GY G++G  G +G  GP+G  G  G  G  G+ GP G  GI   RG  G KG+ GFPG  G  G  G  G PG +G  G  GF G +G  GPVG IGP G  G  G  G  G  G++G  G++G  G +G PG  G+ G +GL G  G+ G+ G SG  G                  DIG+ G  GP GPK                              GP+G  G+ G  GE GP GLKG +G +G  G+IGE+G  G  G +G+ G  G+KGE G+ G  G +G+KG++                  G  G  G PG +GP G RGS GP+G+            KG+ G  GP G IG  G  G +G  G  G  GLPG  G++G  G+   RGL G  GP G MG  G  G +G  G  G  G  G  G  G++G  G  G RG  G+ G+ G Q      G+PG +G PGE GEKG+ G+PG  G  G SG  G+ G  GI+G+PG  G  G +G+KG  GP GEVG  G PG  G  GP+G +G  G  G  G  G  G  G  G +G QG  GP+G PGP    G PG+                    GE G+PG  GY G++G  G  G  G  GP G+PG  G+QGL G  G +G KG +G  GP G  G  G QG  GP+GI            PGKIG  GK         PG  G  G PG PG+ G  G  G  G++G  G QG  G+ GI+G  G RG  G+ G  G  GL   PGE G++GL G  G  G  G  GD G +G  GP G +G +G     G +G+ G  G  G  GE G                          K +DI   +   +      Q   M+S  + +V +I ++          +F  L  L  L+      LG+++NP+R CKD+ +   + ++ G +WIDPN+G  SD++   C FS    +TC+P                                 ++ K+ F     Q+ FL  L S+A   I + C  +  +  +        I  + +N +    +            LLE ++  DDC  +  +   A      ++   LP+I++  Q   +      YY D  SVCF
Sbjct:  583 EQGIPGFAGNIGS------PGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQMDINAAIQALIESNTALQ---MESYQNTEVTLIDHS--------EEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDL-LNCEQKVSDGKYWIDPNLGCPSDAIEVFCNFSAGG-QTCLPP-------------------------------VSVTKLEFGVGKVQMNFLHLLSSEATHIITIHCLNTPRWTSTQTSGPGLPIGFKGWNGQIFKVN-----------TLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEV--QKLPHLKTERKYYIDSSSVCF 1713          

HSP 2 Score: 258.455 bits (659), Expect = 1.052e-68
Identity = 326/805 (40.50%), Postives = 412/805 (51.18%), Query Frame = 3
Query: 1842 GPKGFIGYVGKEGARGVQGEKGPRGITGLT---------GLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG---------DFGIMGFPGPRGPTGL---------------RGSSGPEGIKGELG------------NDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGT---KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE------KGSQGPVGEVGILGKPGL---GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---PGPHGLPGDKGISGEVGDP---GPIGYPGNIGRQGAPGLVGVTGPIGKPGK------VGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKP-------XXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            GP+G  G  G  G  G+ G KGP+G  G +         G +G+ G  GP G +G +GL G  G  G PG +G  G  G IG PG+    G++G +G +G+ GP G  G IG+ G  G  G  G  G+ G+ GK+G KG  G PG  G+ G  GL G  G++G  G  G     G+ G  GP GP GP G  G +GL G  G  G+KG  G +G  G++GE G+PG  G +GL G PG +G+ G  G+ G  G +G  G         D GI G  GP GP GL               +G  GP G  GELG              GP G  G VG +G+ G +G  G +GLPGE+G  G+   KG+RG PG  GP G  G  G  G  G+ G  G LGL GH G +G  G  G +G RG++G DG +G QG+ G++G  G+QG++G HG+    GKTG  G RG  G+PG+ GLPG +G+ G  GE      +G  GP GE+G+ G PG     G QG  G KG  G  G  G  G PG +G  G  GE+G  G +G    PG  GLPG+ G  GE+G P   GP+G  G  G  G  G+VG+ G  G+PGK      +G  G +G  G  G+ G  G  G  G  G VG  G  GP G PG  G +G  G  G  GLPG               G  G +G  G  G QG +GE G  G  G  G+ G  G TG++G PGE G +G QG+ G+RG  G  G +G  G  G PG  G QG  G KG++G  G  G  G PG I
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGY---PGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPG---FPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGL---IGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKI 1308          

HSP 3 Score: 233.417 bits (594), Expect = 5.151e-61
Identity = 315/808 (38.99%), Postives = 384/808 (47.52%), Query Frame = 3
Query: 1341 FRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLR---GVDGETGPIGAEGIRGLDGP---KGQIGFPGPEGASGKEGEIGP---------------PGFIGDE---GKRGFSGEKGDSGPVGLIGP---IGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEI---GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL---RGLPGDKGE------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIR---------GHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXX-------HNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---------------------TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP------------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVG 3500
             RG  G +G  G  G  GP GL G+ G PG KG                              D+G+ G  G  GE G PG +G  G+ G  G  G+ G  G  G+ G  GP GP GP G PG  G  G+ G  G  G++G  G  G  G+KG QGE G IG  G LGP+      GK G +G  GE GP G+ G  G +   G  GETGP+G  G  G+ G    KG+ G PGP G  G++G +G                PG +G     G +G  G++G  GP GL+G     GA G +G  G  GP GL G  G  GE+G  G PG +G PG     GL G+ G+ G  G+ GP G++GM+G  G  G  G QG+ G  G  G  G  G  G  GLRGEPG  GE G  G  GL G+   RGLPG+ GE      PG  G  G+ G  GL G  GI+G PG RG  G +G  G  G  GE+G+ GP G IG  G +         GH G +GPDG  G+PG  G +G  G  GLPG KG  G  G                              G KG++G+PGL+G  G QG  G+ G QG  G +G  G +G KG  G PGPSGK G+ G++G+                      G PG  GLPG  G  G  G  G+ GP G  G  G PG  G QGP+G             +G  G +GDQG  G PG +G  G  G QG  G  G+PGP G  GD GI G  G  GPIG+ GN G  G  G++G TG  G  G+ G
Sbjct:  682 LRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKG------------------------------DKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPR------GKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKG 1453          

HSP 4 Score: 203.756 bits (517), Expect = 7.320e-52
Identity = 258/700 (36.86%), Postives = 324/700 (46.29%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI-------GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI---GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD 3269
            +G IG KGE+G  GP G  G+ G +G  G  GV GP+      G+ G RGP G+ G +G  G +GP GL+G  G  G KGE+G                           D+GK GP G  G+ G PG +G  G  GL G  G  G +G  GE G  G                                           QG+ G  G  G  GP G  G  G +G  G +G+ G  G  G TG  G+ GE G  G EG++G DG KG  G  G  G  G++GE+G PG IG  G+   SG+ G  GP G++G  G  G  G  G  G IG  G +G  G  G IG  GP+G  G  G  G +G++G DG  G  G  G  G  GP+G  GP+G+ G  G    +       G  G  G  G RGEPG  G  G  G  GL G  G  G  GEPG  GE+G +G++G  G+ G  G PGP G  G+       G++G LG  G  G+ G+ GI G+ G +GP G  GLPG     G  G  G  G PG+KG SGL GS                              PG+QGP+G QG  G  G QG  G +G+ G+QG  GD G+ G  G+ G+ G+ G  G PG  G  G +G  G  G KG  G  G  G LG+ G+ G  G  GP+G+ GF G+
Sbjct:  866 TGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKG---------------------------DQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGL------------------------------------------QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGR---SGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGI------PGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGS------------------------------PGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          

HSP 5 Score: 182.57 bits (462), Expect = 2.491e-45
Identity = 236/569 (41.48%), Postives = 299/569 (52.55%), Query Frame = 3
Query: 2352 RGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLP---GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL---PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGK------PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            RGP G  GP G+ G  GL G  GP G  G    +  PG+ G+ G  G  G  G++G  G KG PG  G  G++G  G  G+ G  G+PG +G  G  G+ GP+G +         GFIGS    G  G LGP+G  G+PG  G+KG KG++G P   G +GP+GL GSPG  G  G  G PG+         +G++G  G  GP G  G  G  G +G+PG +G  GEQG  G+ G PG  G  G     G+ G PG+ G  G SG+TG  G +G  GP G  G  G  G+ G  GP GPKG  G  G  G  G+ G QG +G  G  G +GP G PG  G    PG +G+ GEVGD G IG  G  G  G PG VG+TG IG+      PG +G QG  G  G  G  G+ G  GP+GL G VG++G  G +G  G+ G++G  GL+G  G                        IQG KGE G +G  GP G+ G+ G  G+ G  G+ G++GL G  G RG PG PG RG  G +GPPG +G +G PG +G  G  G PG  G+ G
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQ---------GFIGSP---GEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---------RGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAV---GLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQG------------------------IQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVG 1032          

HSP 6 Score: 68.9366 bits (167), Expect = 1.080e-10
Identity = 120/311 (38.59%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM-------------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE 2108
            + GH G+ G  G  GP G  G  G+                          G  G++G  G  G+RG TG+QGPPG  G  G  G KGERG                          G++GK G  G  G+ G PG+QGL G KG+ G  G  G  G  G+ G  G  G  G  G PG  G  G  G PG  G  G PG  G++G KG+QG PG  G  G  G +G  G  G  G  G++G+ G  G+ GLTG +G  G  GP G  GI G+ GPKG IG  G  G  G+EG IGP G  G  G++GF GE
Sbjct: 1171 YRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERG------------------------SEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 288.5 bits (737), Expect = 1.626e-78
Identity = 433/1365 (31.72%), Postives = 564/1365 (41.32%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGP---------KGQIGFPGPEGASGKEGEIG---------PPGFIGDEGKRGFSGEKG---------------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKG---------------------EPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE---------------------KGDHGIPGPSGKTGLSG---------------------IRGITGRPGILGLPGFSGET---------------------GYQGEKGSQGPVG---EVGILGKPGLGGYQGPRG---------PKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLK-SQNESEWWLSKLKDQNGK---TLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            H G  GR GE+G  GP G  G  G              G  GF+G RG+ G+ G  G+ G PG+ G  G+PG  G  G T                              G RG  GE G+ G  G  G +G  G VG  G  G IG                                      G  G  G  G +GE G +GN G  GP G  G VG  G  G  G  G  G  GLTG +G  G  G  GA G+   RG+ GP         +G +G PGP G+ G+ G  G         PPG  G+EGKRG +GE G                 G  G  G  G +G  GS GA GP G++G  G  G  G  G  GPRG      L G  G IG  G  GP G  G+DG  GP GP G +G+ G IG  G  GP+G  G  G +G  G  G  G PG  G  G +G PG +G                       G  GE G+ G++GL G+FG+   PGP GP   RG  GP G  G  G  GP+G  G  G  G  GN G  G +G    +G  G  G  GLPG +G +G+ G  G +G  G++G+ G  G  G  G  G +G PG  G  G++G  G  G  G  G +GSPGE+GE                     KG+ G  GP G+ G+ G                      RG  G PG+ G PG +G T                     G +G +G QGPVG   EVG +G PG  G +GP G           G  G  G  G  G+PG +G +GL G  G +G    PGP G+ G  G  G    VG PG  G PG  GR G PG  G  G  G+PG  G++G  G                IG  G  G+ G +GP G  GK G +G+ G  G +G  G                       G +G +G +G+ G +G  GE G  G  GL G  G++GL G+ G  GD G PG  G  G  GP G  GP G+ G  G  G +G  G  G  G               P  V     D     D      P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+   +SG++WIDPN G   D++   C FS  E  TCI AQ  +   P   + + S+++   WL +  +   +    ++ +T     +Q+ F++ L + A Q I   C+ S+ Y D    N + A+ ++  ND +L +  + R             + D C ++        I         LP +DI   D G  DQ        VCF
Sbjct:  144 HPGKPGRPGERGVVGPQGARGFPGTP------------GLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQT------------------------------GARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGS------------------------------------AGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRG------LPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGL---PGPAGP---RGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGA---VGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVG---EPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGN---------------IGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAG---------------------AVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGE--TCIRAQPEN--IPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSR--------FTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1363          

HSP 2 Score: 155.992 bits (393), Expect = 2.123e-37
Identity = 252/609 (41.38%), Postives = 294/609 (48.28%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG---LDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEG---------KRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL------------QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGD------KGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKF------GVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDP---------GPIGYPGNIGRQGAPGLVGVTGPIGKPG 3491
            + GEPG  G  GA GP G  G  G++G  G  G  G RG+ G  G RG  G  G  G +GIRG   LDG KGQ G PG +G  G  GE G PG  G  G           G +G +G  G VG +GP G IGS G  G PG  G +G IG  G  G  G  GPRGE G  GL             G  G  G  G  G  G  G+ G RG  GP G  G  G  GL GE GP+G KG  G +GEPG  G  G PG  G  G RG  G+       G PG  G  G RG  G  G  G+M      GP G RG+SGP G++G  G+          G  G  G +GP G  G PG IG  G +G  GLPGI G  G +G  G                    G+ GNIG PG +GP G+ G +GD G  G+ G++G+PG  G  G  G PGP G  G  G +G  G PG  GLPG SG  G  G+ G +G  GE G+   PG  G +G RGP G++G  G  G        G PGP G KG  G  G +G  G  GP GLPG++G +G  G           G IG PG  G +GAPG VG  GP G  G
Sbjct:  117 EPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVM------GPPGSRGASGPAGVRGPNGD---------AGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGA------------------RGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGL---PGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATG 689          

HSP 3 Score: 103.605 bits (257), Expect = 2.366e-21
Identity = 219/637 (34.38%), Postives = 270/637 (42.39%), Query Frame = 3
Query: 2427 GLKGSMGLRGEPGQIGESGFPGFYGLL---------------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------------GEQGEKGDHGIPGPSGKTGLSGI------------RGITGRPGILGLPGFSGETGYQGEKGSQGPV------GEVGILGKPGLGGY------------------------QGPRGPKGQT------------------GFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQG------------VNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGL---------KGVKGELGLPGQDG 4013
            GL G+   + +   +G    PG  GL+               G +G  G+ GEPG  G  G RG  G  G  G  G PG  G  G RG  GP+G +G  G  G  GF    GIRGH G  G  G  G PG  GE G  G+ G PG  G  GL                         G++G +G PG  G RG+ GS G VG  G  GS G P            G  G  G  G  GP G+ GL G+             G+TG  G  GLPG +G  G  G +G  GPV      G  G++G+PG  G                         +G RGP G+                   G  G  G+ GV GP G++G  G  G  GPNG     G PG+ G+ G  G P   G PGNIG  G  G VG+ G  G+PG +G  G  G  G  G  G +G +G  G +G  G  G  G RG PG  G  G  G  G  G+ G  G  G  G  G +G+ G SG  G  G+ G RGL G  G+ G AG  G+ G PGE G  G  G             +G +G+PG+ G  G  G  GP G  G +G  G+          G++GE+G PG+DG
Sbjct:   70 GLGGNFAAQYDGKGVGLG--PGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGF---KGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLP------------------------GERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGD---AGRPGEPGLMGPRGLP---GSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDG 671          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 288.115 bits (736), Expect = 2.068e-78
Identity = 433/1365 (31.72%), Postives = 564/1365 (41.32%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGP---------KGQIGFPGPEGASGKEGEIG---------PPGFIGDEGKRGFSGEKG---------------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKG---------------------EPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE---------------------KGDHGIPGPSGKTGLSG---------------------IRGITGRPGILGLPGFSGET---------------------GYQGEKGSQGPVG---EVGILGKPGLGGYQGPRG---------PKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLK-SQNESEWWLSKLKDQNGK---TLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            H G  GR GE+G  GP G  G  G              G  GF+G RG+ G+ G  G+ G PG+ G  G+PG  G  G T                              G RG  GE G+ G  G  G +G  G VG  G  G IG                                      G  G  G  G +GE G +GN G  GP G  G VG  G  G  G  G  G  GLTG +G  G  G  GA G+   RG+ GP         +G +G PGP G+ G+ G  G         PPG  G+EGKRG +GE G                 G  G  G  G +G  GS GA GP G++G  G  G  G  G  GPRG      L G  G IG  G  GP G  G+DG  GP GP G +G+ G IG  G  GP+G  G  G +G  G  G  G PG  G  G +G PG +G                       G  GE G+ G++GL G+FG+   PGP GP   RG  GP G  G  G  GP+G  G  G  G  GN G  G +G    +G  G  G  GLPG +G +G+ G  G +G  G++G+ G  G  G  G  G +G PG  G  G++G  G  G  G  G +GSPGE+GE                     KG+ G  GP G+ G+ G                      RG  G PG+ G PG +G T                     G +G +G QGPVG   EVG +G PG  G +GP G           G  G  G  G  G+PG +G +GL G  G +G    PGP G+ G  G  G    VG PG  G PG  GR G PG  G  G  G+PG  G++G  G                IG  G  G+ G +GP G  GK G +G+ G  G +G  G                       G +G +G +G+ G +G  GE G  G  GL G  G++GL G+ G  GD G PG  G  G  GP G  GP G+ G  G  G +G  G  G  G               P  V     D     D      P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+   +SG++WIDPN G   D++   C FS  E  TCI AQ  +   P   + + S+++   WL +  +   +    ++ +T     +Q+ F++ L + A Q I   C+ S+ Y D    N + A+ ++  ND +L +  + R             + D C ++        I         LP +DI   D G  DQ        VCF
Sbjct:  146 HPGKPGRPGERGVVGPQGARGFPGTP------------GLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQT------------------------------GARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGS------------------------------------AGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRG------LPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGL---PGPAGP---RGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGA---VGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVG---EPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGN---------------IGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAG---------------------AVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGE--TCIRAQPEN--IPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSR--------FTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365          

HSP 2 Score: 155.992 bits (393), Expect = 2.218e-37
Identity = 252/609 (41.38%), Postives = 294/609 (48.28%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG---LDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEG---------KRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL------------QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGD------KGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKF------GVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDP---------GPIGYPGNIGRQGAPGLVGVTGPIGKPG 3491
            + GEPG  G  GA GP G  G  G++G  G  G  G RG+ G  G RG  G  G  G +GIRG   LDG KGQ G PG +G  G  GE G PG  G  G           G +G +G  G VG +GP G IGS G  G PG  G +G IG  G  G  G  GPRGE G  GL             G  G  G  G  G  G  G+ G RG  GP G  G  G  GL GE GP+G KG  G +GEPG  G  G PG  G  G RG  G+       G PG  G  G RG  G  G  G+M      GP G RG+SGP G++G  G+          G  G  G +GP G  G PG IG  G +G  GLPGI G  G +G  G                    G+ GNIG PG +GP G+ G +GD G  G+ G++G+PG  G  G  G PGP G  G  G +G  G PG  GLPG SG  G  G+ G +G  GE G+   PG  G +G RGP G++G  G  G        G PGP G KG  G  G +G  G  GP GLPG++G +G  G           G IG PG  G +GAPG VG  GP G  G
Sbjct:  119 EPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVM------GPPGSRGASGPAGVRGPNGD---------AGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGA------------------RGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGL---PGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATG 691          

HSP 3 Score: 103.219 bits (256), Expect = 2.926e-21
Identity = 219/637 (34.38%), Postives = 270/637 (42.39%), Query Frame = 3
Query: 2427 GLKGSMGLRGEPGQIGESGFPGFYGLL---------------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------------GEQGEKGDHGIPGPSGKTGLSGI------------RGITGRPGILGLPGFSGETGYQGEKGSQGPV------GEVGILGKPGLGGY------------------------QGPRGPKGQT------------------GFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQG------------VNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGL---------KGVKGELGLPGQDG 4013
            GL G+   + +   +G    PG  GL+               G +G  G+ GEPG  G  G RG  G  G  G  G PG  G  G RG  GP+G +G  G  G  GF    GIRGH G  G  G  G PG  GE G  G+ G PG  G  GL                         G++G +G PG  G RG+ GS G VG  G  GS G P            G  G  G  G  GP G+ GL G+             G+TG  G  GLPG +G  G  G +G  GPV      G  G++G+PG  G                         +G RGP G+                   G  G  G+ GV GP G++G  G  G  GPNG     G PG+ G+ G  G P   G PGNIG  G  G VG+ G  G+PG +G  G  G  G  G  G +G +G  G +G  G  G  G RG PG  G  G  G  G  G+ G  G  G  G  G +G+ G SG  G  G+ G RGL G  G+ G AG  G+ G PGE G  G  G             +G +G+PG+ G  G  G  GP G  G +G  G+          G++GE+G PG+DG
Sbjct:   72 GLGGNFAAQYDGKGVGLG--PGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGF---KGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLP------------------------GERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGD---AGRPGEPGLMGPRGLP---GSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDG 673          

HSP 4 Score: 68.5514 bits (166), Expect = 1.097e-10
Identity = 155/443 (34.99%), Postives = 181/443 (40.86%), Query Frame = 3
Query: 3027 QGEKGDH----------------------------------------------------GIPGPSGK------TGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGV------------PGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYP------------GNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQ---------GKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGE---------------TGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGS---IGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             GE G                                                      G  GP+G+      TG +G RG  G PG  G  G  G+ G  GE+G  GP G  G  G PGL G++G RG  G  G +G  G  GV            PG  GA+GL GE+G +   G PGP G  G  G  G VG  GPIG              G IG  G  G  G  GP G+ G  G  G +GP G  G  GL G  G  GL G  G+ G  GPRGIPG +G           G+PG  G  G  G  G  G  G +G  G  GE G +G  GE                G RGL G  G +G  G  G  G  G  G++G  G  G+ G+PGL G RG  GS   IGP G+ GP G PG+ G  G +G  G  GEPG I
Sbjct:   53 DGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRV---GAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNI 492          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL27A1 (collagen type XXVII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:22986])

HSP 1 Score: 259.225 bits (661), Expect = 6.242e-69
Identity = 398/1231 (32.33%), Postives = 512/1231 (41.59%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---FSGEKGDSGPVGLIG---------------PIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI---------------GLQGEIGPSGLKGSMGLRGEP------------------------GQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPR------GPTGLRGSS------------------------------GPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE---------------KGDHGIPGPSGKTGLSGIRGI---------------------TGRPGILGLPGFSGETGYQGE---------------------KGSQGPV---GEVGILGKPGLGGYQGPRG------------PKGQTGFE----------------------GDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGK------------VGKQXXXXXXXXXXXXXXXXXXXP---------IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPG---------QDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNR---LFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDST-RKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDI 4829
            D G PG  GN G  G KG  GY G  G  G QG+ GP G  G  G  G  G  GP+G  G +G    +G IG PG  G  G +GE G PG  G  GK G   F G  G+ GP GL G                IG +G  G  G PGP G++GL+G      ++G PG +G+ GE G+ G  G  G  G+ G QG  G  G RG  GP G  GD G I               G  G+ GP G+KG  G RG P                        GQ G  GFPG  GL G++G PGD G PG  GE+G  G  GL+G+ GI+G  G R      G  G +GS                               G +G +G  G DGP G  GS G++G  G  G  G  G  G  GE+G  G RG PGI GPSG  G+ G  G  G QG  G +G  G  G KG  G  G  G  G  G  GD+G  G PG QG  G++GE               KGD G PGP G+ G  G  G+                     +G+ G  G  G  G  GYQG+                     +GS GP    G +G  G+PGL GY G +G             KG+ G +                      G+ G  G PG +G +GL+G+ G  G  G+PGP G PG KG  G  G  G  G  G  GR+G  GL G+ GP G  G+             G+ G  G +G++G+ G  G  GP          GL G  G  G+ G  G+PG++G  GK G  GR GLPG                      QG  G  G  G  G  G  G AG+ G +G PG++G KG+Q   G RG PGL    GK G +GP G +GP G PG KG KG  G  G           G PG        + + Q       +   D      P+    P+ +     VL++   +F  L  L  L+      LG+KENP+R C+D+ M+  + +  G +W+DPN+G  SD++   C F+    +TC+        KP+                       T  K+ F  +  Q+ FL  L S+  Q I + C    V+ + T +   + A++ RA+N +            EAG         D C  +         T   +D + LPII +
Sbjct:  692 DMGLPGLSGNPGPPGRKGHKGYPGPAGHPGEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGS---RGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMG------SVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVGEKGDRGMMGPPGVPGPKGSMGHPGMPGGMGTPGEPGPQGPPGSRGPPGMRGAKGRRGPRGPDGPAGEQGSRGLKGPPGPQGRPGRPGQQGVAGERGHLGSRGFPGIPGPSGPPGTKGLPGEPGPQGPQGPIGPPGEMGPKGPPGAVGEPGLPGEAGMKGDLGPLGTPGEQGLIGQRGEPGLEGDSGPMGPDGLKGDRGDPGPDGEHGEKGQEGLMGEDGPPGPPGVTGVRGPEGKSGKQGEKGRTGAKGAKGYQGQLGEMGVPGDPGPPGTPGPKGSRGSLGPTGAPGRMGAQGEPGLAGYDGHKGIVGPLGPPGPKGEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGKPGQQGQPGHPGPRGWPGPKGSKGAEGPKGKQGKAGAPGRRGVQGLQGLPGPRGVVGRQGLEGIAGPDGLPGRDGQAGQQGEQGDDGDPGPMGPAGKRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGRTGLPGN---------------------QGEPGSKGQPGDSGEMGFPGMAGLFGPKGPPGDIGFKGIQ---GPRGPPGL---MGKEGIVGPLGILGPSGLPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAFQTWMDTSGALRPESYSYPDRL-----VLDQGGEIFKTLHYLSNLIQSIKTPLGTKENPARVCRDL-MDCEQKMVDGTYWVDPNLGCSSDTIEVSCNFTHGG-QTCL--------KPI-----------------------TASKVEFAISRVQMNFLHLLSSEVTQHITIHCLNMTVWQEGTGQTPAKQAVRFRAWNGQIF----------EAGGQFRPEVSMDGCKVQDGRWHQTLFTFRTQDPQQLPIISV 1838          

HSP 2 Score: 120.553 bits (301), Expect = 1.752e-26
Identity = 208/618 (33.66%), Postives = 272/618 (44.01%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGE------QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGIT---------------GLTGLRGVDGETGPIGAEGIRGLDGPKGQI------------------GFPGPEGASGKEGEIGPPGFIGDEGKRGF---------SGEKGDSGPVGLIGPI-------------GAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ 2993
            P G  G  G +G+ G++G  G        G  G+ G  G  G +G  G+ G  G  G  G  G PGP+GP G  G  G++GP+G  G +G+PG+ G  GMKG +G +G  G +G IG+                                                +GEPG  G++G +GP G  G  G  G  G  GEKG  G+                G  G  G  GE G  GA+G +G  G  G++                  G  GP GA G+ G  G PG  G +G +G           GEKG+ G  G                  G  G  G  G PG  G+QGL GK G++G  G+PGPRG PG  G +G  G  G+ G +G  G  G+ G +G  GP+   G +G+ GL+G  GP GL G  G  G+ G+ G+ G PG  G  G RG PG  G PG  G  G +G+ GL G  G  G  G  G TGL G+ G  G KG+ G+ G +GF G  G+ G +G          PG+IG KG +G RG PG+ G  G++G                          G +G  GL GP+G++GS GD G Q
Sbjct: 1067 PRGPDGPAGEQGSRGLKGPPGPQGRPGRPGQQGVAGERGHLGSRGFPGIPGPSGPPGTKGLPGEPGPQGPQGPIGPPGEMGPKGPPGAVGEPGLPGEAGMKGDLGPLGTPGEQGLIGQ------------------------------------------------RGEPGLEGDSGPMGPDGLKGDRGDPGPDGEHGEKGQEGLMGEDGPPGPPGVTGVRGPEGKSGKQGEKGRTGAKGAKGYQGQLGEMGVPGDPGPPGTPGPKGSRGSLGPTGAPGRMGAQGEPGLAGYDGHKGIVGPLGPPGPKGEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGKPGQQGQPGHPGPRGWPGPKGSKGAEGPKGKQGKAGAPGRRGVQGLQGLPGPR---GVVGRQGLEGIAGPDGLPGRDGQAGQQGEQGDDGDPGPMGPAGKRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGRTGLPGNQGEPGSKGQPGDSGEMGFPGMAGLFGPKGP---------PGDIGFKGIQGPRGPPGLMGKEGIVGPL------------------------GILGPSGLPGPKGDKGSRGDWGLQ 1600          

HSP 3 Score: 114.005 bits (284), Expect = 1.895e-24
Identity = 132/369 (35.77%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 2274 GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPG---PRGPTGLRGSSGPEGIK---------GELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGM------------------PGSQGSPGEQGEKGDHGIPGPSGKTGLSG------------IRGITGRPGILGLPGFSGETGYQGEKGSQGPVGE------VGILGKPGLGGYQGPR 3236
            G +G +G+ G  GN GP G  G  G  GPAG           G QG+ GP G  G+ G  G  G  G  G PG  G  G  GLPG  G PG+DGE G  G  G  G  G+ GFPG    RGP GL G+ G  G+          G+LG  GP+G+ G  G++G  G++         GE G KG KG++G+PG+ G  G                          GDKG+ GLPG  G RG  G  G VG +G                   PG  G  G +G+ G  G+PGP G+ G  G            + G  GR G  G PG  G  G  G+ G  GPVGE      +G++G+PG+ G +G R
Sbjct:  688 GAKGDMGLPGLSGNPGPPGRKGHKGYPGPAG---------HPGEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSV---------GEPGLKGDKGEQGVPGVSGDPGF------------------------QGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVGEKGDR 1014          

HSP 4 Score: 113.62 bits (283), Expect = 2.320e-24
Identity = 159/377 (42.18%), Postives = 189/377 (50.13%), Query Frame = 3
Query: 2055 IGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIM---GFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLP---GLQGPRGNQGSDGD---------------VGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILG 3122
             GPPG  G+ G  G  G KG  G  GL       G++G  G P   GL G  G  G KG  G PGP G PGE   QGQ G    +G+ G +G  G  G  GP G  GP+G  G IGL G  G  G  G  GL G PG+ G+ G PGF G+ G RG PG  G PG  G  G  G  GL+GD G++   G+PGP+G  GL GS G  G+KG+ G  G  G  G  G +G +G+ G  G+             G RG PG  G  G  GS G  G  G +G PG +G  G NG +G  G P   GL GPRG  G +GD                GR+G PG  G  G +GE GD G PGP G+ G  G  G+ G PGI+G
Sbjct:  654 RGPPGPYGNPGLPGPPGAKGQKGDPGLSPGKAHDGAKGDMGLP---GLSGNPGPPGRKGHKGYPGPAGHPGE---QGQPGP---EGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGF------------PGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVG 1009          

HSP 5 Score: 103.99 bits (258), Expect = 1.929e-21
Identity = 135/317 (42.59%), Postives = 170/317 (53.63%), Query Frame = 3
Query: 1911 RGITGLTGLRGVDGETGPIGAEGIRGLDGP---KGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPG---QIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT------GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKG 2825
            +G  GL+  +  DG  G +G  G+ G  GP   KG  G+PGP G  G++G+ GP          G  G KG  G  GL GP+G  G +GS G  G  GL GL G +GE+G  G PG RG+   +G+ G  G+ G  G  G  G+ G  G  GP G  G  GD+G +G  G  GP G+KG MG  GEPG     GE G PG  G  G +G  G +G PG  G  G+ G  G +GD G +GFPGP GP       G  G +GPEG+KG+ G  G  G  G +G  G +G +GP G  GL G+ G KG  G+ GL G+KG
Sbjct:  675 KGDPGLSPGKAHDGAKGDMGLPGLSGNPGPPGRKGHKGYPGPAGHPGEQGQPGP---------EGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGK---MGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKG 979          

HSP 6 Score: 103.605 bits (257), Expect = 2.636e-21
Identity = 219/589 (37.18%), Postives = 267/589 (45.33%), Query Frame = 3
Query: 1218 SGHIGRKGEK------------------GQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEG------------ARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEG----------------------EIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGA---IGNPGPRGEPGEIGLQGQV---GIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGL 2810
            +G  G +G K                  G++G  G  G  G  G  G  G  G  G  G +GP+G IG  G  G +GPPG +G  G PG  G +G                           D G +G  G QG IG+ G  GL G  G +G  G KG +G  G D                  G  G+KG  G  G  G PG  GV G++G +G+ G  G  G  G KG  GY G+ G              G +G +G  G TG  G  G  GE G  G +G +G+ GP G  G  G +G  G++G                      E G PG+ G EG +G  G+ G  G  G  GP G  G +GS GA GP G QG  G  G +G     G PGPRG  G  GL+G     G+ GRDG +G QG+ G DGD GP GP G +G+ G  GL G  GP G KG  GL   PGQ+G    PG  G  G  GLPG++GEPG+ G+          GD G MGFPG  G  G +G  G  G KG  G  GP G +G  GI G  G LGP    GLPG  G+KG++G  GL
Sbjct: 1074 AGEQGSRGLKGPPGPQGRPGRPGQQGVAGERGHLGSRGFPGIPGPSGPPGTKGLPGEPGPQGPQGPIGPPGEMGPKGPPGAVGEPGLPGEAGMKG---------------------------DLGPLGTPGEQGLIGQRGEPGLEGDSGPMGPDGLKGDRGDPGPD------------------GEHGEKGQEGLMGEDGPPGPPGVTGVRGPEGKSGKQGEKGRTGAKGAKGYQGQLGEMGVPGDPGPPGTPGPKGSRGSLGPTGAPGRMGAQGEPGLAGYDGHKGIVGPLGPPGPKGEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGKPGQQGQPGHPGPRGWPGPKGSKGAEGPKGKQGKAGAPGRRGVQGLQGLPGPRGVVGRQGLEGIAGPDGLPGRDGQAGQQGEQGDDGDPGPMGPAGKRGNPGVAGLPGAQGPPGFKGESGL---PGQLGP---PGKRGTEGRTGLPGNQGEPGSKGQP---------GDSGEMGFPGMAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIVGPLGILGPS---GLPGPKGDKGSRGDWGL 1599          

HSP 7 Score: 102.449 bits (254), Expect = 6.444e-21
Identity = 129/340 (37.94%), Postives = 175/340 (51.47%), Query Frame = 3
Query: 2622 RGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEK---------GDHGIPGP---SGKTGLSGIRGITGRPGI------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP------------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGP---------------NGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            +G  GL      +G KG++G  G  G  G  G +GH+G  GP G+ G  G+ G +G+ G +G PG +G  G +G PG +G++G  G PG+ GL G +G++G  G+PG +G  G  G  G  G +G PG  G+PGE G           GD G+ GP    G  G+ G+ G  G PG+       G+PG SG+ G+QG+KGSQG  G  G  GKPG  G  G +G              G  G  GD G  G+ G  GA+GL G +G +GP                G PG  G PG  G+ G  G+PG  G PG +G QG  G +G+   +G+PG VG++
Sbjct:  675 KGDPGLSPGKAHDGAKGDMGLPGLSGNPGPPGRKGHKGYPGPAGHPGEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGL---VGEPGIVGEK 1011          

HSP 8 Score: 93.5893 bits (231), Expect = 2.839e-18
Identity = 163/404 (40.35%), Postives = 204/404 (50.50%), Query Frame = 3
Query: 2922 GNIGLPGLQGPRGNQGSDGDVGRQGMPGS------------------------------QGSPG------EQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGK---PXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK---------EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGE 3989
            G+   P L GP G +G  G  G  G+PG                               +G PG        G KGD G+P      GLSG  G  GR G  G PG +G  G QG+ G +G  G  G  G+ GL G  G  GPKG  G+ G  G FG+PG  G +GL G  G  G  G PG  G+ G++G  G  G+PG +G PG  G  G  G +GV GPIG PG  G +GLMG  G+ G KG +G  G  G+SG  G QG  G +G+PG  G +GKPG +G++G  G    PG  G EG  G+ G  G++G +G KG+ G RGL GPRG  G  G  G          EG PG  G  G  G++G +G+PG PG  G +G  G  G +G  GEPG+ G KG+
Sbjct:  616 GSTPFPLLMGPPGPKGDCGLPGPPGLPGLPGIPGARGPRGPPGPYGNPGLPGPPGAKGQKGDPGLSPGKAHDGAKGDMGLP------GLSGNPGPPGRKGHKGYPGPAGHPGEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVGEKGD 1013          

HSP 9 Score: 88.9669 bits (219), Expect = 8.775e-17
Identity = 125/328 (38.11%), Postives = 154/328 (46.95%), Query Frame = 3
Query: 3183 GEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGP------------IGYPGNIGRQGAPGLVGVTGPIGKP------GKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGL------------------PGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP---------------PGRVGPQGEPGLKGVKGELGLPGQDG 4013
            G  G +G PGL G  GP G KG  G+         PGP G  G   EQG  GP G PG  G PG +G+ G VGDPGP             G PG+ G +G PG+ G  G +G P      G+ G  GL G  G+ G  G  G+ G IG  G +G  GY GP+G+ G +G+ G+PGL G  G  G P            G+ G+ G QG+KG  G+ G  G RG  G  G  G +G                   PG+ G +G++G  G R   GLPG RG++G  G                PGR G  G PGL GVKGE G PG+ G
Sbjct:  688 GAKGDMGLPGLSGNPGPPGRKGHKGY---------PGPAGHPG---EQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVP------------GVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGAR---GLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPG 988          

HSP 10 Score: 84.3445 bits (207), Expect = 1.779e-15
Identity = 110/286 (38.46%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 3258 FEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGL---------PGELGIKGLQGVNGQRGDPGLPGDRGKIG------------------------SIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
             +G +G  G+PG  G  G  G +G+    GYPGP G PG++G  G  G PG  GYPG   RQG PG VG  GP G  G +G                       GL G  GS G  G  G+PGK G  G PG  G  G  G PG+DG+ G+ G  G  G  G+ G+ G  G  G  GP+GM G  G  G+ GL         PG  G  G QG  G +G PG PG RGK G                         IGPPG  GP+   G+KG  G  GLPG  G+
Sbjct:  686 HDGAKGDMGLPGLSGNPGPPGRKGH---KGYPGPAGHPGEQGQPGPEGSPGAKGYPG---RQGLPGPVGDPGPKGSRGYIGLP---------------------GLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPE---GMKGKPGARGLPGPRGQ 941          

HSP 11 Score: 74.7146 bits (182), Expect = 1.891e-12
Identity = 137/385 (35.58%), Postives = 168/385 (43.64%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGP------EGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIG------AIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGD 2333
            + G  GRKG KG  GP G  G+ G+                   GP G+ G +G  G QG PG +G    PGPKG RG  G                          G  G  G  GE G PGV G  G  G+ G  G  G +G  G D                           GNPG +G PG  GV G+ GD G  G IG  G  G KG +G VG+ G +G +GE+G  G++G  G +G  G  G  G  G RG  GP G++G  G        G  G  G+IGPPG  G EG +G  G +G  GP G +GP G        G+ G  G PG  G  G  G +G KG  G+PG  G  GE G  G +G++G  G  G +GD
Sbjct:  701 NPGPPGRKGHKGYPGPAGHPGEQGQP------------------GPEGSPGAKGYPGRQGLPGPVG---DPGPKGSRGYIGLP------------------------GLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLD---------------------------GNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSIGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLEGQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVGEKGD 1013          

HSP 12 Score: 67.0106 bits (162), Expect = 3.946e-10
Identity = 80/235 (34.04%), Postives = 106/235 (45.11%), Query Frame = 3
Query: 3393 EVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGK---------------IGSIGPPGRVGPQ---------GEPGLKGVKGELGLPGQDGEPGL 4025
            + GDPG      + G +G  GL G++G  G PG+ G +G                    G +G  G QG  GP G PG  G  G+ GL G +G PG                      +G++G  G+ GL G  G  GE G+ G  G  G++G+ G  GV G+RG PGL G+ G+               +G +GP G  GP+         GEPGLKG KGE G+PG  G+PG 
Sbjct:  674 QKGDPGLSPGKAHDGAKGDMGLPGLSGNPGPPGRKGHKGYP------------------GPAGHPGEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGP---------------------KGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMKGLMGSVGEPGLKGDKGEQGVPGVSGDPGF 869          

HSP 13 Score: 62.3882 bits (150), Expect = 1.045e-8
Identity = 109/334 (32.63%), Postives = 142/334 (42.51%), Query Frame = 3
Query: 1266 GLIGDIGKXXXXXXXXXXXPM-------------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKP---GVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAE---GIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKR---GFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQ 2201
            G  G+ G+ G+                       G  G+ G  G  G+RG  G+QG PG  G  G PGPKG +G                                GP+G QG+ G P   GVQGL G+ G  G VG +G +G  G D                              G+ GR G  G +G +GD G+PG +G  G  G  G  G  G +G  G +GE G  G  G  G RG +G TG  G +   G +G  G  G++GFPG  G  G +G  G  GF G +G R   G  G++G  GP+G++GP G  G +G  G+ G  GLQ
Sbjct: 1327 GEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGKPGQQGQPGHPGPRGWPGPKGSKGAE------------------------------GPKGKQGKAGAPGRRGVQGLQGLPGPRGVVGRQGLEGIAGPD------------------------------GLPGRDGQAGQQGEQGDDGDPGPMGPAGKRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGRTGLPGNQGEPGSKGQPGDSGEMGFPGMAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIVGPLGILGPSGLPGPKGDKGSRGDWGLQ 1600          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL5A3 (collagen type V alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:14864])

HSP 1 Score: 257.299 bits (656), Expect = 2.727e-68
Identity = 428/1358 (31.52%), Postives = 552/1358 (40.65%), Query Frame = 3
Query: 1335 FGFRGPRGNIGMRGNTGE---QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGA---------------EGIRGLDGPKGQIGFPG------------------PEGASGKEGEIGPPG------------------FIGDEGKRGFSGEKGDSGP---VGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKG---------------------EPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGS------------------------SGPEGIKGELGNDGPLGFIGSVGIR---------------------------------GHQGNLGPDGYIGLPGEIGEK---GTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG------------------AKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGI------------PGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIV---FLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
               +GP G +G+ G  G     G PGL G +G+ GP+G RGL G  G  G  G  G P            G  G RG  G+ G  G +G +G+ GL G+ G++G  G +G+                                                 G PG  G  GA GP G  G  G+ G RG+ G +G  G TG  G+ G+DG  G  G                 G +GL GP+G IG PG                  P G  G EG  G  G                    G  G RG  GEKG+ G     G  G +G  G QG  GAPGP G  G  G +G+ G  G  GP G  GE G  G  G+ G  G  GP+G IG  G  GP G KG  G  G+ GL+GE GP G   S G RG+PG  G+ G  G  G  G  G+PG+KG                     + G  G  GQRG+ G  G  G  G  G  GP G  G                          G EG KGELG  GPLG  G  G+R                                 G +G LGP G IGLPG+ G +   G  GK+G  G +GP G  G  G  G  G  G PG  G  G  GDKG++G PG +G +G++G  G  G+ G+ G  G PG  G  G  G  GP G  G  G  G+ G  G++G PG  G  G  GEKG  G VG +G  G PG  G QGP G +G  G  G  G+ G  G +G                   KG  GE+G  GP+G  GP G  G  G  G  G  GP G PG++G  G PG+ G+ G  G+ G  G  G  GP G  GE G  G  G  G SG +G +G  G +G              G +G +G PG VG  GL G PG  G  G  G  G  G  G  G  G  G++G  GP+G  G  G+ G  G PGE G KG QG+      PG+ G  G  G  GPPG +G  G PG  GV G LG  G  G PG +             P     +   ++         +P  +P +   L  +   L  L   + +  +  G+ E P   C +++  ++  +  G +WIDPN G   DS    C F+    +TC+          L  +  S+ +   W S  +   GK    +    +   +V   FL+ L + A Q    +C+ +  + D    +Y  + +    N  +L  +          T    + +  D        T       +    +LP+ D+   DFG  +Q  G+    VCFS
Sbjct:  475 LSMKGPPGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRP------------GADGARGLPGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQ------------------------------------------------PGPPGEDGERGAEGPPGPTGQAGEPGPRGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGNRGLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGSAGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQPGLEGERGPPG---SRGERGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQRGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGGIGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGDVGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGAVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGREGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGPPGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGEKGDQGL------PGVQGPPGPKGDPGPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGAPAELHGLRRRR----RFVPVPLPVVEGGLEEVLASLTSLSLELEQLRRPPGTAERPGLVCHELH-RNHPHLPDGEYWIDPNQGCARDSFRVFCNFTAGG-ETCLYPDKKFEIVKLASW--SKEKPGGWYSTFR--RGKKFSYVDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEELSFNQ---------TTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFELGPVCFS 1744          

HSP 2 Score: 135.576 bits (340), Expect = 4.463e-31
Identity = 321/958 (33.51%), Postives = 395/958 (41.23%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIG---KXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKG------------------ERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGL------------NGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPI---------------------------------------GAIGSQGSHGAPGPIGLQGLIGKEGE------------------------------KGAIGNPGPRGEPGEIGLQ------------GQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES---------------------------GFPGFYGLLGLRGLPGDKGEPG------------TDGEEGQRGDKGLL---GDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG------------LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ---------------------------------GSPGEQGEKGDH---------------GIPGPSGKTGLSGIRGITGRPGILGLPGF---------------------SGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKG---------------QTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG 3347
            G  GEKGQ+G FG +G  G   + GE+G EG  GP G  G  GPRG +G RG+ G  G PG+ G DG+PG KG                   +GL G QG +G PG  GPPG  G PG+PG  G +G  G +G  G+ G QG              G+KG  G+ G +G KG  GED                                 G PG  G  G+KGDQG+PG  G  G  GP+G  G  G+ G  G  G  G +G  G+ GL G  G  GP G+ G  G  GP G+ G  G  G  G EGE GPPG  G+ G+ G +G+ G  G VG  G                                         G +G QG  G PGP G+ G  GK GE                              KG +G PGP G+ G  GL+            G  G+ G  G  GP G  G  G+RGP GP G  G  G+ G +G +GP+G KGS G RG PG  G+                            G PG  G  G +G  G  G+PG             DG +G+RG  GL    GD G+ GF G  GP GL+G  GP G KGE+G+ G +G  G+ G RG QG  G +G  GLPG +G+ G  G++G             PGI GP G +G  G+ G  G  G PG  G  G +G KG++G  GL G  G  G  G  G  G PG +                                 G  G +GEKG                 G  GP G+ G  G+RGI   PG +G PG                       G+TG +GEKG    +G +G++G PG  G +G +G  G                 G  G  G  GV GP G KG KG  G MGP G
Sbjct:  557 GLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGPRGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGNRGLQGEKGEKGED---------------------------------GFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGSAGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQPGLEGERGPPGSRGERGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQRGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGGIGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGDVGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGAVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGREGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGI---PGPVGEPGLLGAPGQMGPPGPLGPSGLPGLKGDTGPKGEKGH---IGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGDPGPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRG 1475          

HSP 3 Score: 97.0561 bits (240), Expect = 2.671e-19
Identity = 271/712 (38.06%), Postives = 328/712 (46.07%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGN---TGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGL------------------------------NGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGA------LGPKGFIGY---------VGKEGARGVQGEKGPRGITG---------------LTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEG------------ASGKEGEIGPPGFI---GDEGKRGFSGEKGDSGPVGLIGP------IGAIGSQGSHGAPGPIGLQGLIGKEGE---KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPA---GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPG------------------------------FYGLLGLRGLPGDKGEPGTDGEE---------GQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGN 2963
            + G  G KG  G  GP G IG+ GK G+ GQ       G  G RGP G+ G RG    TG+ GP G +G DG+PG  GE+GL G QG  GFPGP GPPG +G  G PG  G+ G  G QG+ G PG  G+                               G++G  G  GE G  G +G++G  G  G  GP G PG  G  G K                     GD+G PG +G  G+      LGP G IG          VG  G +G +GE+GP G TG                 G  G +G+ G +GA G +G  G KG  G PG  G            A G +G  GPPG     GD+G RGF G  G  G  GL GP      +G +GS G HGAPGP G QG  G EG     G +G PG  GE GE G  G  G  G  G  GP+GDIG  GD GP+   GP G +G  G+ G +G +GP+GL G +G  G+PG  G  G PG                                G +G  G  G+KG  G  G +         G RG  G +G  G+ G PGP G  GL G+ G  G  G LG  G  G  G  G +G +G++G  G IG PGE GE   KG +GLPG++GP G  G PG  G  G  G PG  G+ G  G KG+ G PG  GPRG+
Sbjct:  795 YPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQP------GLEGERGPPGSRGERGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQRGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGELGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLK---------------------GDKGPPGPVGANGSPGERGPLGPAGGIGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGDVGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGAVGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGREGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGPPGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGE---KGDQGLPGVQGPPGPKGDPGPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGD 1476          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 229.18 bits (583), Expect = 3.304e-60
Identity = 411/1314 (31.28%), Postives = 540/1314 (41.10%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIG---KPGVQGLNGMKGLVGD-VGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQG-----EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP-VGLIGPIGAIGSQGS------------HGAPG------PIGLQGLIGKEGEKG-----------------------AIGNPGPRGEPGEIGLQGQVGIIGRDG---NSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGP------------------------TGLRGSSGPEGIKGELGNDGPLGFIGSVG------IRGHQGNLGPDGYIGLPGEI---------------GEKGTKGKRG-----LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQG------SDGDVGRQGMPGSQGSPG---EQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG--------------------AKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIG------------YPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVG-----PRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDP-------------DVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWW--------LSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQM 4649
            G  G KGEKG+ GP G  G +G         + GP GY G +G +G++G  G  G++G  G+ G+ G  G +GE+GL                         G  G  G +GG GE G   +PG +G  G +G +G+  GE G  GA G DG  G                                           +G PG  G  G +GP+G +G  G  G  G+ G     EKG RG  G  G  G  G  G  G  G  G DG  G     GP G  G+ G  G PG  GD G  G+SGEKG  G  V  +GP G  G+ G             HG PG       +G  G+ G  GE G                        +G PGP G+ G  GL G  G  GRDG     G  G+ GM+G  G  G  G +G+ G +G+ G+ G  G  G+ G  G PG  GE+G PG  G+ G  G PGD+G PG+ G++G  G  G+ G+ G++GFPG RG                          G  G  G +G+ G  G DG  GF+G  G       RG  G  G   Y G PG++               G  G  G+RG      PG  G SG  G  G  G  G+ G PG  G+ G  G KG  GLPGL G +GN G       +G+ G  G PGS G PG   +QG +G+ G PG  G+ GL G+RG  G+PG+ G  G  G+ GY G  G  G  G+VG  G PG  G  G +G  GQ G  G+ G+ G PG  G                     + + G  G  G +GYPG  GLPG  G++GE G PG  G             PG  G +G PGL G  G  G PG  G  G+ G  G +G+ G  G     G  G  GS GY G RG+PG  G QG+ G  G  G PG+PGI G  GD G  G  G  G+ G  G  G+ G +      P G  GE G  G++G PG  G  GL G  G+ G PG PG  G  G  G  G  G  G+ G +G  G  G PG  G PG             + P R    A+  ++T  P              ++ +  N  + G  L +  + L   + +   +          SR+    ++ +++ +      ++P  G+      + C     E+ T I A  S      +     Q  S  W         +   +  G++L+         + V   E H +       T     +      K +R  +  
Sbjct:  261 GPAGVKGEKGRDGPVGPPGMLG---------LDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGL------------------------GGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGG------------------------------------------KGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD-IQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGY---PGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG------GWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTP---MMNPVTGTAIRPYISRCAVC--EVPTQIIAVHSQD---TSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFRKPMSQ 1481          

HSP 2 Score: 209.92 bits (533), Expect = 3.059e-54
Identity = 322/894 (36.02%), Postives = 406/894 (45.41%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG--------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIG--NPGPRGEP----------------------------GEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGE----------------------EGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGI--------KGELGNDGPLGFIGSVGIRGHQGNLG-----------------------PDGYIGLPGEIGEKGTKGKRGLPGIK----GPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ-----------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGP---NGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLV------------GVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRG--LVGPRGMSGEAG------------------ITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL--IKIIDIQVGM 4055
            +G PG  G  GA G  G +G  G  G RG+ G  G  G+ GL GL G+ GE G     G  G DG  G  G  GP G SG+ G  G PG  G         +G++G  GE G SG  GL G  G  G +G+ G PGP GL G  G  G KG +G    G +GE                             G +G  G  G  GRDG  GP G +G+DG  G  G KG +GD+G  G +G+ G  G+ G+ G +G  G+ G  G PG+ G  G  G PG  G PG +G+                      +G +G KGL G  G+ G  GPRGP G  G+ G  GI        KG+ G DG  GF G  G+ G  G+ G                        DG+ G+PG+IG+ G  G++G PG      GP G  G+PG +G  G+ G PG+ G  G  G +G +G  G+ G  G  G DG  G             G PG  G PG  G+ G  G+PGP G  G  G+ G  G PG  G+   +G+ G  G+ GS+G  G VGI GK G  G  G RG  G  G+ G+ G  G  G  G  G  G+QGY G    +GYPGP G+PG+ G+         +G+PG  G  G  GL             G+ G  G PG+ G  GL                   GL G  G  G+ G  G PG  G +G+PG  G +  PG+PG  G+ G  G  G+ G+ G+ G  GE G  G    G  G+SG+ G                  ITG  GL GE G+ GL G  G  G PG PG  G+ G  G PG  G  G PG +G +GE G PG  GE GL  ++  D Q G+
Sbjct:   69 EGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEG---IPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGM---NGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGL---------VGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGL------------------PGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGL 929          

HSP 3 Score: 195.667 bits (496), Expect = 6.706e-50
Identity = 281/699 (40.20%), Postives = 339/699 (48.50%), Query Frame = 3
Query: 2064 PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKG--SMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIM---------------------GFPGPRGPTG---LRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGL---PGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS-DGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP--------RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGY-------MGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            PG  G+ G  GF GE G  G  G  GP GA G+ G  GA G  G  G  G  G++G  G+P   G PG  GL G  G+ G +G  G  G  G  G  G AGP G  G  G  G  G  GP G  G  S G +G  G+ G SG PG  G  G  GL G KG+PG  G  G  G  GL G  G+                       +P    P     L+G  GP G+KGE G DGP+G  G +G+       GP GY GL    G++G+ G +GKRG  G+ G  G  GS G QG  G  G PG  G  G  G  G  G  G  GP G  G   G+ G  G  G  G  G +G  G  G+PGP G  G  G  G  G+PGI G+PG++ E G +GE G  G  GE G+ G+PG  GY G         +GP G  G  G  G  G+PG  G  G  GE+G+       +GP+GYP   G PG++G+ G  G PG  G PG  G+QG  G  G+ G  G+PG  G  G  G  G  GE G        G  G V   GY GP G  G  G  G  G  GR GLPG PG  G  G  G+ G  G+    G++GE+G+ G+ G +G  G  G  G++G PG  G  G  G NG  G PG PGD+G  GS G  G  GP G PG  G+ G  GL G+ G+ GL
Sbjct:   42 PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSP---GHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLD------GPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYP---GTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-------FGFPGQV---GYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQ---PGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGL 714          

HSP 4 Score: 153.295 bits (386), Expect = 6.235e-37
Identity = 245/649 (37.75%), Postives = 294/649 (45.30%), Query Frame = 3
Query: 2220 GEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGE---PGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGL--LGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLG------------------------------PDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISG--EVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPG----KIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKI 4034
            G KG  GNPG  GEPG  G  GQ    G +G  G  G  G +GD G  G KG +GD G  G  G  G  GL G  GL+GE   PG  G  GFPG  GL G  G  G  G PG  G  G  G+ G+   G  G+ G  G  G  GL G+SG  G+KG  G+ GP G  G  G+ G +G +G                              P     L G +G  G KG++G  G  GP G++G                          G  G PGL   +G +G  GD G++G  G  G PG  GEKG  G      + GL G  G  G  G  G PG+ G  G++G+ G +GP+GE             G  GP G  GF+G QG  G+PG     GL G  G  GP G PG  G PG  G+ G  E GD G  GYPG  G    PGL G  G  G PG+ G  G         +        P G+ G +G  GY G +G PG    K+G  G PG  G     GLPG PG+ G  G +G++G  G +GI G+ GE G+ G  G  G  G  G TG  G PG++G  G    NG  G  GLPG  G  G  G PG  G  GE G+ G  G  G PG  GE GL+ I
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQ---DGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGL------------------------DGPPGYPGL---KGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQG------EQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEG-----------TGEAGPHGAQGFDGVQGGKGLPG---HDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGE---PGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFP-GIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF-GFPGQVGYPG---PNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGI 633          

HSP 5 Score: 135.961 bits (341), Expect = 1.367e-31
Identity = 235/659 (35.66%), Postives = 274/659 (41.58%), Query Frame = 3
Query: 2403 LQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGI---MGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGE-----------KGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------------------------------------------------QGPRGNQGSDGDVGRQ---------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQ-TGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISG--------EVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPG----KIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLV-----------------------GPRGMSGEAGI------TGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK------GVKGELGLPGQDG 4013
             +G   P    G+ G RG PG  GE G PG  G  G  G PG  G  G +G+ G  G KG  GD G+    G PG +G  GL G  G EGI G  G DG  G  G  G  G  G  G  G  GL G  GE           KG  G+ G+PG+ G SG  G                  L G  GD G  GLPG                                                 QGP G  G  G+ GR          G+ G  G PG +G+KGD G  G  GK G  G+ G  G  G  G  G  G  GY G KG     GE G  G+PG  G  GP GP G+ TG  G  G  G  G QG KGL G  G  GP G  GP G PG  G  G        E GD G  GYPG  G    PGL G  G  G PG+ G  G         +        P G+ G +G  GY G +G PG    K+G  G PG  G     GLPG PG+ G  G +G++G  G +GI G+ GE G+ G                         GP G +G AG+       G++GLPG  G  G  G+NGQ G PG PG RG+ G +G  G+ G  G PG +      G  GE G PGQ+G
Sbjct:   32 CKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPG------------------LKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGG---AGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGE---PGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFP-GIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNG 665          

HSP 6 Score: 108.227 bits (269), Expect = 3.997e-23
Identity = 156/433 (36.03%), Postives = 201/433 (46.42%), Query Frame = 3
Query: 2913 GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRG-----PKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISG----------------------------------------EV--GDPGPIGYPGNIGRQ---GAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPG-----DRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            G+ G+ G PG  GP G  G+ G  G +G  G  GS   +G +GD G+PG  G  GL G+ G+ G  G  G+PG +G  G+ G  G  GP G+ G  G PG  G  GP G      +G+ G +G+ G+ GVPG  G  G  G +G     G PGP+GLPG  G+SG                                        EV  G  GP G  G  GR    G PG++G+ GP G PG  G++G +G  G++G++G  G+ G  G  G+ G QG  G  G PG  G  G+PG  GR G  G                  E  +    GE G  G  G  G+ G  G+ G +GLPG +G +G  G  G  G PG+ G     ++G  G  G PG     GEPGL G  G+ G PG+DG PG     DIQ
Sbjct:   55 GEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGS---KGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGA---KGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGD--------------CGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFA---GEPGLPGEPGDCGYPGEDGLPG----YDIQ 460          

HSP 7 Score: 107.842 bits (268), Expect = 4.855e-23
Identity = 146/380 (38.42%), Postives = 164/380 (43.16%), Query Frame = 3
Query: 2934 LPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPG-----PQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXX------XXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP----PGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             PG +G RGN G  G+ G  G PG  G  G  G  G  G  G  G  G  G RG  G PG  G PG  G  G  G KG +G  G  G  G PG+ G  GP G  GQ G  G  G  G PG      QG KG+KGE G  G  G PG  G PG KG     GDPGP G PG  G  G  G +GV     K  K        P                   GP+G +G  G +G  GP G PG +G  G PG  G  G  G                       G+ G+ G RG  G  G  GE G  G++GL G  G  G +G  G+ G PG PG  G  G  GP     G  GP G  G  GV+G  GLPG DG PG +
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAK---GDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGD---------------------LGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPV 396          

HSP 8 Score: 57.3806 bits (137), Expect = 1.116e-7
Identity = 146/368 (39.67%), Postives = 171/368 (46.47%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGK-----EGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIG 2303
              G  G KGE G  G  G  G  G++G           G  G+ G  G  G  GN G  G PGL G  G PG  G  G  G  G +G PG DG PG  G       +   GP G  G+ G PG+ GL G  GL G+ G  G  G  G  G  G  G  G  GE G  G  GK+G  G PG  G PG+ GV G++GD GE    G  GA G  G  GY G+ G  GV G++G  G  G  G  G  G  GP G +G  G DG  G  G PG EG  G          G PG  G  G++G+ G  GD+G  G  G  G  G+ G+ G PGP GL G+ G  G++G  G  G  G PG  G  G  G  G
Sbjct:  923 QDGQPGLKGENGLDGQPGYPGSAGQLGTP---------GDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPG-------QDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGE---DGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 9 Score: 55.8398 bits (133), Expect = 3.543e-7
Identity = 72/170 (42.35%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 3567 IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGL------PGDRGKIGSIGPPGRVGPQGEPGL-----KGVKGEL------GLPGQDGEPGL 4025
            I +      +G   P   PG  G +G PG  G  G PG PG DG EG  G  GM G  G  G+ G  G RG  G  G  G  G+ G +GLPG  G +G+ G NG  G PG+      PG  G+ G+ G PG  GP GE G+     KGVKGE       GLPG  G PGL
Sbjct:   24 IHVDAAAACKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGL 193          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 219.164 bits (557), Expect = 1.002e-59
Identity = 228/574 (39.72%), Postives = 284/574 (49.48%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQG---------------EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEG---ASGKEGEIGPPGFIGDEGKRGFSG------EKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPG---DKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPR--GPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGL 3458
            G+ GA GP G  G  G +GA G +G               EKG +G  G  G +G  GE G  G+ G +G  G KG  G PGP+G   A G +G  G PG  GD+G  G  G       KGD+G  G  G  GA G +G++G PG  G +G  G +G KGA G PG +G+ G  G +G  G  G+ G+ G +G  G  GD+G  G  G +GD G  G  G  G  G  GS G +GE G  G  G  G  G  G  G PG   DKGE GTDG +G  G  G  GD G  G  GP+G  G  G+ G +G KGE G DG  G  G+ G +G +G  G  G  G PG+   KG KG++GL G K                              GDKG  G PG +G +G +G+D      G  G+ G+PG +G+KGD G+ GP G  G  G  G  G  G  G  G  G+ G +GEKG  G  G+ G  G+PG  G +G +  G KGQ G  G +G+ G P   G KG KGE+G +   G PG  G  GDKG  G+ G  G  G PG  G+ G PG 
Sbjct:  112 GDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQ---KGDKGEKGLDGPK------------------------------GDKGADGTPGAKGDKGEKGAD------GAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQP---GQKGDKGEKGDI---GQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 2 Score: 215.698 bits (548), Expect = 1.417e-58
Identity = 243/616 (39.45%), Postives = 299/616 (48.54%), Query Frame = 3
Query: 1872 KEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGF------IGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF------EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGK 3683
            K+G  G  G+ G  G  G TG +G  G+TG  G        G KG  G  GP G  GK+G+ G PG        G +G +G SGEKG+ G  G  G  G  G +GS+G+P      G  G +GEKGA GNPGP+G+      +G  G  G DG  G +GD G DG +G  G  G +GD    G +GE G  G KG  G  G PG  G+ G  G  G  G  G PG KG+ G DG +G  G  G  GD G  G  GP+G  G  G+ G +G KG+ G DG  G  G+ G +G +G  G DG  G  G  G KG  G  G  G KG  G  G+ G  G  G +G  G  GL G  GDKG  G PG +G +G +G+DG  G  G PGS+G  G  G KG  G PG  G  G  G+ G  G  G  G PG  G+ G +G  G++G  G  G  G  G  G  GP+G KG  G       +G++G  G PG +G KG KG+ G  G  G  G  G  GDKG  G+ G+ G  G PG  G+ G PG  G  G  G                            IG  G  G +G  G  G PG+ G  G+PG  G+ G PG+
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGV-------GVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSP------GSKGDKGEKGADGNPGPKGD------KGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGD---TGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGD---------------------------IGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 3 Score: 204.912 bits (520), Expect = 5.913e-55
Identity = 212/532 (39.85%), Postives = 265/532 (49.81%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIG---AEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIG---SQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL---QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL---GPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGY--QGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPG 3356
            +GE G  G  G  G KG  G  G  G++G +GEKG  G  G  G +G DG  G  G   ++G +G DG KG  G PG +G +G +GE G  G  GD+G  G  G KGD G  G  G  GA G   S+G  GA G  G  G  G++G+KG  G  GP+G+ G  G    +G  G  G DG  G  G  G  GD+G  G  GP+GD G  G +G  G  G KG  G +G  G  G  G PG  G  G +GL G KG+ G DG  G +GDKG             +G  G +G+ G  G KG+ G DG  G  G+ G +G +G     GP G  G  G  G KG KG++G  G KG  G  GS                        KG+ G  GL GP+G++G+D      G PGS+   G++GEKGD G PG  G  G  G  G  G+ G  G PG  G+ G   QGEKG  G  G+ G  G+PG  G +G +G  GQ G +GD+G  G  G  G KG  G+ G  G +G PG
Sbjct:  153 KGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGE------------KGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGS------------------------KGDKGDKGLDGPKGDKGAD------GTPGSK---GDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 4 Score: 200.29 bits (508), Expect = 2.021e-53
Identity = 234/628 (37.26%), Postives = 290/628 (46.18%), Query Frame = 3
Query: 2262 PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPK--GPQGDIGKIGLQGEIGPSGLKGS---------------------MGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGA------KGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGT---QGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLP--GELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGE------PGLKGVKGELGLPGQDGEPGL 4025
                G  G  G  G+DG  G +GD G  GD+G  G    G +GD G  G  GE G  G KG+                      G +G PGQ G+ G  G  G  G  G  GDKGE G DG  G +GDKG  G  G  G PG +G  G  G+ G +G  G  G+ G  G  GS G +G +G  G  G  G  GE G  G KG  G PG KG  G  G+ G  G  G +G  G  GL G  GDKG  G PG +G +G++G+D      G  G+ G+PG +G+KG+ G+ GP G  G  G +G  G PG     G  GE G  G KG+ G  G  G  G+ GL G +G +G  G  G +GD+G+ G  G +GA      KG KG  G  G +G PG  G  G+KG+ G  GD G  G PG  G +G  G  G  G  G P                           G  G  G +G  GP+G  G  GT   +G  G  G IG PG+                     +G+KGE G  G  G +G  G+ G  G +G    GE G  G  G  GQ G PG  GD+G+ G IG PG+ G +G+      PG KG  G+ G  GQDG+PG 
Sbjct:   70 GTGTGKDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGAD------GAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAK---GDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTP---------------------------GSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQ---------------------KGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 5 Score: 199.904 bits (507), Expect = 2.844e-53
Identity = 237/648 (36.57%), Postives = 303/648 (46.76%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRGNTGEQGPPGL--MGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL---KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTG 3257
            G  G  G +G+ G +G+ G+ G PG+   G  G+ GP GE+G  G +G  G  G  G  G +G  G  G++G+ G  G +G+ G+ G +G NG  G  GD GEKG  G  G                                                 +G+ G  G  GA G  G  G  G +GA+G  G  G +G TG  G +G DG  G  GA G  G  G KG+ G  G +GA G  G  G  G  G +G  G  G+KGD G  GL GP G    +G+ G PG  G +G  G +G KGA G PG +G+ GE GL G  G  G DG  G  G  G  GD+G  G  G +G  G  G +G+ G  GL   KG  G  G PG  G+ G  G  G  G  G PG KG+ G DG +G  G  G  GD G  G  GP+G  G  G+ G +G KGE G DG  G  G+ G +G +G+ G DG          KG KG  G PG KG                             G+KG+IG PG +G +G +G DG  G++G     G PG++G+KGD G  G  G+ G  G +G  G+PG  G  G  G+ G  G+KG +G  G+ G  G+ G  G  G +G  GQ G
Sbjct:   83 GKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGP------------------------------------------------KGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKG---DKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGP---------KGDKGADGTPGSKG---------------------------DKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQ---DGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 6 Score: 195.667 bits (496), Expect = 6.734e-52
Identity = 230/624 (36.86%), Postives = 297/624 (47.60%), Query Frame = 3
Query: 2193 GLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGP------------------KGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGA------KGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQ------RGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK 3974
            G+ G  GK+G  G  G+ G +G+ G+ G  G VG+ G  G  GP G+ G DGD+G  G                   KG +G  G+ G +GE G  G  GS G +G+ G+ G  G PG  G  G  G  G  G PG+      +GDKG  G  G  G PG +G TG +G  G +G KG+ G +G  G  G  G +G  G  G DG  G  G+ G  G KG  G PG KG  G  G                  L G  GDKG  G PG +G +G++G+DG        G+ G+PG +G+KG+ G+ GP G  G  G +G  G PG  G     GE G  G KG+ G  G  G  G+ GL G +G +G  G  G +GD+G+ G  G +GA      KG KG  G  G +G PG  G  G+KG+ G  GD G  G PG  G +G  G  G  G  G PG  G +G  G +G            P G  G  G+ G  G +G  G IG  G+ G  G  G  G+PG  G +G              G KG+ G +G  G +G  G+ G  G++G PG+ G KG +G  GQ      +GD G  G  G+ G  G PG+ G  G+PG K
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG-VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGS------KGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKG------------------LDGPKGDKGADGTPGAKGDKGDKGADG------AKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKG---DKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDG------------PKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDG------------QPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQK 641          

HSP 7 Score: 195.282 bits (495), Expect = 9.826e-52
Identity = 235/617 (38.09%), Postives = 298/617 (48.30%), Query Frame = 3
Query: 1326 MGYFGFRGPRGN-----IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE 3161
             G  G +G +G+     +G++G+ G QGPPG  G DG    KG  G  G +G  G  G  G  G +G  G PG +G  G +G +G  G PG +G  G KG  G+ G KG KGA G  G+ G  G +G  G  G  G+                            G PG  G+TG  G KG  G  G +GA G  G KG +G  G  G +G DG     G++G +G DG KG  G PG +G  G++G  GP G  G +G  G  G+KGD G  G  G  G  GS+G  G  G  G +G  G +G KGA G PG +G+ GE G  G  G  G  G  G +G+ G+DG      PKG +G  G  G +G+ G  G  G+ G  G PG  G+ G  G  G  G  G  GDKGE G DG +G +G  G  G  G  G  G  G  G  G+ G +G KG+ G DGP G  G+ G  G +G+ G  G IG PG+ G+KG KG+ G PG KG  G  G                       GDKG+ G       +G +G DG  G++G  G  G  G++GEKGD G PG  G  G  G  G  G+ G  G PG  G+ G  G+
Sbjct:   91 KGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGD---KGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGA---------------------------DGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGT---PGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDG------PKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPG---------------------QKGDKGDKG-------QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 8 Score: 174.096 bits (440), Expect = 9.467e-45
Identity = 205/551 (37.21%), Postives = 244/551 (44.28%), Query Frame = 3
Query: 1224 HIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLD------GPKGQIGFPGP---EGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK--GELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMG 2843
              G KG  GQKG  G  G+ G  G  G +G  G  G  G  GP+G+ G  G  G  G PG  G  GS G KG  G  G                         +G  G +G +G  G  G +G NG  G  GD GEKG  GA G D                                                G PG  G+ GA G KG  G  G++G +G +G  GP+G  G  G  G  G+ G  GA+G +G D      G KG+ G  GP   +GA G +G  G PG  GD+G++G  G KG  G  G  G  G  G  G  G  G  G  G  G +GEKGA G  G  G PG  G +G  G  G DG  G +GD G  G  GP G KG  G  G  G +GE G  G KG+ G  G  G  G+ G  G  G  G  G PG KG+ G  G+ GQ G KG  G+ G  G PG +G  G  G  G +G K  GE G DG  G  G  G  G +G+ G  G IG PG+ G+KG KG+ G PG KG  G  G
Sbjct:  152 EKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGS------------------------KGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGAD------------------------------------------------GTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPG 630          

HSP 9 Score: 129.028 bits (323), Expect = 3.881e-30
Identity = 174/473 (36.79%), Postives = 212/473 (44.82%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQ---GPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGAL---GPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPG 2618
            +G  G KG+KG+KG  G  G  G        G  G  G  G +G  G  G +G+ GE+   GP G  G DG+PG KG++G           G DG  G +G PG  GD+G+ G  G +G+ G  G +G NG  G  GD GEKG  GA G D                                                G PG  G+ G     GPKG  G  G  GA+G +GEKG  G  G  G  G  G+ G  GA+G  G  G KG  G  G +G  G +G  G PG  GD+G++G  G KG  G  G  G  G  G  G  G  G  G  G  G +GEKG IG PG +G+ GE G  GQ G  G+DG  G +GD    GD+G                QGE G  G  G  G  G+PGQ G+ G  G  G  G +   GDKG+ G DG+ GQ+G  G  G  G  G PG
Sbjct:  252 NGTPGSKGDKGEKGADGAKGADG------TPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDK---------GADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGAD------------------------------------------------GTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDK---GDKG----------------QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQK---GDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 10 Score: 73.559 bits (179), Expect = 8.788e-13
Identity = 122/363 (33.61%), Postives = 157/363 (43.25%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGR 2306
            +G  G KG+KG+KG  G  G  G  G +G +G  G  G  G +G  G  G +G+ GE+G  G  G DG+PG KG++G  G +G  G P                  G+ G +G +G  G  G +G +G  G  GD GEKG  GA G D                                                G PG  G+    G KG  G  G +GA G  G KG +            GE G IG  G +G  G KGQ G P      G++G+ G PG  GD+G +G  GEKG  G  G  G  G  G +G  G  G IG  G  G +G+KG  G PG +G+ G+ G +GQ G  G+
Sbjct:  366 NGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTP------------------GQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGAD------------------------------------------------GTPGSKGD---KGDKGLDGPKGDKGADGTPGSKGDK------------GEKGDIGQPGQKGDKGEKGQDGQP------GQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 640          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 218.779 bits (556), Expect = 6.520e-57
Identity = 311/758 (41.03%), Postives = 393/758 (51.85%), Query Frame = 3
Query: 1833 GALGPKGFIGYVGKEGARGVQGEKGPRGI----------TGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDG---NSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPG---------NIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXP--IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGI---TGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            G  G  G+ G  G +G  G+ G +GPRGI           G  G+ G+ G  G  GA+G+ GL GP G  G+PG  G  G +G  G PG  G+ G RG  GE G +G  G  G  G  G  G+ GAPG  G  G     G  G +G PGP G+ G  GL G  G  GRDG     G  G+ GM+G  G  G  G +G+ G +G+ G+ G  G  G+ G  G PG  GE+G PG  G+ G  G PGD+G PG+ G++G  G  G+ G+ G++GFPG      LRG  G  G+ G  G  G  G  G  G+ G+ G  G DG  GLPG  G+ G  G+ G PG  G  G  G PGN    G  G  G  G  G  G  G  GLPGL G RG+ G        G PG  G PG+ G  G  G+PGP G  G++G+ G+ G  G+ GLPG  G  G  G+ G +G  GE G  G PG  GY       GQ G EG++G  G+PG  G  GL+G+ G  G  G  G  G PG  G +G++G PG +GYPG         N GR G PGL G +G  G+PG  G+ G  GP G  G+ G  G  G    G  G  G  GY G  G+PG  G  G+PG  G+ G+PG PG  G  G  G  G +G  G+ G +G  G+ G  G  G+ G  G+    G++G PG  G  G  G  G+RG PG+PG +G+ G  G PG     G+PG+KG +G+ G PG+DG  GL
Sbjct:  691 GQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF----GFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPG------LRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDS----YPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGY------PGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGA---PGQPGIKGPRGDDGFPGRDGLDGL 1425          

HSP 2 Score: 216.468 bits (550), Expect = 3.092e-56
Identity = 334/922 (36.23%), Postives = 411/922 (44.58%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG--------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIG------------------NPGPRGEP------------GEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGE----------------------EGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGI--------KGELGNDGPLGFIGSVGIRGHQGNL-----------------------GPDGYIGLPGEIGEKGTKGKRGLPGIK----GPSGLMGSXXXXXXXXXXXXXXXXXXXXHNG------------------------------------DKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE-----------------KGDHGIPGPSGK------------------------TGLSGIRGITGRPGILGLPGFSGETG--YQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQ-------TGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            +G PG  G  GA G  G +G  G  G RG+ G  G  G+ GL GL G+ GE    G  G  G DG  G  G  GP G SG+ G  G PG  G         +G++G  GE G SG  GL G  G  G +G+ G PGP GL G  G  G KG +G                     P   P            G +G  G  G  GRDG  GP G +G+DG  G  G KG +GD+G  G +G+ G  G+ G+ G +G  G+ G  G PG+ G  G  G PG  G PG +G+                      +G +G KGL G  G+ G  GPRGP G  G+ G  GI        KG+ G DG  GF G  G+ G  G+                        G DG+ G+PG+IG+ G  G++G PG      GP G+ G PG  G  G  G  G  G  G+NG                                    D G+ G+PG  G  G+ GSDG  G  G+PG  G PG +GE                 KGDHG+PG  G+                         GL+GI G  GR G LG+PG  G  G  + G+ G+ G  GE G  G PGL G QGPRG            G  G  G  G+PG +GA GL G  G +GP+GYP   G PG++G+ G  G PG  G PG  G+QG  G  G+ G  G+PG  G  G  G  G  GE G        G  G V   GY GP G  G  G  G  G  GR GLPG PG  G  G  G+ G  G+    G++GE+G+ G+ G +G  G  G  G++G PG  G  G  G NG  G PG PGD+G  GS G  G  GP G PG  G+ G  GL G+ G+ GL
Sbjct:   69 EGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEE---GIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYP---GTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-------FGFPGQV---GYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQ---PGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGL 971          

HSP 3 Score: 212.231 bits (539), Expect = 7.005e-55
Identity = 377/1035 (36.43%), Postives = 457/1035 (44.15%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG----------------------------LDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKG------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGR-DGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQI-----GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ--RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGND-GPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKG---KRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE-----------------KGDHGIPGPSGKTG------------------------LSGIRGITGRPGILGLPGFSGETG--YQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQ-------TGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPG------LKGVKGELG------------------------------------LPGQDGEPGLI 4028
            G +G RGN G  G  G  G PG  G +G+PG  G  G  G  G                     D G  G RG +G  G PG  GL G+ GL G  GE+G  G  G DG  G  G  GP G+ G  G+ G+ G+ G PG  G             QG  G  G +G  G  G  G  G  G +G +G+ GP G+ G  G+ G+ G  G +   G++G                            L GP G  G    +G  G++G +GPPG +G +G  G+ G KG      D+G  G  G  G  G+ G  G+ G  GL G  G  G KG  G PG  G PG  G  G  G +G   G +GP G  G DG +G  G  G  G  G +G +G +G  G  G  G+ G PG       GE G+PGF G  GL G PGD G PG DG  G   +G  GL G  G  GFPG  G  G  G SG +G  G   N  GP G  G  G  G  G +G DGY G PG  GE+G        G+PG  G  G  G  G  G  G             NGD G+ G+PG  G  G+ GSDG  G  G+PG  G PG +GE                 KGDHG+PG  G+ G                        L+GI G  GR G LG+PG  G  G  + G+ G+ G  GE G  G PGL G QGPRG            G  G  G  G+PG +GA GL G  G +GP+GYPG    PG++G+ G  G PG  G PG  G+QG  G  G+ G  G+PG  G  G  G  G  GE G        G  G VG   Y GP G  G  G  G  G  GR GLPG PG  G  G  G+ G  G+    G++GE+G+ G+ G +G  G  G  G++G PG  G  G  G NG  G PG PGD+G  GS G  G  GP G PG        G++GE G                                    LPG DG+PG +
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFG---------------------DMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVN----------SQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMG-VRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGV---KGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPG------------PNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPG---TPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-------FGFPGQVG---YPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQ---PGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFV 1014          

HSP 4 Score: 202.216 bits (513), Expect = 7.820e-52
Identity = 311/813 (38.25%), Postives = 372/813 (45.76%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSG--LKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGT-------DGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSS---GPEGIKGELG------------------NDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGK-----------RGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG-----MPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRG-------ITGRPGILGLPGFSGETGYQGEKGSQGPVGE------------VGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG------AKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGL---VGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGL------QGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            G  G +GP G +G  G  G  G++G+KG  G  G  G RG DG  G  G +G +G  G  G  G+PG +G +G+ G  G PGF GD G  G  GE                G  G HGA G  G+QG  G  G  G  G  GPRG  G  G  GQ GI G  G +  +GD G DG  G AG  G  G+ G  G  GE G  G  ++G  GL    GQ G  GFPG  G +G  G  G+KG PGT        G  G  G+ G+ G  G+ G+PGP G  G RG      P+G+ G  G                  + G  G  G+ G  G  G+ G  G  GLPG  G  G KG+            G+PG+KG  GL G PG  G+ G+ G PG  G  G  G +G  GL G+ G RG QGS G  G QG      PG  G+PG +GE+G  G+PG  G  G  GI         + G+PG+ G+PG  G+ G  G  G  GPVG              G+ G PGL G  G RG +G+ GF G  G  G PG  G      A G  GE G+    G+PG  G PG  G +G  G PGP GYPG  G  G PG     G+ G  G PG+ G +                     G SG VG  G  G  G PG  G  G PG  G  G PG+          G  G  G  G QG  G  G  G  GP G+ GE G+ G  GL GE G  GL       G  G RG  G+PG  G+ G+ G PG  G  G+PG  G  GE G PG  G+PG
Sbjct:  270 GRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGE--------------GTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLD---GQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF----GFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSR---------------------GESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQ---------NGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPG 1030          

HSP 5 Score: 192.586 bits (488), Expect = 6.551e-49
Identity = 349/963 (36.24%), Postives = 428/963 (44.44%), Query Frame = 3
Query: 1536 GKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY----VGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFP--GPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKG-------AIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIG------------------KIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYG-----------------LLGLRGLPGDKGEPGTD------------------GEEGQRGDKGLLGDFGIMGFPGPRGPTG--LRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL-------GPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ-----------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGP---NGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLV------------GVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRG--LVGPRGMSGEAG------------------ITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL--IKIIDIQVGM 4055
            G +GP G  G  G PG  GL G KG +GD G++G +G  G                    G+ G+KG  G  G+ G PG  G KG  G+ G PG  G  G  GP+G +G      G  GA+G  G +G +G+ G  GL G  G  GP+GA G  G  G  G  G+   G  G  G  G  G PG  G+ G  G+ GE G  G   + GP G  G  G  G PG  G  G  G  GEKG        +G PG  G PGE G+ G++G+ G  G  G  G+ G D    P G  G  GD G                    G+ G  G  G  GS GL G PG  G  G+PG  G                 L G  GLPG  G PG+D                  GE G  G  G  G  G +G PG +GP G    G  G  G KGE G DG  G  G+ G RG    L       G  G  G+PG  G++G  G  GLPG  GP G  G+PG +G  G+ G PG+ G  G  G +G +G  G+ G  G  G DG  G             G PG  G PG  G+ G  G+PGP G  G  G+ G  G PG  G+   +G+ G  G+ GS+G  G VGI GK G  G  G RG  G  G+ G+ G  G  G  G  G  G+QGY G    +GYPGP G+PG+ G+         +G+PG  G  G  GL             G+ G  G PG+ G  GL                   GL G  G  G+ G  G PG  G +G+PG  G +  PG+PG  G+ G  G  G+ G+ G+ G  GE G  G    G  G+SG+ G                  ITG  GL GE G+ GL G  G  G PG PG  G+ G  G PG  G  G PG +G +GE G PG  GE GL  ++  D Q G+
Sbjct:  273 GPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDG------------------VPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPG-YDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGM---NGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGL---------VGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGL------------------PGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGL 1186          

HSP 6 Score: 185.267 bits (469), Expect = 1.280e-46
Identity = 257/688 (37.35%), Postives = 317/688 (46.08%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI------------------GMDGDRG------PAGP--KGPQGDIGKIGLQGE---------IGPSGLKGSMGLRGEPGQIGESGFPGFYGL---LGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGN--IGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE---------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGIS--GEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGP---RGIPGKIGTQGKPGLVGRIGLPGKP 3686
             G PG  G+ G  G  G  G  G++G  G +G+ G  G +G  G  G +G  G  GA G +G  G  GQ G+PGP G  G++G +G PG  G+ G  G  G +G+ G  G  G  G  G  G HG     GL GL G +G+ G +G     GEPG  G +GQ G  G     G  GD+                  G++G+RG      P  P   G  GD G  GL G           G  GLKG  GL G PG+ G  G PG  GL    G  G PG  G+PG  G++G+ G+KG  G  G  G P      GLRG  G  G+KGE G DG  G+ GS G  G  G++   GY G PGE G+ G +G+ G PG++G SG  G PG  G  G  G  G  G  G+ G  G    G PG  G  G  G DG  G  G+ G  GSPG+                G  G+ G+PG  GK G  G+ G  G PG+ G+PG  G+ G  G  G+ G  G  G  G+ GL G  G +G  G  G+ G  G+ G+ GP+G  G  G  G  G  G PG  GLPG   ++     G PG  GYPG  G  G PG  G++GP GK                            G  G  G+ GY GP    G+PG  G QG  G  GR G PG P
Sbjct:  873 DGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGT---DGLPGLPGADGQPGFVGE---AGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLP------GLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDV---GYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGK---------------------------AGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLP 1518          

HSP 7 Score: 183.726 bits (465), Expect = 3.887e-46
Identity = 319/999 (31.93%), Postives = 399/999 (39.94%), Query Frame = 3
Query: 1851 GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFY---------------GLLGLRGLPGDKGE--PGTDGEEGQRGDKGLLG---------DFGIMGFPGPRGPTGLRGSSGPE---------GIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG-----ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPG---------------LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGP-----RGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWW--------LSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYR 4634
            G +GY G  G  G  G  GP G  G  GL G  G  G  G  G  G  G  G  G  G  G  GK+G  G PG  G +G  G+SGE G  G  G+ G  GA G QG  G+PG  G  G  G  GE G +G PG RGE G+ GL G  G  G +G+ G  G  G  G+ G  G  G  G  G+ G  GE G  G  G  G  GEPG +   G PG                 GL GL G  GD G+  PG  G  GQ GD G  G           GI G PG +G +GL G  G +         G++GE G DG  G  G  G  G QG  G  GY G+PGE G  G +G+ G PG+KG +GL G                    G+ G  G +G PG  G  G  G +GD G QG  G  G  GE G+ G  G+PG  G+ G  G  G  G PG     I G PG +G+ GY G  G  G  G  G  G PG               L GY G RG  G  G  G  G  G PG  G +G+ G +G  G +GYPG  G PG  G  GE    G PG  G  G+ G  GAPG  G+ GP G  G  G+ GL                   GL G  G +G  GP     R  PG+ G  G PG  G  GLPG                       G  G  G  G  G  G  G  G  G  G+PG  G +G QG  G+ G+PGLPG  G  GS   PG   P    G    K           PG  ++ +    +Y  V    +   +D+                  G+ L++  T   M   + +  + S       SR+    ++ +++ +      ++P  G+      + C     E+ T I A  S      +     Q  S  W         +   +  G++L+         + V   E H +       T     +      K +R
Sbjct:  829 GQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQ------------------PGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLD------------------GLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGD---------------------NGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGS---PGGWAPSR--GFTFAKHSQTTAVPQCPPGASQLWEGYSLLY--VQGNGRASGQDLGQP---------------GSCLSKFNTMPFMFCNMNSVCHVS-------SRNDYSFWLSTDEPMTP---MMNPVTGTAIRPYISRCAVC--EVPTQIIAVHSQD---TSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFR 1733          

HSP 8 Score: 177.178 bits (448), Expect = 3.941e-44
Identity = 390/1146 (34.03%), Postives = 469/1146 (40.92%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIG----------MRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLV--GDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGA--------LGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVD-GETGPIGAEGIRGLDGPKGQI---GFPGPEGASGKEGE---IGPPGFIGDEGKRGF------------SGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAI-----------------GNPGPRGEPGE---------------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMG----------------LRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGP--------------LGFIGSVGIRGHQGNL------GPDGY---------IGLPGEIGEKGTKGKRGLPGIKGPSGLM---------GSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ---GSPGEQGEKGDHGIP---------------GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKP---------------------GLGGYQGPRGPKGQTGFEGDQGKFGVPGPQ------------------GAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD------PGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGK---PGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKG---------------------LQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            G+ G KG +G++G  G  G  G  G  G+ G  G  G+ G  GP G +G           +G  G QG  GL GHDG PGP                                    +GPRG  G  G PG  G++GM G    GD GE G+ G  GE G                                               GEPG  G  G          GP G  G  G++G  G+ G+ G  G +G  G  G    + GP G  G+ G  G  G+I   G+PGP G +G+ GE     P G  G+ G  GF            +G+ GD G  G  G  G+ GS G  G+PG  G+ G  G +GE G I                 G PG  G PG                 GLQG+ G+ G DG  G QG +G+ G +GP G   P G  G  G +GE G  GL G  G                + G+PG  G  G PG  G  GL GLPG  G  G  G  G+RG  GL G  G+ G PG RG  G  G +G +G  GE G DG                GF G VG  G  G+       GPDGY          G PGE G  G  G  G PG +G SGL+         G+PG +G  G  G  G  G  G NG  G  G PG QG  G+ G DG  G  G+PG     G PG +GE GD+G+P               G  G  G  G  G+ G PG  G PGF GE G  G  G +G  GE G L  P                     GL G  G RG  G + + G+ G  G PG                    G  GLKGE G  G  G  G  G+PG  G+ GE G+      PG  GYPG  GR+G  G  G+ G  G PG  G+ G  G +G+ G  G  G  G  G  GT G  GY G  G  G  G QG+   PGL G  G PG+PG+ G +G  G  G  G+ G  G  G+     + GP G +G+ G  G +GLPG  G+ G                     L G  G+RG PGL G RG  G  G PG  G +G PGL+G  GE G PG  G PG
Sbjct:  315 GNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGP------------------------------------VGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGL---------------------------------------------PGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFP-GQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDS-YPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQD----IYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPG 1373          

HSP 9 Score: 175.252 bits (443), Expect = 1.568e-43
Identity = 305/822 (37.10%), Postives = 364/822 (44.28%), Query Frame = 3
Query: 1875 EGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDE---GKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLR---------------------------------------------GEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK---GELGNDGPLGFIGSVGIRGH----QGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIP-----GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQ-GPVGEVGILGKPGL------GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGL------------KGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGA-----------PGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPG--LVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGM----------SGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQD---GEPGL 4025
            + A   +G   P    G  G RG  G  G  G  G  G DGP+G  G PG  GA G  G++G  G  GD    G  G  G +G  G  GL G  G  G  G+ G PG  GL G  G+ G+ G  G PG  G PGE G+  Q G  G  G SG  G  G+ G+ G  G KG +GD G  GL G  G SGLKG MG+R                                             GE G+ G  G PG  GL G  G PG KG+ G  G+ GQRG +G  G  G  G  G +G  GL G+ G  G K   GE G  G  GF G  G  G      G  GP G  G  G  G KG  G  GLPG  GP G +G+PG                    G  G  G+PG    +G++G DG  G  G PG  G PG+ G  G+ G+P     GP G  G SG  G  G PG +G PG+SGE G+ G   ++ GP G  G+ G+PG+       GY GP G  G+ G +      GVPG  G  G              G+ G  G  G PG  G  G  G+SG  G PG  GYPG  G  G            PGL G  G  G PG+ G  GL G  G  G+ G  GL G  GL+G  G +G  G  GIP   G QG PG    G+ G PG                    G +G  G  G+ G  GPRG+          +G+ G+ G  GLPG+ G  GL G+ G  G  G PG  G+ G  G PG  G  GEPG++G +GE+G  G D   GEPGL
Sbjct:   27 DAAAACKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQ-GRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAP------------------GQPGIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIP---GLQGPPGDSFPGQPGTPGY------------------KGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGL 807          

HSP 10 Score: 135.191 bits (339), Expect = 2.217e-31
Identity = 197/552 (35.69%), Postives = 240/552 (43.48%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---------------RGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPG------------EIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMG-----------------------LRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQG--------------SPGEQGEKG------------DHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQG 3230
             G+PG +G  G  G  G+ G  G+ G     G+ G                 G+ GL G RG +G++ P G  G+ G  G  G  G  G  G  G  G  G PG  G+ G  G  G +G+ G  G  G  G  G  G  G+PG  G  G  G+EGEKG  G PG  G PG            E GL GQ G  G  G  G  GD+G  G  G  G  G QG  G+ GL+GE G  G  G  G                       + G PGQ G+ G+PG   L GL G PG  GEPG+ G+ G  G  G  G+ G+ G+PG RG  GL G  G +G+ G  G        G  G+ G +G+ G DGY G PG  G  G  G+RGLPG+ G  G  G                      NG  G  G PG++GPRG+ G  G  G  G+PG  G               PG+ GE G            D+G+ GP GK G  G  G  G PG    PG SG  G+ G++G QG  G  G  G PG  GY G
Sbjct: 1008 DGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYP-GNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPG---LDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPG------VPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGD---------------------NGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGP---PGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPG 1525          

HSP 11 Score: 106.686 bits (265), Expect = 1.155e-22
Identity = 156/433 (36.03%), Postives = 201/433 (46.42%), Query Frame = 3
Query: 2913 GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRG-----PKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISG----------------------------------------EV--GDPGPIGYPGNIGRQ---GAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPG-----DRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            G+ G+ G PG  GP G  G+ G  G +G  G  GS   +G +GD G+PG  G  GL G+ G+ G  G  G+PG +G  G+ G  G  GP G+ G  G PG  G  GP G      +G+ G +G+ G+ GVPG  G  G  G +G     G PGP+GLPG  G+SG                                        EV  G  GP G  G  GR    G PG++G+ GP G PG  G++G +G  G++G++G  G+ G  G  G+ G QG  G  G PG  G  G+PG  GR G  G                  E  +    GE G  G  G  G+ G  G+ G +GLPG +G +G  G  G  G PG+ G     ++G  G  G PG     GEPGL G  G+ G PG+DG PG     DIQ
Sbjct:   55 GEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGS---KGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGA---KGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGD--------------CGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFA---GEPGLPGEPGDCGYPGEDGLPG----YDIQ 460          

HSP 12 Score: 106.301 bits (264), Expect = 1.539e-22
Identity = 146/380 (38.42%), Postives = 164/380 (43.16%), Query Frame = 3
Query: 2934 LPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPG-----PQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXX------XXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP----PGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             PG +G RGN G  G+ G  G PG  G  G  G  G  G  G  G  G  G RG  G PG  G PG  G  G  G KG +G  G  G  G PG+ G  GP G  GQ G  G  G  G PG      QG KG+KGE G  G  G PG  G PG KG     GDPGP G PG  G  G  G +GV     K  K        P                   GP+G +G  G +G  GP G PG +G  G PG  G  G  G                       G+ G+ G RG  G  G  GE G  G++GL G  G  G +G  G+ G PG PG  G  G  GP     G  GP G  G  GV+G  GLPG DG PG +
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAK---GDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGD---------------------LGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPV 396          

HSP 13 Score: 95.5153 bits (236), Expect = 2.713e-19
Identity = 146/411 (35.52%), Postives = 172/411 (41.85%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD---------EGKRGFSGEKGDSGPVGLIGP-----------------------IGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGN------------------PGPRGEPG------EIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIG------ESGFPGFYGLLGLRGLPGDKGEPG-----TDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPS 2831
            + G PG  G  G  G  GF G  G+ G  G QG +G +G  G+ G  G+ G  G  G  G++G +G  GQ G+PG  G  G  G++G PG  G+         +G+ G  GE G  G  GL G                         G  G  G  G PG  GL G  G  GE G+ G                   PG RG PG        GL G  G+ G +G  G +GD G DG  G  G  G  G  G+ GL G  G  G  G  G  G PGQ G      + GFPG  GL GL G PG +G PG          GQ G+ G  G+ G  G P   G  GL G  G  G  G  G DG  G  G  G+ GH G+ G  G  G  G  G  GT G  G PG   PS
Sbjct: 1126 NDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLP---GDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPS 1533          

HSP 14 Score: 91.2781 bits (225), Expect = 5.992e-18
Identity = 242/662 (36.56%), Postives = 293/662 (44.26%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGL---------MGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQ------------------GLNGMKGLVGDV--GEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIG------PIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGR---------------DGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIR------GHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG 3032
            +SG  G  G+ G  G  G  GD G  G  GQ+G  GP G  G  G  G  G+RG  G+ G PGL          G DG PG  GE G  G  G  G  G  G  G  G PG PG RG+ G  G     G+PG                    GLNG +G  GD   G  G  G  G+ G  G  G  GP G PG  G  G KG  G PG+ GR G  G+ G  G +GE G  G  G+ G  G+ G  G+EG +G  G  G  G+ GL G  G  G  G  G +G  G  G  GQ+G PG  G  G  GE G  G  G +G+ G  GE G  G  GL G      P+G  G  G  GAPG    Q + G  G+ G  G PG  G PG  GL G+ G  G+                G  G +G  G+DG R            G  GL G  G  G++G  GL G+    GE G+PG  G  G  G PG++G PG  G++G+ GD G  G  G  G  GPRG  G  G  G +G+ G  G +G  G + ++ +R      G  G  G  GY GLPG+ G  G  GK G PG  G  G                        + G  G  G+PG  G +G QG+ G  G  G+PG+ G PG  G
Sbjct:  911 YSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPG----QDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKR------------GHDGLPGAPGVPGVEGVPGLEGD---CGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPM-AMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDG------------------------YPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1528          

HSP 15 Score: 55.0694 bits (131), Expect = 5.922e-7
Identity = 72/170 (42.35%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 3567 IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGL------PGDRGKIGSIGPPGRVGPQGEPGL-----KGVKGEL------GLPGQDGEPGL 4025
            I +      +G   P   PG  G +G PG  G  G PG PG DG EG  G  GM G  G  G+ G  G RG  G  G  G  G+ G +GLPG  G +G+ G NG  G PG+      PG  G+ G+ G PG  GP GE G+     KGVKGE       GLPG  G PGL
Sbjct:   24 IHVDAAAACKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGL 193          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 193.741 bits (491), Expect = 6.390e-52
Identity = 207/503 (41.15%), Postives = 260/503 (51.69%), Query Frame = 3
Query: 1872 KEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSG------EKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGY--QGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPG 3356
            K+G  G  G+ G  G  G TG +G  G+TG  G        G KG  G  GP G  GK+G+ G PG  G +G  G  G      EKG+ G  G  G  G  G +GS+G+PG        G +GEKGA GNPGP+G+      +G  G  G DG  G +GD G DG +G  G  G +GD G    +GE G  G KG  G  G PG  G+ G  G  G  G  G PG KG+ G DG +G  G  G  GD G  G  GP+G  G  G+ G +G KGE G DG  G  G+ G +G +G  G  G  G PG+ G+KG KG  G  G KG  G  G+ G++G +G             +G KG  G PG +G +G++G DG  G +G  G+ GS G++GEKGD G PG  G  G  G  G  G+ G  G PG  G+ G   QGEKG  G  G+ G  G+PG  G +G +G  GQ G +GD+G  G  G  G KG  G+ G  G +G PG
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGV-------GVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPG------SKGDKGEKGADGNPGPKGD------KGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTG---DKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGA------------DGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 543          

HSP 2 Score: 174.096 bits (440), Expect = 2.340e-45
Identity = 182/464 (39.22%), Postives = 224/464 (48.28%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQG---------------EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEG---ASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE 3161
            G+ GA GP G  G  G +GA G +G               EKG +G  G  G +G  GE G  G+ G +G  G KG  G PGP+G   A G +G  G PG  GD+G  G  G  G+ G  G  G  G  GS G+ G  G  G  G  G +GEKGA G  G  G PG  G +G  G  G DG  G +GD G    +G  GPKG +G  G  G +G+ G  G  G+ G  G PG  G+ G  G  G  G  G  GDKGE G DG +G +G  G  G  G  G  G  G  G  G+ G +G KG+ G DGP G  G+ G  G +G+ G  G IG PG+ G+KG KG+ G PG KG  G  G                       GDKG+ G       +G +G DG  G++G  G  G  G++GEKGD G PG  G  G  G  G  G+ G  G PG  G+ G  G+
Sbjct:  112 GDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE---KGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPG---------------------QKGDKGDKG-------QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 544          

HSP 3 Score: 172.555 bits (436), Expect = 9.391e-45
Identity = 200/546 (36.63%), Postives = 254/546 (46.52%), Query Frame = 3
Query: 2262 PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGL 3899
                G  G  G  G+DG  G +GD G  GD+G  G  G    +G  G  G  GP G KG  G +G PG  G  G  G  G  G  G  G+KG P      GQ+GDKG  G+ G  G PG +G  G +G+ G  G KG+ G DG  G  G+ G +G +G+ G  G  G PG  G+ G KG++G  G KG  G  G+                   G  GDKG  G  G +G  G  GS GD G  G  G+ G+PG++G+KG+ G+ GP G  G  G  G  G  G  G  G  G  G  G KG +G  G  G  G PG    +G +G KG  G +GD+G  G PG +G KG KG  G  G +G PG  G  GDKG+ G  GD G  G PG+ G +G  G +G  G  G  G+ G+ G  G                 G  G  G +G  G +G  G+ G  G+PG  G+ G PG+                        KG+ G +G +G  G  G+ G  G++G PG+ G  G  G  GQ G PG 
Sbjct:   70 GTGTGKDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG----VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSP------GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGT------------------PGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQ---KGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQ---------------KGQDGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQ------------------------KGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 544          

HSP 4 Score: 172.17 bits (435), Expect = 1.030e-44
Identity = 193/507 (38.07%), Postives = 243/507 (47.93%), Query Frame = 3
Query: 1806 GEPGGIGNTGALGPKGF-----IGYVGKEGARGVQGEKGPRGITGLTGLRGVD---------------GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD---EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTG 3257
            G PG  G+TG  G KG      +G  G  GA+G  GEKG  G  G  G +G                 GE G  G +G +G  G KG  G PG +G  G++G  G PG  GD   +G +G  G  G  G  G  G  GA G+ GS G  G  G +G  G +G+KGA G PG +G+ GE G  G     G DG  G +GD G DG +G  G  G +GD G+ GL       G KG  G  G PG  G+ G  G  G  G  G PG KG+ G DG +G  G  G  GD G  G  GP+G  G  G+ G +G KGE G DG  G  G+ G +G +G+ G DG          KG KG  G PG KG                             G+KG+IG PG +G +G +G DG  G++G     G PG++G+KGD G  G  G+ G  G +G  G+PG  G  G  G+ G  G+KG +G  G+ G  G+ G  G  G +G  GQ G
Sbjct:   86 GTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADG---AKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL------DGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGP---------KGDKGADGTPGSKG---------------------------DKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQ---DGQPGQKGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 543          

HSP 5 Score: 162.155 bits (409), Expect = 2.599e-41
Identity = 194/540 (35.93%), Postives = 244/540 (45.19%), Query Frame = 3
Query: 2517 GLPGDKGEPGTDGEEGQRGDKGLLGD-----FGIMGFPGPRGPTGLRGSSGPEGIKG------------ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ---------GSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGT---QGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLP--GELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGE------PGLKGVKGELGLPGQDGEPGL 4025
            G+PG  G+ GT G++G  GDKG  GD      G+ G PG +GP G +G  G +G  G            + G+ G  G  GS G +G +G  G  G  G PG  G+KG KG  G PG KG  G  G+ G  G                 G KG+ G  G +G  GN GS GD G +G  GS          G+PG +G+KG+ G  G  G  G  G +G  G  G  G  G  G+ G +GEKG  GP G+ G  G PG       +G KG+ G +G +G  G P   G+KG KG  G  G +G PG  G  G+KG+ G  GD G  G PG  G +G  G  G  G  G P                           G  G  G +G  GP+G  G  GT   +G  G  G IG PG+                     +G+KGE G  G  G +G  G+ G  G +G    GE G  G  G  GQ G PG  GD+G+ G IG PG+ G +G+      PG KG  G+ G  GQDG+PG 
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTP---------------GSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGA------KGDKGEKGADGAKGADGTP---GSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTP---------------------------GSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQ---------------------KGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPGQ 544          

HSP 6 Score: 159.458 bits (402), Expect = 2.240e-40
Identity = 194/527 (36.81%), Postives = 254/527 (48.20%), Query Frame = 3
Query: 2394 KIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK 3974
            K G+ G  G  G  G  G  G+ G  G++G PG    +G++G PG +G PG  G++G +G  G  G  G  G  G +G +G +G  G  G KG+ G  G  G  GS G +G +G  G DG  G  G+ G  G KG  G PG KG  G  G+                        KG  G PG +G  G++G  G  G +G  G+ G+PG +G+KG+ G  G  G  G  G +G  G  G  G  G  G+ G +GEKG  GP G+ G  G PG       +G KG+ G +G +G  G PG   +KG KG  G  G +G PG  G  G+KG+ G  GD G  G PG  G +G  G  G  G  G PG  G +G  G +G KG+KG  G  G  G  G  G  G  G +G  G+ G  G+PG  G+ G PG+                        KG+ G +G  G +G  G+ G  G++G PG+ G KG +G  GQ   PG  GD+G  G  G PG+ G  G+PG K
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG----VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGA------------------------KGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGA------KGDKGEKGADGAKGADGTPG---SKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQ------------------------KGDKGDKGQ-GEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQ---PGQKGDKGDKGQDGQPGQKGQDGQPGQK 536          

HSP 7 Score: 145.591 bits (366), Expect = 7.481e-36
Identity = 165/471 (35.03%), Postives = 216/471 (45.86%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAP---GPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMD---GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGL--PGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVG 2717
            G  G +G +G  G  G+ G +G  G  G DG+PGPKG++G  G                         +G  G  G +G+ G  G +G +G  G  GD G+KG KG+ G                                              KGD+G  G  G+ G  G KG       +GA+G  G  G +G  G  G +G DG  G  G +G +GLDGPKG  G              G PG  GD+G++G  G KG  G  G  G  GA G++G+ G P   G  G +GL G +G+KGA G PG +G+ GE G  G  G  G  G+ G +GD G+D   GD+G  G  G +GD G+ G  G+ G  G KG  G  G+PGQ G+ G PG  G  G +G    G  G+PG  G++GQ G KG  G+ G +G PG +G  G +G  G  G KG+ G  G  G  G  G
Sbjct:  160 GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGA------------------------KGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDG---------------------------------------------AKGDKGANGTPGSKGDKGEKGA------DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGA------------DGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 543          

HSP 8 Score: 144.436 bits (363), Expect = 1.913e-35
Identity = 167/415 (40.24%), Postives = 204/415 (49.16%), Query Frame = 3
Query: 1605 KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK--GELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMG 2843
            KG  G  G+KG KG  GE                        KG  G+PG  G  G  G  G  G +G+ G  G  GA G  G  G  G +GA+G  G  G +G TG  G +G DG  G  GA G  G  G KG+ G  G +GA G  G  G  G  G +G  G  G+KGD G  GL GP    G +G+ G PG  G +G  G +G KGA G PG +G+ G  G +G  G  G+ G+   +G+ G+D   GP G KG  G  G  G +GE G  G KG+ G  G  G  G+ G  G  G  G  G PG KG+ G  G+ GQ G KG  G+ G  G PG +G  G  G  G +G K  GE G DG  G  G  G  G +G+ G  G IG PG+ G+KG KG+ G PG KG  G  G
Sbjct:  153 KGEKGSPGQKGDKGEKGE------------------------KGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGP---KGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGD---KGEKGLD---GPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPG 534          

HSP 9 Score: 132.494 bits (332), Expect = 1.445e-31
Identity = 165/436 (37.84%), Postives = 205/436 (47.02%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPG 2528
            G  G KGEKG+KG  G  G  G  GE+G +G  GP G  G  G +G  G  G+ G++G  G  G DG+PG KG+ G  G +G  G  G  G  G  G  G  G++G  G +G  G  G  G +G +G KG  G  G+KG KG  G D                                                G  G  G  G  G KG  G  G +GA+G  G  G +G  G  G +G DG  G  G +G +GLDGPKG  G  G  GA G +GE G  G  G +G  G  G+KGD    GL GP G  G+ G+ G+ G  G +G IG+ G+KG  G  G  G+PG+ G  GQ G  G  G+ G QG+ G DG  G  G  G  G  G  G +G+IG  G KG  G +G+ GQ G+ G  G  G  G  G PG
Sbjct:  160 GQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD------------------------------------------------GPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDK---GLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 543          

HSP 10 Score: 101.293 bits (251), Expect = 1.632e-21
Identity = 124/346 (35.84%), Postives = 155/346 (44.80%), Query Frame = 3
Query: 2988 RQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            + G+PG+ G  G  G+KGD G  G  G TG  G+ G+ G PG  G PG   E G  G+KG+ G  G  G  GK G  G  G +G KG  G +GD+G+ G  G  G+ G KG++G  G +G PGP G  G  G  G  G PG  G  G+ G +GA G  G  G  G                             G  G+ G++G  G  G PG  G +G+ G  G  G  G P                     G+KG+ G  G  G  G  G+ G  G++GL G  G KG  G  G +GD G  G  G  G+ G PG  G +G  G KG  G  G  G  GE GL
Sbjct:   75 KDGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGV-GVKGDPGAQGPPG---EKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGD---------------------------KGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTP---------------------GSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL 368          

HSP 11 Score: 90.1225 bits (222), Expect = 5.912e-18
Identity = 126/378 (33.33%), Postives = 163/378 (43.12%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQ---GPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM 2342
            +G  G KG+KG+KG  G  G  G        G  G  G  G +G  G  G +G+ GE+   GP G  G DG+PG KG++G                            +G  G +G  G  G  G +G +G KG  G  G+KG KG  G DG                                              +G+ G  G  GA G KG  G  G +GA G  G KG +G  GL G +G  G  G  G++G +G    KG IG PG +G  G++G+ G PG  G +G+ G  G+KGD G  G  G  G  G +G  G P      G  G +GEKG IG PG +G+ G+ G  GQ G  G+DG  G +G  G 
Sbjct:  252 NGTPGSKGDKGEKGADGAKGADG------TPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGE---------------------------KGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGP---------------------------------------------KGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGE---KGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQP------GQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQ 541          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 185.652 bits (470), Expect = 9.674e-47
Identity = 324/901 (35.96%), Postives = 407/901 (45.17%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGIT---------GLTGLRGVDGETGPIGAEGIRGLDGPKGQIG---------------------FPGPEGASGKEGEI----GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI--GLQGEIGPSGLKGSMGLRGEPGQIGESGFPG---------------------------FYGLLGLRGLPGDKGE---PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKG---TKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPG---------------PSGKTGLSGIRGITG------------RPGILGLPGFSGETGYQG---EKGSQGPV------GEVGILGKPGLGGYQGPRGPKGQTGFEGDQG-----KFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRG---------------------IPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNK-----------------------------GETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
             G PG  G  GA GP G+ G  G  G  G  G KG RG T         G  GL G  G+ GP G  G+ G+ GP G  G                     FPG  G  G+  ++    GPPG+ G +G+ GF G+ G  G  G  GP+G  G+ G  G  G  GL GL GK G+ G  G PG +GE G  G  GQ G  G  G+ G  G  G  G +G  G   P+  +     G  G  G  G KG  G  G PG++G+ GFPG                           F G+ GL G+PG KG+   PG  G  GQ+G+ G+    G+ G PG  G  GL+G +G  G+ G  G +G  GF G+ G++G  G  G  G  G PGE G+ G     G+ G PG  G  GL G PG                    G+ G  GLPG+ G +G+ G+ G  G  G+PG+ G PG +G  G  G+PG               P G+ G+ G+ G  G            R G+ G+PG  G+ G+ G   EKG  GP       G+ G+ G+PGL G QGP G  G  GF+G+ G     + G PG +G  G+ G+ G  G  G PG  GLPG  G+ GE G PG  G PG  G  G PG  G  G  G+PG  G  GL G  G  G +G +G  G  G+ G  G  GY G +G                      PG  G +G PG  G+ GLPG PG+ G  G  G+ G +G  G+ G K                             G+ G  GL G +G SG +G+ G  GL GE G+ G  G  G  G  G+PG RG+ G  G PGR G  G PGLKG  G  GLPGQ G PG+
Sbjct:  494 NGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGV----GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPG------------------MKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGI 1371          

HSP 2 Score: 183.341 bits (464), Expect = 5.183e-46
Identity = 305/807 (37.79%), Postives = 381/807 (47.21%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGY--VGKEGARGVQGEKGPRGITGLTGLRGVDGETGP--------IGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKG------------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG---------------ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPG--EQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKG---------SQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPG---DKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIG--------------LSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             G+PG  G  G  G KG  GY   G+ G  G +G+ G  G+ G  GL+G+ GE  P         G  G+ GL G KG+ G+PG      + GE+G PGF G  G +G SG  G            D G  G+ G  G  G +G  G PG   L GL G++GE G +G PG  G PG  GL+G  G+ G  G  G      ++G RG  G  G +G  G  GL G+ G  G KG  GL G PG+ G  GFPG  GL G+ G+ G+ G PG  G  G +GD G  G  G  G PG  G  G++G++G  G+ G                 G  G  G  G+ G++G+ G  G  G  GL G  G KG +G  GLPG KG +G                         +G KG+ GLPG  G RG QG  G  G  G  G  G PG  + G+ G+ G+PG  GK G  G  G  G+ G+ G PG  GE+GY G+ G           G  G++G  G+PGL G  G  G  G  G  GD+G+ G+PG  G +G+ G  G  G NGYPG  GLPG   +KG +G  G PG  G PG  G+ G PG+ G+ G  G PG+ G++GL G  G+KG  GL G+ G  G              L G  G  G  G +G  G  G  G PGL G  G+PG P                     G KG+ G  G+ G RG  G  G+ G++G PG  G+KG  G  G  G PG PG          PG  G  G PG  G KGE G PG  G PG  
Sbjct:  663 SGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPG------RPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPG---LPGLNGQKGEPG-VGVPGQPGSPGFPGLKGDAGLPGLPGTPG------LEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPA---------------------ARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFP---------------------GAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGI---------PGLKGEGGLPGFPGAKGEAGFPGTPGVPGYA 1402          

HSP 3 Score: 172.555 bits (436), Expect = 8.602e-43
Identity = 309/866 (35.68%), Postives = 390/866 (45.03%), Query Frame = 3
Query: 1617 GDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGE--------TGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFS------------GEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG---------------ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP--GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEK---------GSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI-----GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGIT---------GKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            GD G  G  G  G+D                                                G PG  GN G  G     G  G+ G  G +G+ G  G+ G  GL+G+ GE          P G  G+ GL G KG+ G+P      G+ GE+G PGF G  G +G S            G  GD G  G+ G  G  G +G  G P   GL GL G++GE G +G PG  G PG  GL+G  G+ G  G        G++G RG  G  G +G  G  GL G+ G  G KG  GL G PG+ G  GFPG  GL G+ G+ G+ G PG  G  G +GD G  G  G  G PG  G  G++G++G  G+ G                 G  G  G  G+ G++G+ G  G  G  GL G  G KG +G  GLPG KG +G                         +G KG+ GLPG  G RG QG  G  G  G  G  G P  G+ G+ G+ G+PG  GK G  G  G  G+ G+ G PG  GE+GY G+          G  G  G++G  G+PGL G  G  G  G  G  GD+G+ G+PG  G +G+ G  G  G NGY   PG  GL G+KG +G  G PG  G PG  G+ G PG+ G+ G  G PG+ G++GL                   GLSG  G  G  G  G PG+      G  G PGL G+ G PG P                     G KGE+G+ GL G  G+ GE+G+          G  G+PG+ G  GL GV G+ G PG+PG +G++G  G PG+ G  G PGLKG  G  G PG  GE G 
Sbjct:  655 GDAGLPGLSGKPGQD------------------------------------------------GLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYP------GRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNP---GLPGLNGQKGEPG-VGVPGQPGSPGFPGLKGDAGLPGLPGTP------GLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAG---------------------PAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLP------------------GLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLP---------------------GQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGF 1392          

HSP 4 Score: 138.658 bits (348), Expect = 2.225e-32
Identity = 208/520 (40.00%), Postives = 254/520 (48.85%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASG------------KEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQ 3326
            +GE G  G  G  G KG +G  G+ GA G+ G  G  G+ G  G+ GV G  G  G  G+ GL+GPKG+ G PG  G  G            ++G  G PG  GD G  G  GEKG++GP    G  G  G  G  G  GP G  GL G  G KG  G PG  G+PG+ G +G  GI G+ G  G  G  G DG  G  G KG  G  G+ GL G        G  G+ G+ G +G+SG PG  G  GL G P   G PG  G++GQ G  G+ GD G+ G+PG +G  G  G  G  G+ GE G  G  GF G  G  G+ G  G  G  GL G+ G  G  G+ GLPG+ G    MG       Q  Q   G +G  G  G +G  G PGL G +G  G  G  G  G+ G  G PG  G KGD G  G  GK G  G+ G+ GR G  G+PG  GE            VG  G+ G+PG  G  G +G  G  GF G +G+ G PG  G  G  GE+
Sbjct:  909 KGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGR------DGLPGVPGQKGDLGQSGQPGLSGAPGLDGQP---GVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSG-EKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGE------------VGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEK 1405          

HSP 5 Score: 110.923 bits (276), Expect = 6.835e-24
Identity = 250/656 (38.11%), Postives = 296/656 (45.12%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHD---GSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKG-----------------------------LLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITG-----------RPGILGLPGFSGETGYQGEKGSQG 3176
            G+ G +G+ G+ G  G +G PG  G D   G PG KGE GL G  G  G                   +G +G  G  G  G PG  G  GMKG  G  G  G KG  G  G  G  GP+G  G PG  G+ G KG  G PG+ GR G+ GV G+KGD+G  G  G  G  GP    G  G  G  G  G +GP+G +GL G+ G  GETG +   G  G  G KG  G P      GK G  G PG  G +G  GF G KG+S            G  G  G PG  GL G+ G++G+ G  G PG  G P   GL GQ G+ G  G+ G  G  G+ GDRG  G  G +G+ G  G  G  G  G KG  G  G PG  G  G+PG  GL G+ GL GD G PG  G+EG  G  G                             L G  G  G PG +G +GL G  G  G+KGE G  G  G  G +G  G  G  G DG  G+PG  G+       G+PG+KG  G  G                       G  G  G+PGL+G  G  G  G  G  G PG+ G PG  GEKGD G+PG  G+ GL G  G  G            PG  GLPG  G  G +GEKG  G
Sbjct:  874 GYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGL------------------KGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETG-LPGYGQPGQPGEKGLPGIP------GKAGRQGAPGSPGQDGLPGFPGMKGES------------GYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAP---GLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQP------GIPGLKGEVGGAG---------------------LPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPG 1462          

HSP 6 Score: 110.153 bits (274), Expect = 1.096e-23
Identity = 182/530 (34.34%), Postives = 222/530 (41.89%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKG-----------------------------LLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG---------------LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS------------DG--------------------DVGRQGMPGSQGSPGEQGEKGDHGIPGPS------------GKTGLSGIRGITGRPGILGLPGFSGETG 3149
            G  G  G +GF G  G++G  G     G +G  GL G  G+ G  GP G  G+ G    KG+ G PG  G  G+ GE G PG  G  G++G  G  G  G  G  G  G  G  G  G PG  GL G+ G++G+ G  G PG  G PG   L GQ G+ G  G+ G  G  G+ GDRG  G  G +G+ G  G  G  G  G KG  G  G PG  G  G+PG  GL G+ GL GD G PG  G+EG  G  G                             L G  G  G PG +G +GL G  G  G+KGE G  G  G  G +G  G  G  G DG  G+PG  G+ G  G +G               +PG+KG  GL G                       G KG  G PG  G  G  G             DG                    + G +G+PG  G+PG +GEKG  G+ GP             G  G  G  G++G  G+ GLPGF G  G
Sbjct: 1006 GVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGF---KGETGLPG-YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPG---LDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPG---------------------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDG 1507          

HSP 7 Score: 87.0409 bits (214), Expect = 1.137e-16
Identity = 199/577 (34.49%), Postives = 238/577 (41.25%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGL---------DGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPG-----------PIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGK---IGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGI-----------------MGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKG 2825
             +G  G KGE G     G  GD G              G  G RGP+G  G+ G  G +G  GL G+ G PG  GE+GL                            G  G  G QG  G PG  GL G  G+ G+ G  G  G  G DG  G                                            G+ G +G +G  G  G  G  G+ G  G++G+KG  G+ G+ G RG+DG  G  G  G  G           G  G  GFPG +G+ G  G+ G PG  G +G  GF G+ G  G  GL G  G  G  G  G PG             GLQG  G  G  G  G  G  G PG  GL+G+ G+ G  G  G  G  G+ G RG  G  G  G  G+    GL+GE+G +GL G  G  G PG  GE G PGF G  G  G PG  G PG  GE+G  G  GL G  G+                 +  PG +G  GL G+ G  G KG  G DGP G  G  G+ G +GN   DGY G PG  GEKG  G  G PG+ G
Sbjct: 1016 FNGLPGEKGEAGPAARDGQKGDAGLP------------GQPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLP---------------------------GIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGV------------------------------------------PGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGN---DGYPGAPGLSGEKGMGGLPGFPGLDG 1507          

HSP 8 Score: 86.2705 bits (212), Expect = 1.792e-16
Identity = 179/513 (34.89%), Postives = 219/513 (42.69%), Query Frame = 3
Query: 1410 GHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPA--------GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGE---PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQG--------------------------------NLGPDGYIGLPGEIGEKGTKGKRGLPGI 2819
            G  G PG KG+RG  G  G  G  GP    G +G  G+PG  G  GP+G  G  G PG +G  G+ G  G  G+ G KG                                                     G PG  G  GA G  G  G  G  G +G  G  G  G+ G  GL GV G+ G +G  G  GL G  G  G PG  G  G +G+ G PG  GD G  G+ G+KG++G  G  G  G  G +G  G PG  GL+G  G  G+ G  G PG +G+ G  G  GQ G+ G  G  G  G  GM G  G +        G  G QG  G  GL G+ G SGL G  G  G  G+ G  GFPG  G LG  G+PG +GE   PG  G +GQ G  GL G+ G  G PG  G  G+ G  G  G+ G  G  G  GF G+ G+ G+ G                                NL   G  GLPG  G  G +G++G+PG+
Sbjct: 1003 GLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGL---------------------------------------------------PGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGL 1463          

HSP 9 Score: 65.855 bits (159), Expect = 3.483e-10
Identity = 65/137 (47.45%), Postives = 76/137 (55.47%), Query Frame = 3
Query: 2292 GIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF 2702
            G  GRDG  G +GD G  G+ GP GP G  G  G  G+ G IGP G  G +G  G PG  G   F G   ++G RG PG+KG+ G  GE GQRG  G  G  G  G PG +G  GL G +GP G +G  GN GP GF
Sbjct:  182 GPSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPGI-GSIGPKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGF 317          

HSP 10 Score: 58.5362 bits (140), Expect = 5.890e-8
Identity = 106/271 (39.11%), Postives = 130/271 (47.97%), Query Frame = 3
Query: 1890 VQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGA------------SGKEGEIGPPGFIGDEGKRGFSGE------------KGDSGPVGLIGPIGAIGSQGSHGA------PGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGF 2612
            ++G  GP G+ G  GL+G  G  GP+G +G RG     G  GFPG +G              G +G  G  G  G  G+ G  G             KG+      IG  GA G +G  G       PGP G  G  G++G++G  GN GPRG PGE G  G  GI    G+ GP+GD    GD G  GP GP G     G    +GP G  G  G +GEPG+ G+ G+PG  GL G  GLPG KGE G  G  G RG +G  G+ G  GF
Sbjct:   61 IRGFPGPEGLAGPKGLKGAQGPPGPVGIKGDRGA---VGVPGFPGNDGGNGRPGEPGPPGAPGWDGCNGTDGAPGIPGRPGPPGMPGFPGPPGMDGLKGEP----AIGYAGAPGEKGDGGMPGMPGLPGPSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPGI----GSIGPKGD---PGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGF 317          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 265.003 bits (676), Expect = 5.334e-71
Identity = 419/1205 (34.77%), Postives = 532/1205 (44.15%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDG------SPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGM---KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIG-NTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP-----VGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGF---YGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG---------------IMGFPGPRGPTGLRGSSGPEGIKGELGN------DGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSG------------KTGLSGIRGITGRPGILGLPGFSGETG---YQGEKGSQGPVGEVGILGKPGL-------GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPG-----NIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSG---EAGITGKEGL---------PGELGIKGLQGVNGQRGDPGLPGDR---------------------------------------------------GKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEML--DELVTKYNKSLGSKEN--------PSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSR 4412
              G  GR G  GQKG  G+ GD+G      + G  G  G  G  G  G  G RG  GE+G PG  GHDG       PG KGE G TG  G  G PG            + GD+G  G  G +G  G  G +GL G+   KG  G  GEKG  GA G DG+ G  G  G  G PG       KG PG  G  G  G  G  G  G++GEPG    +   +  KG  G  G+ G  G  GE G  G  G TGL+G  G  GP G EG RGL+GP+G+          G +G +G PG  G +G RG  G  G  GP     +   GP+G  G  G  G  G  G  G IG  G  G++G PG RG+ G  G+ G+ GI+G  G+ GP G         PAG  GP G  G  G++G  G  G  GS GL G PG  G+ G PG     G  G+ G PG +G  G  G  G +GDKG  G  G               +MG  G +G  G  G  G +G+ GE GN      DGP G  G    +G +G  GP G  G  G  G  G  G++GLPG+                       + G  G  G+KG+ G  G+ G     G +G+ G QG+ G  G PGE+G  G  GIPG  G              G  G RG  G PG+ GLPG  GETG    QG  G+ GP GE GI G+PGL        G +G +G +G TG +G+QG+ G+ GP G  G KG++G  GP G  G +G+PG KG   ++G  G IGYPG       G  G PG  G  G IG PG +G++GL G                 G  G VG  G  GP G  G+ G  G PG  G+ G PG PG+ G  G +G KG +G +G +G KG+ G RGL GP G+ G   + G TG  GL         PGE G  G +G +G+ G PGLPG +                                                   G+ G++G PG  G +GEPG +G +G +GL GQ GEPG      +       + R  + +                  VP+  A    L+T   +L  D     +N+ LGS  +        P  SC    + +  +     FW+  N  +    +  E     Q I  C+  +A + 
Sbjct:  544 QKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSI----KGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGE---------KGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIG---------PAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA----------------------VHGRAGPPGEKGDQGRSGIDG---RDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKG---DIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGL---------------AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSE-----------------TVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTN--AAIPMMPVENIEIRQYISRCVVCEAPAN 1664          

HSP 2 Score: 242.662 bits (618), Expect = 4.515e-64
Identity = 396/1077 (36.77%), Postives = 479/1077 (44.48%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---RGITGLTGLRGVDGETG-----------PI-------------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG-----FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL----IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-----------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------------------GETGYQGEKGSQ------------GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI-------------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXP--------------IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVN------GQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            + G  G+KGEKG  G  G  G IG +G  G  G  G  G  G  G     G++G+ G+ G PG  G  GS   KGERG  G  G  G      P  P          G  G  G +G+ G+PG  G  G  G+ GDVG K      G  G  G                                            G PG  G  GA GP G  GY G+ G  G+ G+ GP   +G  G TGL G  GE G           P+                   GAEG+ G+ GPKG+ GF G +G SG  G  G PG  G +G  G       GE G  G  G  G  G+ G  G  G PG   L  +     G +GE G  G PGP   PGE G  G+ G  G  GN+GPQG  G++G RG  GP+G +G+ G +G+ G  G  GL+G  G  G+PG  GE                              GFPG  G +G  G  GD G PG  G  G  G+KG +G  G  G  GP G  G+ G  G +G KGE G+ G +G  G+ G RG  GN GP G+ G+ G  G++G  G  G+ G KG  G  G  GN G  G +G PG  GL+G  GD+G  G PG QG  G  G  G+ G  G+ G  G PG+  EKG  G PGPSG  G +G  G  G PG  GLPG +                    G  G  GEKG Q            G VG  GI G PG+ G  G  G  G  G+ GD+G  G PG  G  GLKGE G +G  G+ G  G  G++GI G+ G P  +             GY G  G QG  GL G  G  G  G  G QG  G  G  G  G +G  GP               GL G  G  G  G  G PG IG +G PGL G    +GLPG  G  G +G++G  G  G+ G  G  G  G++G  GP+G  GE G+ G EG  G+ G +GLQG +      GQ+GD G PG  G  G +G PG  G  G  G  G  G  GLPGQ GEPG++
Sbjct:  447 NEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG----YGIQGSKGDAGIPGYPGLKGS---KGERGFKGNAGAPGDSKLGRPGTP----------GAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGT------------------------------------------SGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGP---PGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGML 1461          

HSP 3 Score: 233.802 bits (595), Expect = 2.024e-61
Identity = 368/1039 (35.42%), Postives = 452/1039 (43.50%), Query Frame = 3
Query: 1227 IGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGN---------IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI--GAEGIRG----------------LDGPKGQIGFPGPEGASGKEGEIGP---PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKG----------------------------------AIGNPGPR------GEPGEIGLQGQ---VGIIGRDGNSGPQGDIGMDGDRGPAGPKGP---------------QGDIGK--IGLQGEIGPSGLKGSMGLRGEPGQ---IGESGFPGFY-----GLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG--ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP----RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPG--KVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGD---RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            I  KG +G  GP G  G  G+            MG+ G  GP G+          G RG+ GE+G PGL G  G PG +G  G  G                          G  G  G  G+ G PG++GL+GM G  G  G+ G KG  GE                                    P        KG++GEPG  G  G  GP+GF G  G+ G  G  G KGPRG  GL G +G     GP+  GA GI+G                + GP+G +G  G  G  G++GE GP    G  G +G++G  G  GD G  G  GP G+ G +G  G PG  GL G  G++GE G                                   +G PGP+      G PG  G  GQ    G+ GR GN GP G  G  G  G  GPKG                +GD G    G+QG  G +G+ G  GL+G  G+    G +G PG       G  G  G PG KG+ G  G  GQ+GD G+ GD G        GP G +G+SG  GI G+ G  GP G  G  G RGH      DG  G  G  GEKG  G+ GLPG  G  G          + +               KG+ G PG  G +G QG  G  G  G+PG +G  G +GEKG  G PG  G  G +G  G  G PG  I G PGF G  G +G+KGS G  GE G  G   L   + P    +G  GQTG  G  G+ G PG +G  GLKG  G  GP G  GP GL G +G  G  G  G  G PG  G +G PG  G  GP G+PG  + G  G  G  G +GEKG RG +GPIG  G  GS GY G RG  G  G  G+PG+VG                            +G+ G  G  G+ GP G+ G  G+ G++G  GE G  GL G+ G +GD G PG+   +G  G  G PG+ GP G PG+ G KG+ G  G  G 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGE------------MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAP------------------------GINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE------------------------------------PAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS-CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGH------DGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPL---------------KGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGE---------------------------KGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 4 Score: 227.254 bits (578), Expect = 2.118e-59
Identity = 385/1076 (35.78%), Postives = 472/1076 (43.87%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM------RGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXX--XXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ----------------------------------------IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP---------VGLIGPIGAI--------------------------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR-----GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRG---PAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF------PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGI---KGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI--GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------GETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAP------GLVGVT------GPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGV------KGELGLPGQDGEPGL 4025
             G  G KG+KG  GP+G  GD G+ G  G  G     G  G +GP GN G        G  G+ G PGL G  G PGP+G  G  G +G  G P  +              +G+ G  G +G  G  G QG  G KG  GD G  G KG  GE G  G  G                 K     +  V     ++G +G  G +GEPG +G  G  GP+G  G  G++G +G+ G  G RG  G  G  G  G+ G  G  G+ GL G  GQ                                        +G PGP+G +G +G  GP G+ G +G  G  G  G+ GP          GL GP G+I                          GS+G  G PG  GL+G  G+ G KG  G PG       G PG  G  GQ G  GR G  G +GD+G+ GD G    +   GP+GD G  GL G  G  G +G  G RG PG+ G  G       PG  G  G  GLPG  GEPG          + L GD G  G PG +G  G +G+ G  GI   KGE G  G  G  G+ G  G  G  G DGY G+PG+   GE G  G+ G  G KG  G  G                +   G+ G+ G  G+PG  G  G+ G  G  G +G  G QG P            GE+G +G  G+PG  GK GL GI G  G+PG  G PG S        G  G QGEKG +GP G +G  G  G  GY G R   G  G  G  G+ G+ G +G  G  G  G  GP G PG  G+ G  G  GE G PG +G PGN G +GAP      G  GVT      GP G PG  G +G  G  G  G  G  G  GP G  G +G +G  G  G PG+ G  G PG  G  G PG               + G  G+ G+  E G +G  GP G+ G+ G  G  G PGE G+ GL  V+G+ G PG  GD+G+ G  G  G  G +GE GL+GV      KG +G PG  G PG+
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQ---AGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA---------KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGE--KGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDR---GDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPG---------------LDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGM 1154          

HSP 5 Score: 220.705 bits (561), Expect = 2.028e-57
Identity = 323/906 (35.65%), Postives = 401/906 (44.26%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---------RGITGLTGLRGVDGETGPI---GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---------FSGEKGD---------SGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK-------GAIGNPGPRGEP----------------GEIGLQGQVGIIGRDGNSGPQGDIGMD------------GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGP-----------------------------EGIKGELGNDGPLGFIGSVGIRGHQGNLGPD-----GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK------------------------TGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP--KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL-------PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G PG +G TG  G  GF G  G  G +G +G+ GP         RG  GL G  GV G  GP    GA GI G DG  GQ G PG EG SG  G  G  G +G +G++G           GEKG+         +GP G  G  G  G  G +GA GP G  GL G++G         GA G  G +GEP                G++G +G+ G++GR G  GP+GD G+D            GDRG  G  GP G  G+ G +GE G +GL G+ G +GEPG+ G +                         G  G+ G  G +GL G  G PG  G  GQ+G  GL G  G  G PG +G  G  G +GP                             +G KG+ G  G  G  GS G RG +GN G       G  G PG  G  G KG  G PG  G  G MG       +G  G        G  GDKG  GLPG+      +GP G +G  G+ G  G+ G  G PGE+GE G  G+PG +G+                         G  G++G  G  G+ G+PG  GE G++GEKG  G  G  G  G+ G  GY G  G   KG+ GF G           GAKG KG  G  G  G PG   L        G+KG  G+ G PGP G  G+ G +G  GL G TGP G PG  G                     P GL+G  G +G  G  G+PG  G  G  G+ GR G PG       E      G  G  G+ G +GE G RG  GP G  G  G     G PG+ G  GL GV+G+   PG+ G++G +G IGP G  GP G PG+ GV+G  G  G+ G PGL+
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMG------IKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGR---------DGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEG---------------------PRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGP----RGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV---GYPGDRGDAGLPGVSGR---PGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLV 949          

HSP 6 Score: 196.438 bits (498), Expect = 6.881e-50
Identity = 274/734 (37.33%), Postives = 345/734 (47.00%), Query Frame = 3
Query: 1965 IGAEGIRGLDGP------KGQIGFPGPEGASGKEGEIGPPGFI---GDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL--GLRGLPGDKGEPG-------TDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHN-------------GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT---GLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRV-----GPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQV 4049
            I  +G RGL GP      KG++GFPG EG SG +G+ G PG     GD+G+RG  G  G +G  G+ GP G  G+ G +G  G  G  G+ G EG  G    PGPRG  G++G +G+ G   ++     +G+ G  G RG AG  GPQG  G+ G +G+ GP G KG  G  G  G+ G S     YG +  G  G+ G+KGEP        T    G RGD G  G+ G++         G +G  GPEG  G  G  G  G  G  G RG QGN GP G  G  G+ GE G  G  G PG KG  G  G+ G  G  G  G PG                     G +G  G+ GL GP+G  G  G  G  G PG++G PG++GEKG  G+ GP G     G  G  G  G+ G  GLPG+          G QG  G+ GI G PGL G +G RG KG  G  GD  K G PG  GA G  G++G     G PG  G  GD GI G+VG        G  G +G  GL G+ G  G  G  G++                     G  G  G  G  G  G PG+ G  G+ GL G  G PGKP             +     ++G+KG  G  G  G +G  G  G+ G  G  GE G KG +G++G  G+ G PG  G+ G  G PG+      G  G  G KG KG  G  G+ GEPG   + +I++
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGM---PGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS----CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLV---------GRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGY----------GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDS-KLGRPGTPGAAGAPGQKGDA---GRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER---------------------GYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKP---------ALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM 758          

HSP 7 Score: 149.443 bits (376), Expect = 1.264e-35
Identity = 239/661 (36.16%), Postives = 288/661 (43.57%), Query Frame = 3
Query: 2262 PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXX------------XXXXXXXXXXXXXXXXHN-----GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGP----------------------------VGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---------------PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP-----IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELG---------IKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            P  I  +G  G+ G  G +G +G++G  G  GP+G KG +GD          GP G +G  G RG PG  G++G PG  G  G  G PG  G+ G DG++      G+ G  G+ G PGPRG  G  GS G +G   +   D   G  G  G RG  G  GP G+   PGE GE+G  G  G  G +G  GL G  G                +  +          H      GD G  G PGL G +G  G +GD G  G  G +G PG  G++G  G  GP G TG  G R   G PG+ GLPG  G+ G  G  G+ G                             VG  G  G  G+ G  GP+G  GQ G  G  G+ G  GP G KG KG  G  GP G                 G  GLPG  GI G  GD G  GYPG  G +G  G  G  G      +G+PG  G  G  G +G  G  G  G  G +G+ G VG +      G  G  GT G PG+ G+ G  G P               GE G  G +G  GI G  GP G  GE G TG  G  GE G         I+ L+G  G  G PG  G +G  G+ G PG  GP+GE G KG KG  G PG DG PG
Sbjct:   82 PKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD---------PGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF---PGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDR---GEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG-YGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPP---------------GERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPG 705          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 265.003 bits (676), Expect = 5.334e-71
Identity = 419/1205 (34.77%), Postives = 532/1205 (44.15%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDG------SPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGM---KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIG-NTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP-----VGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGF---YGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG---------------IMGFPGPRGPTGLRGSSGPEGIKGELGN------DGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSG------------KTGLSGIRGITGRPGILGLPGFSGETG---YQGEKGSQGPVGEVGILGKPGL-------GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPG-----NIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSG---EAGITGKEGL---------PGELGIKGLQGVNGQRGDPGLPGDR---------------------------------------------------GKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEML--DELVTKYNKSLGSKEN--------PSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSR 4412
              G  GR G  GQKG  G+ GD+G      + G  G  G  G  G  G  G RG  GE+G PG  GHDG       PG KGE G TG  G  G PG            + GD+G  G  G +G  G  G +GL G+   KG  G  GEKG  GA G DG+ G  G  G  G PG       KG PG  G  G  G  G  G  G++GEPG    +   +  KG  G  G+ G  G  GE G  G  G TGL+G  G  GP G EG RGL+GP+G+          G +G +G PG  G +G RG  G  G  GP     +   GP+G  G  G  G  G  G  G IG  G  G++G PG RG+ G  G+ G+ GI+G  G+ GP G         PAG  GP G  G  G++G  G  G  GS GL G PG  G+ G PG     G  G+ G PG +G  G  G  G +GDKG  G  G               +MG  G +G  G  G  G +G+ GE GN      DGP G  G    +G +G  GP G  G  G  G  G  G++GLPG+                       + G  G  G+KG+ G  G+ G     G +G+ G QG+ G  G PGE+G  G  GIPG  G              G  G RG  G PG+ GLPG  GETG    QG  G+ GP GE GI G+PGL        G +G +G +G TG +G+QG+ G+ GP G  G KG++G  GP G  G +G+PG KG   ++G  G IGYPG       G  G PG  G  G IG PG +G++GL G                 G  G VG  G  GP G  G+ G  G PG  G+ G PG PG+ G  G +G KG +G +G +G KG+ G RGL GP G+ G   + G TG  GL         PGE G  G +G +G+ G PGLPG +                                                   G+ G++G PG  G +GEPG +G +G +GL GQ GEPG      +       + R  + +                  VP+  A    L+T   +L  D     +N+ LGS  +        P  SC    + +  +     FW+  N  +    +  E     Q I  C+  +A + 
Sbjct:  544 QKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSI----KGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGE---------KGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIG---------PAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA----------------------VHGRAGPPGEKGDQGRSGIDG---RDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKG---DIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGL---------------AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSE-----------------TVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTN--AAIPMMPVENIEIRQYISRCVVCEAPAN 1664          

HSP 2 Score: 242.662 bits (618), Expect = 4.515e-64
Identity = 396/1077 (36.77%), Postives = 479/1077 (44.48%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---RGITGLTGLRGVDGETG-----------PI-------------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG-----FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL----IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-----------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------------------GETGYQGEKGSQ------------GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI-------------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXP--------------IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVN------GQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            + G  G+KGEKG  G  G  G IG +G  G  G  G  G  G  G     G++G+ G+ G PG  G  GS   KGERG  G  G  G      P  P          G  G  G +G+ G+PG  G  G  G+ GDVG K      G  G  G                                            G PG  G  GA GP G  GY G+ G  G+ G+ GP   +G  G TGL G  GE G           P+                   GAEG+ G+ GPKG+ GF G +G SG  G  G PG  G +G  G       GE G  G  G  G  G+ G  G  G PG   L  +     G +GE G  G PGP   PGE G  G+ G  G  GN+GPQG  G++G RG  GP+G +G+ G +G+ G  G  GL+G  G  G+PG  GE                              GFPG  G +G  G  GD G PG  G  G  G+KG +G  G  G  GP G  G+ G  G +G KGE G+ G +G  G+ G RG  GN GP G+ G+ G  G++G  G  G+ G KG  G  G  GN G  G +G PG  GL+G  GD+G  G PG QG  G  G  G+ G  G+ G  G PG+  EKG  G PGPSG  G +G  G  G PG  GLPG +                    G  G  GEKG Q            G VG  GI G PG+ G  G  G  G  G+ GD+G  G PG  G  GLKGE G +G  G+ G  G  G++GI G+ G P  +             GY G  G QG  GL G  G  G  G  G QG  G  G  G  G +G  GP               GL G  G  G  G  G PG IG +G PGL G    +GLPG  G  G +G++G  G  G+ G  G  G  G++G  GP+G  GE G+ G EG  G+ G +GLQG +      GQ+GD G PG  G  G +G PG  G  G  G  G  G  GLPGQ GEPG++
Sbjct:  447 NEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG----YGIQGSKGDAGIPGYPGLKGS---KGERGFKGNAGAPGDSKLGRPGTP----------GAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGT------------------------------------------SGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGP---PGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGML 1461          

HSP 3 Score: 233.802 bits (595), Expect = 2.024e-61
Identity = 368/1039 (35.42%), Postives = 452/1039 (43.50%), Query Frame = 3
Query: 1227 IGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGN---------IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI--GAEGIRG----------------LDGPKGQIGFPGPEGASGKEGEIGP---PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKG----------------------------------AIGNPGPR------GEPGEIGLQGQ---VGIIGRDGNSGPQGDIGMDGDRGPAGPKGP---------------QGDIGK--IGLQGEIGPSGLKGSMGLRGEPGQ---IGESGFPGFY-----GLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG--ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP----RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPG--KVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGD---RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            I  KG +G  GP G  G  G+            MG+ G  GP G+          G RG+ GE+G PGL G  G PG +G  G  G                          G  G  G  G+ G PG++GL+GM G  G  G+ G KG  GE                                    P        KG++GEPG  G  G  GP+GF G  G+ G  G  G KGPRG  GL G +G     GP+  GA GI+G                + GP+G +G  G  G  G++GE GP    G  G +G++G  G  GD G  G  GP G+ G +G  G PG  GL G  G++GE G                                   +G PGP+      G PG  G  GQ    G+ GR GN GP G  G  G  G  GPKG                +GD G    G+QG  G +G+ G  GL+G  G+    G +G PG       G  G  G PG KG+ G  G  GQ+GD G+ GD G        GP G +G+SG  GI G+ G  GP G  G  G RGH      DG  G  G  GEKG  G+ GLPG  G  G          + +               KG+ G PG  G +G QG  G  G  G+PG +G  G +GEKG  G PG  G  G +G  G  G PG  I G PGF G  G +G+KGS G  GE G  G   L   + P    +G  GQTG  G  G+ G PG +G  GLKG  G  GP G  GP GL G +G  G  G  G  G PG  G +G PG  G  GP G+PG  + G  G  G  G +GEKG RG +GPIG  G  GS GY G RG  G  G  G+PG+VG                            +G+ G  G  G+ GP G+ G  G+ G++G  GE G  GL G+ G +GD G PG+   +G  G  G PG+ GP G PG+ G KG+ G  G  G 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGE------------MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAP------------------------GINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE------------------------------------PAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS-CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGH------DGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPL---------------KGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGE---------------------------KGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 4 Score: 227.254 bits (578), Expect = 2.118e-59
Identity = 385/1076 (35.78%), Postives = 472/1076 (43.87%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM------RGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXX--XXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ----------------------------------------IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP---------VGLIGPIGAI--------------------------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR-----GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRG---PAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF------PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGI---KGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI--GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------GETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAP------GLVGVT------GPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGV------KGELGLPGQDGEPGL 4025
             G  G KG+KG  GP+G  GD G+ G  G  G     G  G +GP GN G        G  G+ G PGL G  G PGP+G  G  G +G  G P  +              +G+ G  G +G  G  G QG  G KG  GD G  G KG  GE G  G  G                 K     +  V     ++G +G  G +GEPG +G  G  GP+G  G  G++G +G+ G  G RG  G  G  G  G+ G  G  G+ GL G  GQ                                        +G PGP+G +G +G  GP G+ G +G  G  G  G+ GP          GL GP G+I                          GS+G  G PG  GL+G  G+ G KG  G PG       G PG  G  GQ G  GR G  G +GD+G+ GD G    +   GP+GD G  GL G  G  G +G  G RG PG+ G  G       PG  G  G  GLPG  GEPG          + L GD G  G PG +G  G +G+ G  GI   KGE G  G  G  G+ G  G  G  G DGY G+PG+   GE G  G+ G  G KG  G  G                +   G+ G+ G  G+PG  G  G+ G  G  G +G  G QG P            GE+G +G  G+PG  GK GL GI G  G+PG  G PG S        G  G QGEKG +GP G +G  G  G  GY G R   G  G  G  G+ G+ G +G  G  G  G  GP G PG  G+ G  G  GE G PG +G PGN G +GAP      G  GVT      GP G PG  G +G  G  G  G  G  G  GP G  G +G +G  G  G PG+ G  G PG  G  G PG               + G  G+ G+  E G +G  GP G+ G+ G  G  G PGE G+ GL  V+G+ G PG  GD+G+ G  G  G  G +GE GL+GV      KG +G PG  G PG+
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQ---AGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA---------KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGE--KGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDR---GDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPG---------------LDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGM 1154          

HSP 5 Score: 220.705 bits (561), Expect = 2.028e-57
Identity = 323/906 (35.65%), Postives = 401/906 (44.26%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---------RGITGLTGLRGVDGETGPI---GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---------FSGEKGD---------SGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK-------GAIGNPGPRGEP----------------GEIGLQGQVGIIGRDGNSGPQGDIGMD------------GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGP-----------------------------EGIKGELGNDGPLGFIGSVGIRGHQGNLGPD-----GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK------------------------TGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP--KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL-------PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G PG +G TG  G  GF G  G  G +G +G+ GP         RG  GL G  GV G  GP    GA GI G DG  GQ G PG EG SG  G  G  G +G +G++G           GEKG+         +GP G  G  G  G  G +GA GP G  GL G++G         GA G  G +GEP                G++G +G+ G++GR G  GP+GD G+D            GDRG  G  GP G  G+ G +GE G +GL G+ G +GEPG+ G +                         G  G+ G  G +GL G  G PG  G  GQ+G  GL G  G  G PG +G  G  G +GP                             +G KG+ G  G  G  GS G RG +GN G       G  G PG  G  G KG  G PG  G  G MG       +G  G        G  GDKG  GLPG+      +GP G +G  G+ G  G+ G  G PGE+GE G  G+PG +G+                         G  G++G  G  G+ G+PG  GE G++GEKG  G  G  G  G+ G  GY G  G   KG+ GF G           GAKG KG  G  G  G PG   L        G+KG  G+ G PGP G  G+ G +G  GL G TGP G PG  G                     P GL+G  G +G  G  G+PG  G  G  G+ GR G PG       E      G  G  G+ G +GE G RG  GP G  G  G     G PG+ G  GL GV+G+   PG+ G++G +G IGP G  GP G PG+ GV+G  G  G+ G PGL+
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMG------IKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGR---------DGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEG---------------------PRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGP----RGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV---GYPGDRGDAGLPGVSGR---PGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLV 949          

HSP 6 Score: 196.438 bits (498), Expect = 6.881e-50
Identity = 274/734 (37.33%), Postives = 345/734 (47.00%), Query Frame = 3
Query: 1965 IGAEGIRGLDGP------KGQIGFPGPEGASGKEGEIGPPGFI---GDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL--GLRGLPGDKGEPG-------TDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHN-------------GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT---GLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRV-----GPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQV 4049
            I  +G RGL GP      KG++GFPG EG SG +G+ G PG     GD+G+RG  G  G +G  G+ GP G  G+ G +G  G  G  G+ G EG  G    PGPRG  G++G +G+ G   ++     +G+ G  G RG AG  GPQG  G+ G +G+ GP G KG  G  G  G+ G S     YG +  G  G+ G+KGEP        T    G RGD G  G+ G++         G +G  GPEG  G  G  G  G  G  G RG QGN GP G  G  G+ GE G  G  G PG KG  G  G+ G  G  G  G PG                     G +G  G+ GL GP+G  G  G  G  G PG++G PG++GEKG  G+ GP G     G  G  G  G+ G  GLPG+          G QG  G+ GI G PGL G +G RG KG  G  GD  K G PG  GA G  G++G     G PG  G  GD GI G+VG        G  G +G  GL G+ G  G  G  G++                     G  G  G  G  G  G PG+ G  G+ GL G  G PGKP             +     ++G+KG  G  G  G +G  G  G+ G  G  GE G KG +G++G  G+ G PG  G+ G  G PG+      G  G  G KG KG  G  G+ GEPG   + +I++
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGM---PGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS----CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLV---------GRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGY----------GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDS-KLGRPGTPGAAGAPGQKGDA---GRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER---------------------GYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKP---------ALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM 758          

HSP 7 Score: 149.443 bits (376), Expect = 1.264e-35
Identity = 239/661 (36.16%), Postives = 288/661 (43.57%), Query Frame = 3
Query: 2262 PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXX------------XXXXXXXXXXXXXXXXHN-----GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGP----------------------------VGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---------------PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP-----IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELG---------IKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            P  I  +G  G+ G  G +G +G++G  G  GP+G KG +GD          GP G +G  G RG PG  G++G PG  G  G  G PG  G+ G DG++      G+ G  G+ G PGPRG  G  GS G +G   +   D   G  G  G RG  G  GP G+   PGE GE+G  G  G  G +G  GL G  G                +  +          H      GD G  G PGL G +G  G +GD G  G  G +G PG  G++G  G  GP G TG  G R   G PG+ GLPG  G+ G  G  G+ G                             VG  G  G  G+ G  GP+G  GQ G  G  G+ G  GP G KG KG  G  GP G                 G  GLPG  GI G  GD G  GYPG  G +G  G  G  G      +G+PG  G  G  G +G  G  G  G  G +G+ G VG +      G  G  GT G PG+ G+ G  G P               GE G  G +G  GI G  GP G  GE G TG  G  GE G         I+ L+G  G  G PG  G +G  G+ G PG  GP+GE G KG KG  G PG DG PG
Sbjct:   82 PKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD---------PGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF---PGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDR---GEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG-YGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPP---------------GERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPG 705          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 265.003 bits (676), Expect = 5.334e-71
Identity = 419/1205 (34.77%), Postives = 532/1205 (44.15%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDG------SPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGM---KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIG-NTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP-----VGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGF---YGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG---------------IMGFPGPRGPTGLRGSSGPEGIKGELGN------DGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSG------------KTGLSGIRGITGRPGILGLPGFSGETG---YQGEKGSQGPVGEVGILGKPGL-------GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPG-----NIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSG---EAGITGKEGL---------PGELGIKGLQGVNGQRGDPGLPGDR---------------------------------------------------GKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEML--DELVTKYNKSLGSKEN--------PSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSR 4412
              G  GR G  GQKG  G+ GD+G      + G  G  G  G  G  G  G RG  GE+G PG  GHDG       PG KGE G TG  G  G PG            + GD+G  G  G +G  G  G +GL G+   KG  G  GEKG  GA G DG+ G  G  G  G PG       KG PG  G  G  G  G  G  G++GEPG    +   +  KG  G  G+ G  G  GE G  G  G TGL+G  G  GP G EG RGL+GP+G+          G +G +G PG  G +G RG  G  G  GP     +   GP+G  G  G  G  G  G  G IG  G  G++G PG RG+ G  G+ G+ GI+G  G+ GP G         PAG  GP G  G  G++G  G  G  GS GL G PG  G+ G PG     G  G+ G PG +G  G  G  G +GDKG  G  G               +MG  G +G  G  G  G +G+ GE GN      DGP G  G    +G +G  GP G  G  G  G  G  G++GLPG+                       + G  G  G+KG+ G  G+ G     G +G+ G QG+ G  G PGE+G  G  GIPG  G              G  G RG  G PG+ GLPG  GETG    QG  G+ GP GE GI G+PGL        G +G +G +G TG +G+QG+ G+ GP G  G KG++G  GP G  G +G+PG KG   ++G  G IGYPG       G  G PG  G  G IG PG +G++GL G                 G  G VG  G  GP G  G+ G  G PG  G+ G PG PG+ G  G +G KG +G +G +G KG+ G RGL GP G+ G   + G TG  GL         PGE G  G +G +G+ G PGLPG +                                                   G+ G++G PG  G +GEPG +G +G +GL GQ GEPG      +       + R  + +                  VP+  A    L+T   +L  D     +N+ LGS  +        P  SC    + +  +     FW+  N  +    +  E     Q I  C+  +A + 
Sbjct:  544 QKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSI----KGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGE---------KGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIG---------PAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA----------------------VHGRAGPPGEKGDQGRSGIDG---RDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKG---DIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGL---------------AGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSE-----------------TVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTN--AAIPMMPVENIEIRQYISRCVVCEAPAN 1664          

HSP 2 Score: 242.662 bits (618), Expect = 4.515e-64
Identity = 396/1077 (36.77%), Postives = 479/1077 (44.48%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---RGITGLTGLRGVDGETG-----------PI-------------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG-----FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL----IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-----------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------------------GETGYQGEKGSQ------------GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI-------------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXP--------------IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVN------GQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            + G  G+KGEKG  G  G  G IG +G  G  G  G  G  G  G     G++G+ G+ G PG  G  GS   KGERG  G  G  G      P  P          G  G  G +G+ G+PG  G  G  G+ GDVG K      G  G  G                                            G PG  G  GA GP G  GY G+ G  G+ G+ GP   +G  G TGL G  GE G           P+                   GAEG+ G+ GPKG+ GF G +G SG  G  G PG  G +G  G       GE G  G  G  G  G+ G  G  G PG   L  +     G +GE G  G PGP   PGE G  G+ G  G  GN+GPQG  G++G RG  GP+G +G+ G +G+ G  G  GL+G  G  G+PG  GE                              GFPG  G +G  G  GD G PG  G  G  G+KG +G  G  G  GP G  G+ G  G +G KGE G+ G +G  G+ G RG  GN GP G+ G+ G  G++G  G  G+ G KG  G  G  GN G  G +G PG  GL+G  GD+G  G PG QG  G  G  G+ G  G+ G  G PG+  EKG  G PGPSG  G +G  G  G PG  GLPG +                    G  G  GEKG Q            G VG  GI G PG+ G  G  G  G  G+ GD+G  G PG  G  GLKGE G +G  G+ G  G  G++GI G+ G P  +             GY G  G QG  GL G  G  G  G  G QG  G  G  G  G +G  GP               GL G  G  G  G  G PG IG +G PGL G    +GLPG  G  G +G++G  G  G+ G  G  G  G++G  GP+G  GE G+ G EG  G+ G +GLQG +      GQ+GD G PG  G  G +G PG  G  G  G  G  G  GLPGQ GEPG++
Sbjct:  447 NEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG----YGIQGSKGDAGIPGYPGLKGS---KGERGFKGNAGAPGDSKLGRPGTP----------GAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGT------------------------------------------SGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGP---PGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGML 1461          

HSP 3 Score: 233.802 bits (595), Expect = 2.024e-61
Identity = 368/1039 (35.42%), Postives = 452/1039 (43.50%), Query Frame = 3
Query: 1227 IGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGN---------IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI--GAEGIRG----------------LDGPKGQIGFPGPEGASGKEGEIGP---PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKG----------------------------------AIGNPGPR------GEPGEIGLQGQ---VGIIGRDGNSGPQGDIGMDGDRGPAGPKGP---------------QGDIGK--IGLQGEIGPSGLKGSMGLRGEPGQ---IGESGFPGFY-----GLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG--ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP----RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPG--KVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGD---RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            I  KG +G  GP G  G  G+            MG+ G  GP G+          G RG+ GE+G PGL G  G PG +G  G  G                          G  G  G  G+ G PG++GL+GM G  G  G+ G KG  GE                                    P        KG++GEPG  G  G  GP+GF G  G+ G  G  G KGPRG  GL G +G     GP+  GA GI+G                + GP+G +G  G  G  G++GE GP    G  G +G++G  G  GD G  G  GP G+ G +G  G PG  GL G  G++GE G                                   +G PGP+      G PG  G  GQ    G+ GR GN GP G  G  G  G  GPKG                +GD G    G+QG  G +G+ G  GL+G  G+    G +G PG       G  G  G PG KG+ G  G  GQ+GD G+ GD G        GP G +G+SG  GI G+ G  GP G  G  G RGH      DG  G  G  GEKG  G+ GLPG  G  G          + +               KG+ G PG  G +G QG  G  G  G+PG +G  G +GEKG  G PG  G  G +G  G  G PG  I G PGF G  G +G+KGS G  GE G  G   L   + P    +G  GQTG  G  G+ G PG +G  GLKG  G  GP G  GP GL G +G  G  G  G  G PG  G +G PG  G  GP G+PG  + G  G  G  G +GEKG RG +GPIG  G  GS GY G RG  G  G  G+PG+VG                            +G+ G  G  G+ GP G+ G  G+ G++G  GE G  GL G+ G +GD G PG+   +G  G  G PG+ GP G PG+ G KG+ G  G  G 
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGE------------MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAP------------------------GINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGE------------------------------------PAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS-CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGH------DGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPL---------------KGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGE---------------------------KGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGN 1002          

HSP 4 Score: 227.254 bits (578), Expect = 2.118e-59
Identity = 385/1076 (35.78%), Postives = 472/1076 (43.87%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM------RGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXX--XXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ----------------------------------------IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP---------VGLIGPIGAI--------------------------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR-----GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRG---PAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF------PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGI---KGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI--GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS--------GETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAP------GLVGVT------GPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGV------KGELGLPGQDGEPGL 4025
             G  G KG+KG  GP+G  GD G+ G  G  G     G  G +GP GN G        G  G+ G PGL G  G PGP+G  G  G +G  G P  +              +G+ G  G +G  G  G QG  G KG  GD G  G KG  GE G  G  G                 K     +  V     ++G +G  G +GEPG +G  G  GP+G  G  G++G +G+ G  G RG  G  G  G  G+ G  G  G+ GL G  GQ                                        +G PGP+G +G +G  GP G+ G +G  G  G  G+ GP          GL GP G+I                          GS+G  G PG  GL+G  G+ G KG  G PG       G PG  G  GQ G  GR G  G +GD+G+ GD G    +   GP+GD G  GL G  G  G +G  G RG PG+ G  G       PG  G  G  GLPG  GEPG          + L GD G  G PG +G  G +G+ G  GI   KGE G  G  G  G+ G  G  G  G DGY G+PG+   GE G  G+ G  G KG  G  G                +   G+ G+ G  G+PG  G  G+ G  G  G +G  G QG P            GE+G +G  G+PG  GK GL GI G  G+PG  G PG S        G  G QGEKG +GP G +G  G  G  GY G R   G  G  G  G+ G+ G +G  G  G  G  GP G PG  G+ G  G  GE G PG +G PGN G +GAP      G  GVT      GP G PG  G +G  G  G  G  G  G  GP G  G +G +G  G  G PG+ G  G PG  G  G PG               + G  G+ G+  E G +G  GP G+ G+ G  G  G PGE G+ GL  V+G+ G PG  GD+G+ G  G  G  G +GE GL+GV      KG +G PG  G PG+
Sbjct:  112 EGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQ---AGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA---------KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGE--KGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDR---GDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPG---------------LDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLA-VHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGM 1154          

HSP 5 Score: 220.705 bits (561), Expect = 2.028e-57
Identity = 323/906 (35.65%), Postives = 401/906 (44.26%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---------RGITGLTGLRGVDGETGPI---GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---------FSGEKGD---------SGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK-------GAIGNPGPRGEP----------------GEIGLQGQVGIIGRDGNSGPQGDIGMD------------GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES-------------------------GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGP-----------------------------EGIKGELGNDGPLGFIGSVGIRGHQGNLGPD-----GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK------------------------TGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP--KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL-------PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G PG +G TG  G  GF G  G  G +G +G+ GP         RG  GL G  GV G  GP    GA GI G DG  GQ G PG EG SG  G  G  G +G +G++G           GEKG+         +GP G  G  G  G  G +GA GP G  GL G++G         GA G  G +GEP                G++G +G+ G++GR G  GP+GD G+D            GDRG  G  GP G  G+ G +GE G +GL G+ G +GEPG+ G +                         G  G+ G  G +GL G  G PG  G  GQ+G  GL G  G  G PG +G  G  G +GP                             +G KG+ G  G  G  GS G RG +GN G       G  G PG  G  G KG  G PG  G  G MG       +G  G        G  GDKG  GLPG+      +GP G +G  G+ G  G+ G  G PGE+GE G  G+PG +G+                         G  G++G  G  G+ G+PG  GE G++GEKG  G  G  G  G+ G  GY G  G   KG+ GF G           GAKG KG  G  G  G PG   L        G+KG  G+ G PGP G  G+ G +G  GL G TGP G PG  G                     P GL+G  G +G  G  G+PG  G  G  G+ GR G PG       E      G  G  G+ G +GE G RG  GP G  G  G     G PG+ G  GL GV+G+   PG+ G++G +G IGP G  GP G PG+ GV+G  G  G+ G PGL+
Sbjct:   90 NRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMG------IKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGR---------DGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEG---------------------PRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGP----RGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV---GYPGDRGDAGLPGVSGR---PGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLV 949          

HSP 6 Score: 196.438 bits (498), Expect = 6.881e-50
Identity = 274/734 (37.33%), Postives = 345/734 (47.00%), Query Frame = 3
Query: 1965 IGAEGIRGLDGP------KGQIGFPGPEGASGKEGEIGPPGFI---GDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL--GLRGLPGDKGEPG-------TDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHN-------------GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT---GLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRV-----GPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQV 4049
            I  +G RGL GP      KG++GFPG EG SG +G+ G PG     GD+G+RG  G  G +G  G+ GP G  G+ G +G  G  G  G+ G EG  G    PGPRG  G++G +G+ G   ++     +G+ G  G RG AG  GPQG  G+ G +G+ GP G KG  G  G  G+ G S     YG +  G  G+ G+KGEP        T    G RGD G  G+ G++         G +G  GPEG  G  G  G  G  G  G RG QGN GP G  G  G+ GE G  G  G PG KG  G  G+ G  G  G  G PG                     G +G  G+ GL GP+G  G  G  G  G PG++G PG++GEKG  G+ GP G     G  G  G  G+ G  GLPG+          G QG  G+ GI G PGL G +G RG KG  G  GD  K G PG  GA G  G++G     G PG  G  GD GI G+VG        G  G +G  GL G+ G  G  G  G++                     G  G  G  G  G  G PG+ G  G+ GL G  G PGKP             +     ++G+KG  G  G  G +G  G  G+ G  G  GE G KG +G++G  G+ G PG  G+ G  G PG+      G  G  G KG KG  G  G+ GEPG   + +I++
Sbjct:   85 IAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGM---PGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGAS----CYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLV---------GRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGY----------GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDS-KLGRPGTPGAAGAPGQKGDA---GRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER---------------------GYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKP---------ALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKM 758          

HSP 7 Score: 149.443 bits (376), Expect = 1.264e-35
Identity = 239/661 (36.16%), Postives = 288/661 (43.57%), Query Frame = 3
Query: 2262 PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXX------------XXXXXXXXXXXXXXXXHN-----GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGP----------------------------VGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---------------PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP-----IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELG---------IKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            P  I  +G  G+ G  G +G +G++G  G  GP+G KG +GD          GP G +G  G RG PG  G++G PG  G  G  G PG  G+ G DG++      G+ G  G+ G PGPRG  G  GS G +G   +   D   G  G  G RG  G  GP G+   PGE GE+G  G  G  G +G  GL G  G                +  +          H      GD G  G PGL G +G  G +GD G  G  G +G PG  G++G  G  GP G TG  G R   G PG+ GLPG  G+ G  G  G+ G                             VG  G  G  G+ G  GP+G  GQ G  G  G+ G  GP G KG KG  G  GP G                 G  GLPG  GI G  GD G  GYPG  G +G  G  G  G      +G+PG  G  G  G +G  G  G  G  G +G+ G VG +      G  G  GT G PG+ G+ G  G P               GE G  G +G  GI G  GP G  GE G TG  G  GE G         I+ L+G  G  G PG  G +G  G+ G PG  GP+GE G KG KG  G PG DG PG
Sbjct:   82 PKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD---------PGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGF---PGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDR---GEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPG-YGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPP---------------GERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPG 705          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 231.106 bits (588), Expect = 1.764e-60
Identity = 357/1001 (35.66%), Postives = 460/1001 (45.95%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRG------NTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNG--------MKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALG-----PKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVD------------GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGP--------PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGS---------QGSHGAPGPIGLQGL---IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI-----------GMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPG------DKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVG------------------ILGKPG----------LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDI 4043
            GY G RG  G  G+RG      N G +GP G  G  G PG  G RG  G  G  G  G  G PG  G       +G  GP G  GE GK G  G +G         KG +GD G+ GH+G  G+DG  G  G  G  GE G  G  G  G  G  G                 GEPG  G  GA G     PK ++  +G+ G  G++GE+G  G TG  G++G              GE G  G +G++G  G +G IG  G  G  G  GE+ P        PG  GD G++G  G  G  G  GL G IG  G          QG  G PG  G++G    +G  G+ G  G PGP+G  GE G  G VG  G  GN G +GD            G +G + P G KG +G++G +G  G+   +G KGS+G  G  G +G +G  G  G  G+ GLPG      ++GE G +G +G  G +G  G+FG  G  G  GP G  G++G  G KGE GN G  G  G+ G+  + G  G DG  GL G IG  G       PG KG  G +G      +                G KG +G PG  G  G  G  G  G +G+PG QG PGE G KG  G PG   + G++G++G TG PG  G  G  GE+G  G  G  G +G+ G                   +G PG            G+ G +G +G+ G +GD G  G  GP GAKG +G+ GY G  G+ G  GL G +G  G  G PG I  P   G +G   + G+ G  G+PG  G++G  G               P G +G  G+ G+ GP+        QG PG  G +G PG PG +G  G            + G KGE G  G  G RG SG A I G++G  G++G +G  G +G +G+ G PG  GK G +G PG  GP G+ G  G+ G  GL G  G+PG+     +
Sbjct:  510 GYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAG------HKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGR---------------DGEPGRDGRDGAPGRNATTPKVYL--IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQ---NGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGA------PGAKGQRGPVGDSQPALDGVA-------------GRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPG---RNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPG-ITLPAEKGDEG---VAGLDGRAGRPGHFGQKGAPG---------------PPGENGPNGAIGHRGPQ-------IQGPPGPQGDVGFPGAPGHNGRHG------------LIGPKGELGDMGRQGERGESGYA-IVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSM 1423          

HSP 2 Score: 226.868 bits (577), Expect = 3.233e-59
Identity = 395/1235 (31.98%), Postives = 536/1235 (43.40%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGL------VGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRG-----ITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ------IGFPGPEGASGKE---GEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL-----------------------------QGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKG---------------DHGIPGP----------SGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF-----EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKG--ISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR---GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIG---SIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVM----VIPNNVPSIGAVLNRL------FTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIK-TCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNY 4631
            G+ GR G KG  GP G+ G+ GKVG  G +G    +G    +G  G+ G  G+ G+ G  G  G DGS G KGERG TG                         RG  G  G QG  G+PG  G +G  G       V  +GE G+ G  GE                        +G  G+ G  G  G      I  + GEPG  G TG   PKG  G  G++GA G++GE G RG     I G  G +G  G TG  G +G  GL G  G+      IG+ G  G  G+E   GEIGPPG  G +G  G  G  G  G  G  GP G  G QG  GA G  GL                              G  G++GE G++G  G  G  G IG  G+ G++G  G  G  G  G+ G  G  G  G +G+IG  G QG+IGP G  G  G +G  G  G  G+PG  GL G +G  G+ G PG  G +G     G+ GD G  G     GP G  G+ G +G +G +G+  P       G+ G +G +G  G  GLPG  G KG +G RGLPG +G  G  G+ G  G  G  G          NG KG  G PG QGP+G QG  G VG   + G  G  G+QG +G               + GIPG            G TG  G++G  G  G +G  GF G  G +GE+G  G  G++G  G  GL G+QG +GP+G  G      +GD+G  G+ G  G  G  G++G  GP G  GP+G  G +G  I G  G  G +G+PG  G  G  GL+G  G +G  G+ G++G  G                +G  G +G  G+ G  G  G  G QG PGL G+ G  G PG  G  GD G  G+ G  G+ G KG+ G+     +  P G  GE G+ G +G  G+ G  GL G  GQRG  G  GD+G++G   + GP G+ G +G  GL G  G  GLPG  GEP          G   F+  R  +     +   + +++     +  NV +  AV   L        R   +  ++          +N   S   +++ + + +      + P  G       + C   E   +   + +Q+ S       + +      +++S L +  G     ++  +       L+E   +A+  I         Y+D+    +
Sbjct:  570 GNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETG------------------------QRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGE------------------------RGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGL---TGPIGYPGAPGAKGQRGPVGDSQPA----LDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGI---------NGLKGATGFPGPQGPKGPQGESGVVG---LDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAI-------------VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARP-GDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRG---FIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDS---LWLSTAEPMP---MTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSC------LEEF--RAQPVIECHGHGRCNYYDALASFW 1702          

HSP 3 Score: 211.075 bits (536), Expect = 2.517e-54
Identity = 296/797 (37.14%), Postives = 370/797 (46.42%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI----------GAEGIRGLDGPKGQIGFPGPEGASGKEGEI---GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGP------RGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL--GPDGYIGLPGEIGEKGTKGKRGLPG------------IKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRG---NQGSDGDVGRQGMPGSQGSPGE--------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRG-----IPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             GEPG       +GPKG  G  G+ G   ++G +G RG  GL G +G+ GE   I          G  G+ G DG  G  G PG +G  G +  +   GP G  G EG  G+ G  G+ G +GL GP G  G QG+ G  G  GL G  G  GE G +G  GP G+  E+G   + G IG  G+SG +GD G DG++G  G  G +G+ G+ G +G+ G +G +G     GEPG+ G  G PG         L    GEPG DG +G+RGD G  G  G+ G P P       G  G  G +GP+G+KG  G  G +G  G +G RG  G +  GP G  G PG  G+ G +G  GLPG             KG  G+ G    QG  G  G+ GI G  G  G  G  GL G  GP+G    QG DG VG+ G+PG++G  G+               G +  HG  G  G+ G  G  G  G  G +G   FSG  G  G  G QG  G  GI   PGL G  G  G +G+ G+ G QG  G  GP G  G KG  G  GP+GYPG +GLPG KG   E G+PG   +PG  G +G     G+ G  G+ G  G                     PIG  G  G++G  GP G     + G  G +G+ G  G  GLPG+                      G KG+ G RGL G +G  GE G  G  G PG  GI GL+G        G P         GP G  GPQGE G+ G+ G  G  G  G  GLI
Sbjct:  443 HGEPG----QNVVGPKGEPGLNGQPG---LEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGR---DGEPGRDGRDGAPGRNATTPKVYL---IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIG---FSGRRGLLGNAGLQGLPGSPGI---PGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKG---ETGNPG---FPGRPGAKGVAAYSGIKGDDGESGLTG---------------------PIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGR---------------------HGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGAT------GFP---------GPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLI 1156          

HSP 4 Score: 209.149 bits (531), Expect = 9.143e-54
Identity = 312/782 (39.90%), Postives = 381/782 (48.72%), Query Frame = 3
Query: 1848 KGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGA---SGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGP--------QGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS--GLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGD----------------KGEPGTDGEEGQR---GDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG---------ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG--YPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXX--------XXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLP------GDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            KG+ GYVG +G  G QG  G +G  G  GL G  GE G  G  G  G DG  G+ G  G +GA   +G +G  G PG  G++G  G  G +G +GP G+  P        +   PGPIG QG IG  GE+G  G PG  G  G IGL GQ G  G +G+ GP         GD G  G  GP GP G  G  G+ GL GE G +  G KG  GL G+PG  G  G  G  GL G +GLPG+                +G PG DG  G R   G+KGL GD   +   GPRGP   RG  G  G  G  GN G +G  G  G++G QGN G  G+ GLPG  G  G  GK G  G  G +  +GS                        KG IG  G  G RG+ G DG+ GR G  GS+G  GE G++GD+G  G  G+ G  G  G  G PG         ++G PG+    G +GE+G  G  G  G+ G+P  G      G  G+ G+ G +G  G  G QGA GL+GE G  GP G   PGP G    KG  G  GD G  G PG  GR G PGL G  G  G+ G  G++ + G  G  G  G++G  G +G  G  G  G  GP+G+ G+   QG  G VG+ GLPG  G  G         +G  G  G +   G +G KGE G  G  G  G  G  G +G+ GL   LG  GLQG+ G  G PGLP      G+RG+IG  G  G +GP+G  G  G KG  G  G DG PG
Sbjct:  252 KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDP------SLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGP---RGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLR----------------------KGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYD---GIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGA---KGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGE---QGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGL---LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPG 990          

HSP 5 Score: 194.512 bits (493), Expect = 2.844e-49
Identity = 352/1004 (35.06%), Postives = 438/1004 (43.63%), Query Frame = 3
Query: 1344 RGPRGNIGMRGNTGEQGPPGLMGHDGSPG-----------PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGP------------------------KGQIGFPGPEGASGKEGEIGPPGF-----IGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH-----GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGE-------------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGP---AGPKGPQGDIGKIGL------QGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGD--KGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGE---------IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG--MP---GSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPG---FSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPG--------------------------PQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPR--GMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDG 4013
            RG +G+ G  G TGE+G PGL G  G  G           P G +G  G          D   G +G  G+ GD G  GP G QG +G+      NG+ G  G++G  G +G  G+D                                                GEPG  G+ G    KG  G+ G +G  G  GE+G  G TG+ G++G  G  G       + L GP                        +G IG  G  G  G  G  GPPG       GD G  G  G +G  G  GL G  G  G  G +     G PG  G  GL G  G++G +G PG +G PGE              G +G  G  G +G  G  G+ G+ GD  P   AGP+GP+G  G  G       +G IG +G +G  GL+G PG+ G  G P   G  G+ G PG  G  G DG+  + G   KG +GD G  G  G  G  G +G  G +G KGE G  G  G  G  G +G  G  G DG  G PG          IGE G  G +G  G  G +G  G  G      I    G  G  G+ G KG  G  G QG  G +G  GD G  G  +P   G++G PG  G+ G  G PG  G+ G  G+ G  G  G  G+PG     GE G  G  G +G  G+VG  G+ GL G  GP+G KG+ G +G  G+ G+PG                          P GAKG KGE G +G NG  G  G  G  G  G +G+ G  G PG+ G  G PG++G  G  G+ G  G+Q      G  G +G  G  GP GLSG  G  GY G  G+PG+ G  G PG  GR G  G     G +GD GE G+ G  G  G  G  G RG VG     + G AG  G+ G PG  G+ G  G+ GQRGD GLPG +G+ G  G  G  G  G  G+ G+KG  G PG  G
Sbjct:  190 RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGR------NGLPGARGEIGGPGERGKPGKD------------------------------------------------GEPGRFGDKGM---KGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLP---GPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQ------GDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQG 1127          

HSP 6 Score: 193.741 bits (491), Expect = 4.060e-49
Identity = 291/781 (37.26%), Postives = 379/781 (48.53%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPG--------------FIGDEGKRGFSGEK------------GDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGN-SGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGI--KGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKG-NI----GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF---EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIG--RQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP-----PGRVGPQGEPGLKGVKGEL---GLPGQDGEPGL 4025
            G  G LG KG +G  G++G +G +G+ GP+G  G  G+ G  GE G     G RG+DG  G+ G  GP GA G+ G  GPPG               I  +G +G  GE             GD G  G  G  G  G +G  G PGP G  G +  E     IG PG +GEPG+       G++  D    G +G +G+ GD GP GP G QG +G+ GL       G +G +G  GE G+ G+ G PG +G  G++G PG  G  G DG  G+RG+ G  G  G+ G     GP G+   S  + + G +G+ G +G  G  G  G  G  G  G IGL G+ G+ G  G RG PG   +G +G  G  G  G QG  G+ G+ G  G +G+ G N+    G PGL G  G +G  GD G  G+PG +G PGE      + I GP G  G  G RG+ G  G  GL G  GE G +G+     PV   G          +GPRG +G TG+    G++G  G+ GP+G +GL+G  G  G  G PGP G+PG+    G+VG  GP G    +G  R+G  G  G +G  G  G  G++G                    G  G+ G +G  G RG  G  G QG+ G  GR G  G PG +         G  G  GI+G +G+ G  G  G +G      I    G PGE G  G +GV G +G+ G  G RG+IG  GP     PG VG +G PG  G  G+    GLPG+DGEPGL
Sbjct:   69 GRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPG---TPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAV-SELPYSLIGPPGAKGEPGDS----LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGG---AGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-----GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGD---DCPVCNAGP---------RGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGE---PGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRD------------------GSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGL 794          

HSP 7 Score: 193.741 bits (491), Expect = 4.308e-49
Identity = 304/838 (36.28%), Postives = 375/838 (44.75%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPG------PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP------RGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEG---ARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---------------RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQ--GLIGKEGEKGAIGNPGPRGEPGEIGLQGQVG------------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGL---------------RGEPGQIGE-------SGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG-----IKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGD------KGNIGLPGLQGPRGN--------QGSDGDVGRQGMPGSQGSPGEQG------EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGET--------GYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD 3404
            ++G  G KG KG++G  GL G+IG  G  G+     P+G  G+ GP G+ G      +QG PGL G DG PG       KG+RG+ G +                       +G+IGP      +G  G++G PG  GL G  G  G  GE+G  GA+G+ G  G  G RG       G                +            +GE G +G  G  G KG IG+ G+ G     G+QG  G  GI GL G+ G  GE G IG  G                +GL G  G  G+PG  G  G++GE G PGF G  G +G   +SG KGD G  GL GPIG  G+ G+ G  GP+G     L G  G KG +G+PGP G PG  GL+GQ G                  + G  G +G  G  G  G  GP GPKGPQG+ G +GL G  G  G +G  GL                G PG++          GF G  GL G RG  GD G  G  G  G +G++G +G  G +GF G  G  G +G  GP G     +  E G++G  G  G  G  GH    G  G  G PGE G  G  G RG P I+GP G  G  G  G  G            HNG       KG +G  G QG RG         QG  GD+G QG PG  G+ GEQG      + G  G PGP G TG +G  GI G  G++G  G  G T        G +GE G  G  GE G  G PGL G+QG RG     G+ GDQG+ G        G  G QG  G  GY G  G PG +G+ G  G+
Sbjct:  729 YTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPG-PVGAKGYPGPTGDYG------QQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVI---------------------QGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG----------QKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGH---FGQKGAPGPPGENGPNGAIGHRG-PQIQGPPGPQGDVGFPGAPG------------HNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG---AVGYRGDQGEVGY------TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 8 Score: 142.51 bits (358), Expect = 1.724e-33
Identity = 260/712 (36.52%), Postives = 336/712 (47.19%), Query Frame = 3
Query: 2157 GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM------DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL--RGLPGDKGEPGTD------------GEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSS-----GPEGIKGELGN---------DGPLGFIGSVGIRGHQGNLGPDG------YIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE---------------QGEKGDHGIPGPSGKTGLSGIRGITGRP-----------------GILGLPGFSGETGYQGEKGSQ--GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK----FGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRG---KIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIID 4040
            G +G  GAPGPIG+ GL G  G+ G  G  GP GE G++G  G+ G  G  G+ GP+G++G        G+ G  GP+G  G  G+ G+QG   PSG  G  G+RG PG+ G+ G PG  G  G+  +G  G++GE G              G +G  G  GL G+ G  G PGP+G TG          GP G KGE G+         D   G+ G VG++G +G  GP G        GLPG  GE G  G+RG PG  G  G  G  G +G  G  G  G+ G  G  G+ G  G+PG+QG  G  G       + +PG  GS G+                G +G  G+ G SG  GL+G RG  GR                  G  G  G  G  G  GE G    GP GE G+ G+PGL GY   RG +G+ G  GD+G     + + GP G++G  G +G  G +GY G  GLPG+KG+ G+   V + GP G  G  G  G PG  G  G IG  G                        P G+ G  G+ G  G +G+PG  G  G+PG VG  G  GK  I+     KGE G  G+SG +G+ G+ G +G  G  G  GE G TG+ G  G+ G +G  G  G+ G  G PG      K+  IG PG  G +GE   +G  G+ G  G  GEP   +I D
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQG---PSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY---RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG------------------------PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGK-AIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGE---RGDDGDTGFKGVKGEPNPGQIYD 719          

HSP 9 Score: 119.783 bits (299), Expect = 1.489e-26
Identity = 210/589 (35.65%), Postives = 259/589 (43.97%), Query Frame = 3
Query: 2568 RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPG---EIGEKGTKGKRGL------PGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQ--------------GPRGNQGSDGDVG---------RQGMPGSQGSPGEQGEKGDHGIPGPSGKTG--------LSGIRGITGRPG-----IL----GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXX---XXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI-----------------GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXX--XXXIQGNKGETGI---RGLVGP----------------RGMSGEAGITGKEGLPGELGIKGL---------QGVNGQRGDPGLPG---DRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            +G KG +G  G +G PG  GP G     GP G  G LG  G +G  G  G +GH+G++GP G +G PG   + GE GT G RG+      PG++GPSG  G                      NG +G  G PG Q              G +GN+G  G  G          +G  G  G  G  GEKGD G+PGP G TG        L G  G  G PG     +L     L G+ G  G QG++G QGP GE G +G+ GL    G RG  G  G  G  GK G PG  G KG+KG  G+ G +G           G  GE G+ G  G PG  G  G PG+   +     PG +G QG     G +G  G  G  G  GPIGL+G  G  G  G RG PG+                  G  G+ GL GR GL G+PG +                 G +G++GE G+   +GL G                 RG+ G+ G  G  GLPGE G++G          +G  GQ GD G PG   +RG IG  GP G  G QG PG  G KG  G  G  GEPG +
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAG---DIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPG---------------------QNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL---PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGL---------DGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKV 593          

HSP 10 Score: 100.908 bits (250), Expect = 8.748e-21
Identity = 194/569 (34.09%), Postives = 233/569 (40.95%), Query Frame = 3
Query: 2658 EGIKGELGNDGPLG---FIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR---------GLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ--------------------------------------------GSPGEQGEKGDHGIPGPSGKTG--------LSGIRGITGRP-----GIL----GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXX---XXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI-----------------GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR---GLVGPRGMSGEAGITGKEGLPGE-------------LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            +GIKG +G  GP+G     G  G  G  G  GP G  G  GE GE+G KG R         G PGI G SG  G+PG                    G  G  G PG+QGP G  G +G  G  G PG Q                                            G  G  GEKGD G+PGP G TG        L G  G  G P     G+L     L G+ G  G QG++G QGP GE G +G+ GL    G RG  G  G  G  GK G PG  G KG+KG  G+ G +G           G  GE G+ G  G PG  G  G PG+   +     PG +G QG     G +G  G  G  G  GPIGL+G  G  G  G RG PG+                  G  G+ GL GR GL G+P                   + G KGE G+    GL G RG  GE G+ G +GLPGE              G +GL G +G  G  GLPG++G  G   P    GP+G    +G +G+ G PG  G  G I + 
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGP------------------RGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL---PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGL---------DGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEP----------------GQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGP---RGQEGDTGYPGSHGNRGAIGLT 560          

HSP 11 Score: 87.4261 bits (215), Expect = 1.038e-16
Identity = 123/312 (39.42%), Postives = 155/312 (49.68%), Query Frame = 3
Query: 3162 KGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKV--------------GKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRI--GLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIID 4040
            KG +G +G  G +G PGL G  G  GP G+ G  G++G  G  G QG KG +G+ G  G  GYPG  G  G+ G  G  G  G  G PG  G  GAPG  GV GP GKPG+               G +G  G  G+ G  G  G  G  G  G  G  G  G +G PG  G +G  G V  +   L G PG  G  GD     +K +  ++G KG  G++G  GP+G +GE G  G+ GLPG   E+G  G +G  G+ G+PG  GD+G  G+ G  G  G  G PG +G  G  G+PG  G  G   I D
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYD 352          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 231.106 bits (588), Expect = 1.764e-60
Identity = 357/1001 (35.66%), Postives = 460/1001 (45.95%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRG------NTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNG--------MKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALG-----PKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVD------------GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGP--------PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGS---------QGSHGAPGPIGLQGL---IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI-----------GMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPG------DKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVG------------------ILGKPG----------LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDI 4043
            GY G RG  G  G+RG      N G +GP G  G  G PG  G RG  G  G  G  G  G PG  G       +G  GP G  GE GK G  G +G         KG +GD G+ GH+G  G+DG  G  G  G  GE G  G  G  G  G  G                 GEPG  G  GA G     PK ++  +G+ G  G++GE+G  G TG  G++G              GE G  G +G++G  G +G IG  G  G  G  GE+ P        PG  GD G++G  G  G  G  GL G IG  G          QG  G PG  G++G    +G  G+ G  G PGP+G  GE G  G VG  G  GN G +GD            G +G + P G KG +G++G +G  G+   +G KGS+G  G  G +G +G  G  G  G+ GLPG      ++GE G +G +G  G +G  G+FG  G  G  GP G  G++G  G KGE GN G  G  G+ G+  + G  G DG  GL G IG  G       PG KG  G +G      +                G KG +G PG  G  G  G  G  G +G+PG QG PGE G KG  G PG   + G++G++G TG PG  G  G  GE+G  G  G  G +G+ G                   +G PG            G+ G +G +G+ G +GD G  G  GP GAKG +G+ GY G  G+ G  GL G +G  G  G PG I  P   G +G   + G+ G  G+PG  G++G  G               P G +G  G+ G+ GP+        QG PG  G +G PG PG +G  G            + G KGE G  G  G RG SG A I G++G  G++G +G  G +G +G+ G PG  GK G +G PG  GP G+ G  G+ G  GL G  G+PG+     +
Sbjct:  510 GYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAG------HKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGR---------------DGEPGRDGRDGAPGRNATTPKVYL--IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQ---NGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGA------PGAKGQRGPVGDSQPALDGVA-------------GRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPG---RNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPG-ITLPAEKGDEG---VAGLDGRAGRPGHFGQKGAPG---------------PPGENGPNGAIGHRGPQ-------IQGPPGPQGDVGFPGAPGHNGRHG------------LIGPKGELGDMGRQGERGESGYA-IVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSM 1423          

HSP 2 Score: 226.868 bits (577), Expect = 3.233e-59
Identity = 395/1235 (31.98%), Postives = 536/1235 (43.40%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGL------VGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRG-----ITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ------IGFPGPEGASGKE---GEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL-----------------------------QGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKG---------------DHGIPGP----------SGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF-----EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKG--ISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR---GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIG---SIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVM----VIPNNVPSIGAVLNRL------FTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIK-TCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNY 4631
            G+ GR G KG  GP G+ G+ GKVG  G +G    +G    +G  G+ G  G+ G+ G  G  G DGS G KGERG TG                         RG  G  G QG  G+PG  G +G  G       V  +GE G+ G  GE                        +G  G+ G  G  G      I  + GEPG  G TG   PKG  G  G++GA G++GE G RG     I G  G +G  G TG  G +G  GL G  G+      IG+ G  G  G+E   GEIGPPG  G +G  G  G  G  G  G  GP G  G QG  GA G  GL                              G  G++GE G++G  G  G  G IG  G+ G++G  G  G  G  G+ G  G  G  G +G+IG  G QG+IGP G  G  G +G  G  G  G+PG  GL G +G  G+ G PG  G +G     G+ GD G  G     GP G  G+ G +G +G +G+  P       G+ G +G +G  G  GLPG  G KG +G RGLPG +G  G  G+ G  G  G  G          NG KG  G PG QGP+G QG  G VG   + G  G  G+QG +G               + GIPG            G TG  G++G  G  G +G  GF G  G +GE+G  G  G++G  G  GL G+QG +GP+G  G      +GD+G  G+ G  G  G  G++G  GP G  GP+G  G +G  I G  G  G +G+PG  G  G  GL+G  G +G  G+ G++G  G                +G  G +G  G+ G  G  G  G QG PGL G+ G  G PG  G  GD G  G+ G  G+ G KG+ G+     +  P G  GE G+ G +G  G+ G  GL G  GQRG  G  GD+G++G   + GP G+ G +G  GL G  G  GLPG  GEP          G   F+  R  +     +   + +++     +  NV +  AV   L        R   +  ++          +N   S   +++ + + +      + P  G       + C   E   +   + +Q+ S       + +      +++S L +  G     ++  +       L+E   +A+  I         Y+D+    +
Sbjct:  570 GNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETG------------------------QRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGE------------------------RGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTG---PKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGL---TGPIGYPGAPGAKGQRGPVGDSQPA----LDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGI---------NGLKGATGFPGPQGPKGPQGESGVVG---LDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAI-------------VGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARP-GDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRG---FIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDS---LWLSTAEPMP---MTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSC------LEEF--RAQPVIECHGHGRCNYYDALASFW 1702          

HSP 3 Score: 211.075 bits (536), Expect = 2.517e-54
Identity = 296/797 (37.14%), Postives = 370/797 (46.42%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI----------GAEGIRGLDGPKGQIGFPGPEGASGKEGEI---GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGP------RGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL--GPDGYIGLPGEIGEKGTKGKRGLPG------------IKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRG---NQGSDGDVGRQGMPGSQGSPGE--------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRG-----IPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
             GEPG       +GPKG  G  G+ G   ++G +G RG  GL G +G+ GE   I          G  G+ G DG  G  G PG +G  G +  +   GP G  G EG  G+ G  G+ G +GL GP G  G QG+ G  G  GL G  G  GE G +G  GP G+  E+G   + G IG  G+SG +GD G DG++G  G  G +G+ G+ G +G+ G +G +G     GEPG+ G  G PG         L    GEPG DG +G+RGD G  G  G+ G P P       G  G  G +GP+G+KG  G  G +G  G +G RG  G +  GP G  G PG  G+ G +G  GLPG             KG  G+ G    QG  G  G+ GI G  G  G  G  GL G  GP+G    QG DG VG+ G+PG++G  G+               G +  HG  G  G+ G  G  G  G  G +G   FSG  G  G  G QG  G  GI   PGL G  G  G +G+ G+ G QG  G  GP G  G KG  G  GP+GYPG +GLPG KG   E G+PG   +PG  G +G     G+ G  G+ G  G                     PIG  G  G++G  GP G     + G  G +G+ G  G  GLPG+                      G KG+ G RGL G +G  GE G  G  G PG  GI GL+G        G P         GP G  GPQGE G+ G+ G  G  G  G  GLI
Sbjct:  443 HGEPG----QNVVGPKGEPGLNGQPG---LEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGR---DGEPGRDGRDGAPGRNATTPKVYL---IGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIG---FSGRRGLLGNAGLQGLPGSPGI---PGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKG---ETGNPG---FPGRPGAKGVAAYSGIKGDDGESGLTG---------------------PIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGR---------------------HGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGAT------GFP---------GPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLI 1156          

HSP 4 Score: 209.149 bits (531), Expect = 9.143e-54
Identity = 312/782 (39.90%), Postives = 381/782 (48.72%), Query Frame = 3
Query: 1848 KGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGA---SGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGP--------QGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS--GLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGD----------------KGEPGTDGEEGQR---GDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG---------ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG--YPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXX--------XXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLP------GDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            KG+ GYVG +G  G QG  G +G  G  GL G  GE G  G  G  G DG  G+ G  G +GA   +G +G  G PG  G++G  G  G +G +GP G+  P        +   PGPIG QG IG  GE+G  G PG  G  G IGL GQ G  G +G+ GP         GD G  G  GP GP G  G  G+ GL GE G +  G KG  GL G+PG  G  G  G  GL G +GLPG+                +G PG DG  G R   G+KGL GD   +   GPRGP   RG  G  G  G  GN G +G  G  G++G QGN G  G+ GLPG  G  G  GK G  G  G +  +GS                        KG IG  G  G RG+ G DG+ GR G  GS+G  GE G++GD+G  G  G+ G  G  G  G PG         ++G PG+    G +GE+G  G  G  G+ G+P  G      G  G+ G+ G +G  G  G QGA GL+GE G  GP G   PGP G    KG  G  GD G  G PG  GR G PGL G  G  G+ G  G++ + G  G  G  G++G  G +G  G  G  G  GP+G+ G+   QG  G VG+ GLPG  G  G         +G  G  G +   G +G KGE G  G  G  G  G  G +G+ GL   LG  GLQG+ G  G PGLP      G+RG+IG  G  G +GP+G  G  G KG  G  G DG PG
Sbjct:  252 KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDP------SLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGP---RGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLR----------------------KGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYD---GIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGA---KGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGE---QGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGL---LGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPG 990          

HSP 5 Score: 194.512 bits (493), Expect = 2.844e-49
Identity = 352/1004 (35.06%), Postives = 438/1004 (43.63%), Query Frame = 3
Query: 1344 RGPRGNIGMRGNTGEQGPPGLMGHDGSPG-----------PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGP------------------------KGQIGFPGPEGASGKEGEIGPPGF-----IGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH-----GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGE-------------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGP---AGPKGPQGDIGKIGL------QGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGD--KGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGE---------IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG--MP---GSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPG---FSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPG--------------------------PQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPR--GMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDG 4013
            RG +G+ G  G TGE+G PGL G  G  G           P G +G  G          D   G +G  G+ GD G  GP G QG +G+      NG+ G  G++G  G +G  G+D                                                GEPG  G+ G    KG  G+ G +G  G  GE+G  G TG+ G++G  G  G       + L GP                        +G IG  G  G  G  G  GPPG       GD G  G  G +G  G  GL G  G  G  G +     G PG  G  GL G  G++G +G PG +G PGE              G +G  G  G +G  G  G+ G+ GD  P   AGP+GP+G  G  G       +G IG +G +G  GL+G PG+ G  G P   G  G+ G PG  G  G DG+  + G   KG +GD G  G  G  G  G +G  G +G KGE G  G  G  G  G +G  G  G DG  G PG          IGE G  G +G  G  G +G  G  G      I    G  G  G+ G KG  G  G QG  G +G  GD G  G  +P   G++G PG  G+ G  G PG  G+ G  G+ G  G  G  G+PG     GE G  G  G +G  G+VG  G+ GL G  GP+G KG+ G +G  G+ G+PG                          P GAKG KGE G +G NG  G  G  G  G  G +G+ G  G PG+ G  G PG++G  G  G+ G  G+Q      G  G +G  G  GP GLSG  G  GY G  G+PG+ G  G PG  GR G  G     G +GD GE G+ G  G  G  G  G RG VG     + G AG  G+ G PG  G+ G  G+ GQRGD GLPG +G+ G  G  G  G  G  G+ G+KG  G PG  G
Sbjct:  190 RGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGR------NGLPGARGEIGGPGERGKPGKD------------------------------------------------GEPGRFGDKGM---KGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLP---GPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQ------GDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQG 1127          

HSP 6 Score: 193.741 bits (491), Expect = 4.060e-49
Identity = 291/781 (37.26%), Postives = 379/781 (48.53%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPG--------------FIGDEGKRGFSGEK------------GDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGN-SGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGI--KGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKG-NI----GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF---EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIG--RQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP-----PGRVGPQGEPGLKGVKGEL---GLPGQDGEPGL 4025
            G  G LG KG +G  G++G +G +G+ GP+G  G  G+ G  GE G     G RG+DG  G+ G  GP GA G+ G  GPPG               I  +G +G  GE             GD G  G  G  G  G +G  G PGP G  G +  E     IG PG +GEPG+       G++  D    G +G +G+ GD GP GP G QG +G+ GL       G +G +G  GE G+ G+ G PG +G  G++G PG  G  G DG  G+RG+ G  G  G+ G     GP G+   S  + + G +G+ G +G  G  G  G  G  G  G IGL G+ G+ G  G RG PG   +G +G  G  G  G QG  G+ G+ G  G +G+ G N+    G PGL G  G +G  GD G  G+PG +G PGE      + I GP G  G  G RG+ G  G  GL G  GE G +G+     PV   G          +GPRG +G TG+    G++G  G+ GP+G +GL+G  G  G  G PGP G+PG+    G+VG  GP G    +G  R+G  G  G +G  G  G  G++G                    G  G+ G +G  G RG  G  G QG+ G  GR G  G PG +         G  G  GI+G +G+ G  G  G +G      I    G PGE G  G +GV G +G+ G  G RG+IG  GP     PG VG +G PG  G  G+    GLPG+DGEPGL
Sbjct:   69 GRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPG---TPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAV-SELPYSLIGPPGAKGEPGDS----LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL------PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGG---AGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGE-----GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGD---DCPVCNAGP---------RGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGE---PGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRD------------------GSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGL 794          

HSP 7 Score: 193.741 bits (491), Expect = 4.308e-49
Identity = 304/838 (36.28%), Postives = 375/838 (44.75%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPG------PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP------RGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEG---ARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---------------RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG---FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQ--GLIGKEGEKGAIGNPGPRGEPGEIGLQGQVG------------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGL---------------RGEPGQIGE-------SGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG-----IKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGD------KGNIGLPGLQGPRGN--------QGSDGDVGRQGMPGSQGSPGEQG------EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGET--------GYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD 3404
            ++G  G KG KG++G  GL G+IG  G  G+     P+G  G+ GP G+ G      +QG PGL G DG PG       KG+RG+ G +                       +G+IGP      +G  G++G PG  GL G  G  G  GE+G  GA+G+ G  G  G RG       G                +            +GE G +G  G  G KG IG+ G+ G     G+QG  G  GI GL G+ G  GE G IG  G                +GL G  G  G+PG  G  G++GE G PGF G  G +G   +SG KGD G  GL GPIG  G+ G+ G  GP+G     L G  G KG +G+PGP G PG  GL+GQ G                  + G  G +G  G  G  G  GP GPKGPQG+ G +GL G  G  G +G  GL                G PG++          GF G  GL G RG  GD G  G  G  G +G++G +G  G +GF G  G  G +G  GP G     +  E G++G  G  G  G  GH    G  G  G PGE G  G  G RG P I+GP G  G  G  G  G            HNG       KG +G  G QG RG         QG  GD+G QG PG  G+ GEQG      + G  G PGP G TG +G  GI G  G++G  G  G T        G +GE G  G  GE G  G PGL G+QG RG     G+ GDQG+ G        G  G QG  G  GY G  G PG +G+ G  G+
Sbjct:  729 YTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPG-PVGAKGYPGPTGDYG------QQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVI---------------------QGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG----------QKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGH---FGQKGAPGPPGENGPNGAIGHRG-PQIQGPPGPQGDVGFPGAPG------------HNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG---AVGYRGDQGEVGY------TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 8 Score: 142.51 bits (358), Expect = 1.724e-33
Identity = 260/712 (36.52%), Postives = 336/712 (47.19%), Query Frame = 3
Query: 2157 GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM------DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL--RGLPGDKGEPGTD------------GEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSS-----GPEGIKGELGN---------DGPLGFIGSVGIRGHQGNLGPDG------YIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE---------------QGEKGDHGIPGPSGKTGLSGIRGITGRP-----------------GILGLPGFSGETGYQGEKGSQ--GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK----FGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRG---KIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIID 4040
            G +G  GAPGPIG+ GL G  G+ G  G  GP GE G++G  G+ G  G  G+ GP+G++G        G+ G  GP+G  G  G+ G+QG   PSG  G  G+RG PG+ G+ G PG  G  G+  +G  G++GE G              G +G  G  GL G+ G  G PGP+G TG          GP G KGE G+         D   G+ G VG++G +G  GP G        GLPG  GE G  G+RG PG  G  G  G  G +G  G  G  G+ G  G  G+ G  G+PG+QG  G  G       + +PG  GS G+                G +G  G+ G SG  GL+G RG  GR                  G  G  G  G  G  GE G    GP GE G+ G+PGL GY   RG +G+ G  GD+G     + + GP G++G  G +G  G +GY G  GLPG+KG+ G+   V + GP G  G  G  G PG  G  G IG  G                        P G+ G  G+ G  G +G+PG  G  G+PG VG  G  GK  I+     KGE G  G+SG +G+ G+ G +G  G  G  GE G TG+ G  G+ G +G  G  G+ G  G PG      K+  IG PG  G +GE   +G  G+ G  G  GEP   +I D
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQG---PSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGY---RGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTG------------------------PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGK-AIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGE---RGDDGDTGFKGVKGEPNPGQIYD 719          

HSP 9 Score: 119.783 bits (299), Expect = 1.489e-26
Identity = 210/589 (35.65%), Postives = 259/589 (43.97%), Query Frame = 3
Query: 2568 RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPG---EIGEKGTKGKRGL------PGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQ--------------GPRGNQGSDGDVG---------RQGMPGSQGSPGEQGEKGDHGIPGPSGKTG--------LSGIRGITGRPG-----IL----GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXX---XXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI-----------------GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXX--XXXIQGNKGETGI---RGLVGP----------------RGMSGEAGITGKEGLPGELGIKGL---------QGVNGQRGDPGLPG---DRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            +G KG +G  G +G PG  GP G     GP G  G LG  G +G  G  G +GH+G++GP G +G PG   + GE GT G RG+      PG++GPSG  G                      NG +G  G PG Q              G +GN+G  G  G          +G  G  G  G  GEKGD G+PGP G TG        L G  G  G PG     +L     L G+ G  G QG++G QGP GE G +G+ GL    G RG  G  G  G  GK G PG  G KG+KG  G+ G +G           G  GE G+ G  G PG  G  G PG+   +     PG +G QG     G +G  G  G  G  GPIGL+G  G  G  G RG PG+                  G  G+ GL GR GL G+PG +                 G +G++GE G+   +GL G                 RG+ G+ G  G  GLPGE G++G          +G  GQ GD G PG   +RG IG  GP G  G QG PG  G KG  G  G  GEPG +
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAG---DIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPG---------------------QNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL---PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGL---------DGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKV 593          

HSP 10 Score: 100.908 bits (250), Expect = 8.748e-21
Identity = 194/569 (34.09%), Postives = 233/569 (40.95%), Query Frame = 3
Query: 2658 EGIKGELGNDGPLG---FIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR---------GLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ--------------------------------------------GSPGEQGEKGDHGIPGPSGKTG--------LSGIRGITGRP-----GIL----GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXX---XXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI-----------------GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR---GLVGPRGMSGEAGITGKEGLPGE-------------LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            +GIKG +G  GP+G     G  G  G  G  GP G  G  GE GE+G KG R         G PGI G SG  G+PG                    G  G  G PG+QGP G  G +G  G  G PG Q                                            G  G  GEKGD G+PGP G TG        L G  G  G P     G+L     L G+ G  G QG++G QGP GE G +G+ GL    G RG  G  G  G  GK G PG  G KG+KG  G+ G +G           G  GE G+ G  G PG  G  G PG+   +     PG +G QG     G +G  G  G  G  GPIGL+G  G  G  G RG PG+                  G  G+ GL GR GL G+P                   + G KGE G+    GL G RG  GE G+ G +GLPGE              G +GL G +G  G  GLPG++G  G   P    GP+G    +G +G+ G PG  G  G I + 
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGP------------------RGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGL---PGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGL---------DGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEP----------------GQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGP---RGQEGDTGYPGSHGNRGAIGLT 560          

HSP 11 Score: 87.4261 bits (215), Expect = 1.038e-16
Identity = 123/312 (39.42%), Postives = 155/312 (49.68%), Query Frame = 3
Query: 3162 KGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKV--------------GKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRI--GLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIID 4040
            KG +G +G  G +G PGL G  G  GP G+ G  G++G  G  G QG KG +G+ G  G  GYPG  G  G+ G  G  G  G  G PG  G  GAPG  GV GP GKPG+               G +G  G  G+ G  G  G  G  G  G  G  G  G +G PG  G +G  G V  +   L G PG  G  GD     +K +  ++G KG  G++G  GP+G +GE G  G+ GLPG   E+G  G +G  G+ G+PG  GD+G  G+ G  G  G  G PG +G  G  G+PG  G  G   I D
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYD 352          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col27a1b (collagen, type XXVII, alpha 1b [Source:NCBI gene;Acc:560145])

HSP 1 Score: 318.161 bits (814), Expect = 1.371e-89
Identity = 375/1119 (33.51%), Postives = 513/1119 (45.84%), Query Frame = 3
Query: 1818 GIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE---KGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIG---LQGQVGIIGRDGNSGPQGDIGM------------DGDRGPAGPKGP---QGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRG------NQGSDGDVGRQGMP-------------------------GSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGF---------------------EGDQGKFGVPGPQGAKGLKGEQGYM----GPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKP---------GKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR---IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDM----KSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRK-SVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G    G +G  G  G  G +G RG+ G  G +G  G  G  G  GE GP G +G  G  G  G +G PG  G  G  G +GPPG IG +G  G  GE   KGD G +GL G  G  G QG  G+PG   L G+ GK G +G IG+ GP G PG +G     G +G  G++G  GP+G+ G+            +GD+GP GP G    +G  G+ G+ G  G  G+KG  G+ G PG +GE G  GF G  G  GL G+KG+ G  G+ G  G+KG +     +   GP G  GL G+ GP+G +G  G DGP+G  G +G++G +G  G  G  G  G+IGE G  G  G  G++GP+G  G+ G                    G+ G  G PG+ GP G        G  G   R+G                           G  G  GE GEKG  G  G  G+TG  G+ G+ G  G +G  G  G+ G +G KG QG +GE+G LG+ G  G+ GP+G +G TGF                     +G QG  G PGP+G KG +G+ G +    GP+G  GP G  GD+G  G+ G PG  G  G  G++GAPG  G +GP G P         G  GK    G  G +G  G  G+ GP G+ G  G +G  GP G  GK G +G PG +G    +GLPGKP      G +G  G  G  G+QG+ G  G RG+ G  G  G+ G+ G  G PG+ G +G +G  G  G+ G PG  G  G  GPPG  GP G  G KG +G +G+ G  G  G+I             P+  K    +M            M    ++P +    + +F  L  L  L+      LG++ENP+R C+D+ +E    +  G +WIDPN+G  SD++   C F+    +TC+        KP+                       T  K+    +  Q+ F+  L S+A Q I + C   SV   + ++    S +  +A++ + +          EAG  +    +KD+C          Q     +D   LPI++I       P          VCF
Sbjct:   43 GTKRQGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGSPG---LPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMEREACLDQQGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGIL------------------GEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCSRVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG--GNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKP------GPQGNAGAPGLPGVQGSFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSG------NPGPQGDKGNKGEMGPPGPRGPPGPPMYQDTDLPLLDQG-SEIFKTLHYLSILIHSIKNPLGTQENPARMCRDL-LECEHRLNDGTYWIDPNLGCSSDNIEVTCSFTNGG-QTCL--------KPV-----------------------TASKLEIGVSLIQMNFIHLLSSEAVQIITVHCLNISVWASEDSKTPSSSMVYFKAWDGQII----------EAGGFIEPDLLKDECWITDGRWHQTQFIFRTQDPNLLPIVEIYNLPSTKPGSHYHLEVGPVCF 1082          

HSP 2 Score: 218.394 bits (555), Expect = 4.106e-57
Identity = 320/801 (39.95%), Postives = 402/801 (50.19%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPG---PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQG------QVGIIGRDGNSGPQGDIGMDGDRGPAGPK--------GPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG-LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIG 3671
            P+G  GF G  G +GM G  G  GP G+ G+ G PG    KGE GL G  G  GF G  G PG  G  G PG +GKIG RG     G PG  G  G  G +G  G+ G +G  G  G  G  GP G  G  G  G +G  G PG  G  GR GI G  G +G +GEPG  GN G LG +G +G+VG  G  G+ GEKG RG TG  G     GE G +  E      GP G  G  G  G  G  G  GP G +G++G  G  G +G  G  GL G +G IG  G  G  G  G+QG  G  G KG +G PGP+G PG +G  G      + G+ GR    G    +  +  R     +        G QGD+G  G  GE G  G KG+ G  G+PG IG  G  G  G  G RG PG+K   G+ G +GQ G+ G LG+ G  GF GP+   G RG++G  G  G++G  G  G +      G++G+ GP G +G PG  GEKG +G  G + G  GPSG +G                +G  G  G+ G+ G PGL+G +G +G +G  G  G  G +G PG +G KG+ G  G +   G SG RG  G  G+ G  G  G  G++G+ G  G  G+ G  G PG  G+ G  G  G+ G +G+ G  G+PG QG+ G KGE+G  G +G PG  GL G  G  G+ GD G  G PG+ G QG PG++G+ GP G PG  G                 G+ GP G  G +G QG  GP GI   IG  G PG  G  G
Sbjct:  106 PVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGSPGLPGVQGKPGPQGKIGDRG---PDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPG---PPGEKGAMEREACLDQQGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCS-RVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEK---GSKGHQGQLGEMGALGEQGDTGFIGPK---GSRGTTGFMGATGKMGQHGEPGLV------GYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGP---------------VGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG--GNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGP---------------VGVQGPKGPQGLMGMQGAIGPVGI---IGPSGNPGPQGDKG 852          

HSP 3 Score: 206.453 bits (524), Expect = 2.443e-53
Identity = 301/818 (36.80%), Postives = 378/818 (46.21%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP------PGLMG---HDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGN---TGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNS----------------------GPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLL---------GDFGIMGFPGPRGPTGLRGSSGPEGIKGELGND-------GPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP------GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            G+ G  G KG KG  GL G+ G+ G QG +G  G  G  G  GP+G IG RG  G  GP      PG +G    +G  GPKG  G+             G PGP G PG+ GD+G +GP       G PG++G  G KG+ G+ GE+G KG  G                                                  G PG +G     G +GP G +G  G++G RG  G+ GP G  G         + GP G+ G+ G  GPKG  G  GP+G  G++G +G  G  G  GK+G SG+ G  G  G  GP G  G QG  G P   G +G++G+ G +G+ G  GP G   E    G  G   R+G S                      G QGD+G++G+ G  G  G +G  G+ G  G IG  G +G +G  GE G+ GE G  G  G LG  G  G++G+ G  G +G RG  G +         G+ G++G+ G +GP G  GS GP+G KGE G+D       GP G IG VG RG +G  G  GY GL G  GE+G +G  G  G  GP G  G                       G KGN G  G   PRG  G+ G  G  G+PG +G  G +G +GD G  G +GK G  G+ G  G  G +GLP      G +G  G  G +GS GP GE GI   PG  G  G RG  G  GF G QG  G    +G  G  GEQG+ G  G  GP G PGD    G VG  GP G  G +G QGA G VG+ GP G PG  G +
Sbjct:  135 GNPGEPGLKGDKGELGLPGEPGEPGFQGDKGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVR------------GIPGPGGLPGLEGDQGPVGP------AGAPGLEGRPGRKGISGNPGEEGMKGEPGM------------------------------------------------TGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMEREACLDQQGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPP---GAKGILGEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCSRVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG--GNSGPRGFPGP---------------------KGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGI---PGQSGPPGKRGLNGGMGFPGKQGDQGF---KGQPGDAGEQGFPGVLGIFGPQGPPGD---FGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDK 851          

HSP 4 Score: 182.57 bits (462), Expect = 5.575e-46
Identity = 251/706 (35.55%), Postives = 301/706 (42.63%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY---VGKEGARGVQGEKGPRGITGLTGLRGVDGE-------------------------------------TGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIG---PPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPA-GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ---RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGP------LGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQG 3176
             G  GRKG  G  G  G+ G+ G  G           G  G RGP G +G  G  G  G  G  G  G PGP GE+G    +  L                      + GP G +G  G  G +G  G +G  G VGEKG  G  G +G  G  G                                         G+ G IG TG  GP GF G     G  GA+G+ GE GP+G  G+ G  G   E                                      G  G  G+ G  G KG IGF G EG +G  G IG   P G IG  G+RG  GEKG  G  G +G +GA+G QG  G  GP G +G  G  G  G +G     GEPG +G +G  G  G  G+ GP+G+ G  GD G   GP GP GDIG +G +G+ G  G  G  GL G  G+ G+ G PG  G  G RG PG KG  G  G +G+   RG+ G  G  G +G PGPRG  G  G  G  G  G  G DG       LG  G VG+ G  G  G  G  GLPG  G  G KG+RG+PG  GP G                          G  G +G PG QG +G +G  GD G QG PG  G  G QG  GD G  G  G  G  G+ G+ G  G +G+ G SG  G QG+KG++G
Sbjct:  248 EGRPGRKGISGNPGEEGMKGEPGMTGNP---------GMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMEREACLD---------------------QQGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGL---------------------------------------SGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCSRVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQ---HGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG--GNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGIPGQSGPPG------------------------KRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKG 855          

HSP 5 Score: 181.8 bits (460), Expect = 1.020e-45
Identity = 277/760 (36.45%), Postives = 337/760 (44.34%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFG---LIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMR------------GNTGEQGPPGLMGHDGSPGPK------GERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPG---------------VQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY---VGKEGARGVQGEKGPRGITGLTGLRGVDGE-------------------------------------TGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEI---GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPA-GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ---RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQ 3251
            G IG +G  G  GP G     GDIG            P G  G  GP+GN G+R            G+ G  GP G  G +G PG K      GE G+ G  G  G PG  G  GP G  G  G+ G  G +G +GE G+PG                QG +G +GL G  G KG +GA G DG  G  G  G  G  G  G  G                          G+ G IG TG  GP GF G     G  GA+G+ GE GP+G  G+ G  G   E                                      G  G  G+ G  G KG IGF G EG +G  G I   GP G IG  G+RG  GEKG  G  G +G +GA+G QG  G  GP G +G  G  G  G +G     GEPG +G +G  G  G  G+ GP+G+ G  GD G   GP GP GDIG +G +G+ G  G  G  GL G  G+ G+ G PG  G  G RG PG KG  G  G +G+   RG+ G  G  G +G PGPRG  G  G           G+ GP G  G  G +G  G+LG DG +GLPG+ G +G  G  GLPG++G                             G KG  G+PG  GP G +G +G +G  G  G QG  G+ G+ G+ G P      G+ GI G  G PG  G  G  G  G QG  G QG +G VGI+G  G  G QG +G KG+
Sbjct:  180 GKIGDRGPDGLPGPLGPEGFPGDIG------------PPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMEREACLDQQGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGL------------------------SGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCSRVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQ---HGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG--GNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFE---------GDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQG---------------------------SFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFP------GVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGE 856          

HSP 6 Score: 155.221 bits (391), Expect = 1.888e-37
Identity = 202/557 (36.27%), Postives = 261/557 (46.86%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP---PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDR----GKIGPRGGQGEIGKPGVQGLNGMKGLVGD---VGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIG----PPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPG----PIGLQGLIGKEGEKGAIGNPGPRGE------PGEIGLQGQVGIIGR---------------DGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLP---GDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYI 2759
              G +G KG +G  G  GL G +GK+GE G+ G   P G+ G +GP G  G +G  GE GP   PG++G  G        GLTG     G                  +R    G+ G  G +GE G+ GV G  G +G  GD   +G KG +G IG+ G                                             ++G+PG  G+ G  G  G +G +G++G  G  G KG RG TG  G  G  G+ G  G  G  G  GP+G +G PGP+G  G++G+ G    PPG  GD G  G  G++G+ G  G  G  G  G +G  GAPG    P G  G  G +G KG  G   PRGE      PG +G+ G  G+IGR               DG  G  GD+G DGD G  G  GPQG+ G  GL       G++GS G +GE G  G+SG PG  GL G  G P   GD+G  G  G+ G++G  G+LG FG  G PG  GP G++G  GP+G+ G  G  GP+G IG  G  G QG+ G  G +
Sbjct:  355 EKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAG---PTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGFTWEGWRSGLTGRTRREGCSRVSWEYWRARVTLESMERLVQVGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTG---------------------------------------------ERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGL------PGVQGSFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEM 857          

HSP 7 Score: 72.0182 bits (175), Expect = 6.960e-12
Identity = 155/449 (34.52%), Postives = 197/449 (43.88%), Query Frame = 3
Query:  972 ILLMKGVRGKRGPT------GETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQ----KGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMR----GNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIG 2276
            ++ +KG  GK G T      GE GS G+ G+ G  G +G  GD+G +GP G RG  G +G+ G  GQ+GE G  G  G  G  G+ G  G  G KGE+G     +GP G  GDIG VG +G  G  G  GY G  G +G  G      GN+G +G PG  G  G+ GPKG+                              RG+ G RG  G +G PG +G+ G +G  GD G  G  G  G                                                 +G PG +G+ G +G               + G+ GP+G  G  GL GV G  GP G  GI G  GP G+ G  G  G  GK+G+ G  G  GD G++GF G  G  GP G  G  G +G QG  G  G +G+QG IG  G  G  GNPGP+G+ G  G
Sbjct:  497 LIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGGNSGPRGFPGPKGSKGNKGPKGKN---------------------------SPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGA------------------------------------------------KGMPGDLGHDGDVG---------------LPGKPGPQGNAGAPGLPGVQGSFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKG 855          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 317.775 bits (813), Expect = 3.938e-88
Identity = 463/1352 (34.25%), Postives = 582/1352 (43.05%), Query Frame = 3
Query: 1341 FRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKG---LVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYV---GKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGA---------EGIRGLDGPKGQIGFPG------------------PEGASGKEGEIGPPGFIG------------------------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDG------------NSGPQGDIGMD---------------GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGND---------------------GPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIG---------LPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPG------------------PSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLK---------------GEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQ------GKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK------EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTD---PDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQ------NGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
              GPRG  G  G  G QG   L GH G PG  G+ G  G +G  G PG +G  G  G PG PGDRG +G +G +G  G PG+ G+ G +G   + G  GE G  GA GE+G+ G  G  G  G  G  G  G+                   G  G  G  G  GNTG  GP G +G     G  GA G +GE GP G TG +G +G  GE GP GA          G  G++G KG  G PG                  P GASG  G  G PG +G                        +EGKRG +GE+G +GP+GL GP GA G++   G PG  G  G +G  G +G +G PG RG PG+ G  G+ G++G  G              GP G  G D               G+ G  GPKGP G+ GK G +G +GP+GL+GS G  G  G  G          +GL G PG+KGE G  G  G +G  G  G  G  G PG RG  G +G SGP G+KGE GN                      GP G  G  G  G  G  GP G  G+PGE G  GT G +G  G  G  GL G+ G  G +G  G  G  G  G NGDKG  G           G  G RG  G  G  G  G PG+ G  G +GEKG  G  G                  PSG  G  G RG +G  G+ G PG  G  G  G  G  GP G  G  GK       GPRGP+G  G  G  G+ G+ GP G  G K               G QG +G  G+   +GLPG +G  G  G PG +G PG +G  GAPG  G  G IG PG  G Q                     G +G  GS G  GP G PG  G +      G PG  G +G PG  G  G  G  G +G  G SG  G  G  G RG  GP G  GE G+ G+      +GL G  G++G+ G NG  GD G  G  G  G  GP G  GP G+ G  G+ G +G PG  G  G +             P        D     D    D   +      + A +  L T++E L           GSK+NP+R+C+DI + S+   +SG +WIDPN G   D++ A C FS  +  TCI     S  +    +  SQ +   W  +  +       N +TL   +     +Q+ F++ L ++A Q I   C+ S+ Y D+   N + A+ ++  ND +L +  + R             ++D C       +   I         LPI+DI   D G  DQ  G     VCF
Sbjct:   85 LMGPRGPSGSPGAPGAQG---LQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGR------------------VGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTR---GLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGP---------VGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPRGEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPAGK------DGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGF---NGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQ---------------------GEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGHVGPAGPPGSPGLPGPPGPSGGGYDTSGGYDEYRADQASLRAKDYEVDATIKSLNTQIENL-------LSPEGSKKNPARTCRDIRL-SHPEWSSGFYWIDPNQGCTMDAIKAFCDFSTGQ--TCIHPHPESIPR-KNWYRSSQEKKHTWFGETINSGTEFAYNDETLSPQSMA---TQLAFMRLLANQAVQNITYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSV--------LEDGCSRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1351          

HSP 2 Score: 125.176 bits (313), Expect = 3.882e-28
Identity = 276/849 (32.51%), Postives = 346/849 (40.75%), Query Frame = 3
Query: 2034 ASGKEGEIGPPGFIGDEGKRG-----------------------------FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGND---------------GPLGFIGSVGIRGHQGNLGPD---------------------GYIGLPG---------------------EIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------------------------------------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGI---------------RGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQ---------------------------RGDP------GLPGDRGKIGS------IGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDI 4043
            AS + G  GP G  G+ G +G                             + G KG     G +G +G  G  GS GAPG  GLQG  G+ GE          G+ G IG +G  G  G++G  G  G  G  GDRG  G +G +G  G  GL G  G  G  G  G +GEPG  G                 G+ G  G++G  GQRG +GL G+ G +G  GP G  G  G++GP G  G LG+                GP G  G  G +G +G  GP+                     G  GLPG                       G +G  G  G  G+KG SG+ G PG+ G QG  G  G  G  G  G++G  G  GL+GPRG  G+ G  G  G  G  G PG +G  G  G  GP G  G +G  G+ G  G+                                       +G PG  G +G  G+ G +GPVG  G+ G PG  G  GP GP G  G  G++G+ G  G  G +GL G  G +G  G PG  G+PGD+G+SG  G  G  G PG  G  GA G +G  GP G PG  G +            G  G  GP G  G  G+ G  G RG  G  G +G+ G  G  GL G  G DG  G  G  G  G +G  G+KGETG                RG  GP G SG AG  G +G  G  G KG  G  G                            RGD       G PG  G++G       +GP G  GP G+ G +G +G++G  G  GE G+I  + +
Sbjct:   20 ASCQSGLKGPKGPRGERGPKGPDGKPGRPGLPGPAGPPGPPGLGGNFAAQYDGAKGPDPGPGPMGLMGPRGPSGSPGAPGAQGLQGHAGEPGEP---------GQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAK---------------GENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNK------------GEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPRGEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPGAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGL 832          

HSP 3 Score: 66.6254 bits (161), Expect = 3.260e-10
Identity = 137/323 (42.41%), Postives = 159/323 (49.23%), Query Frame = 3
Query: 1245 KGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIG 2213
            +G  GP GL G  G  G  G      P G  G  GP G  G  G  G +GP    G  G  GP GE G+ G  G  G  GP G  G  G PG  G +G++   G QG  G PG +G  G+ G+ G VGE G  G  G  G+ GP G  G  G  G  G  G++G PGN G  GRPG  G+KG +G+ G PG  G  GA GP G  G VG+ G RG  G  GP G  G  G RG  G  GP G +G+ G  G +G  G     G  G +G  GP G  GD G  G +G  G  GP G  GP G  GS G  GA GP G +G  G
Sbjct:  767 RGDSGPTGLTGFPGAPGRVG------PPGPAGIVGPAGLTGPAGKDGPRGP---RGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQL---GSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGL---RGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAG 1074          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-196i2.1 (si:ch211-196i2.1 [Source:ZFIN;Acc:ZDB-GENE-091204-150])

HSP 1 Score: 310.842 bits (795), Expect = 2.285e-85
Identity = 478/1521 (31.43%), Postives = 631/1521 (41.49%), Query Frame = 3
Query:  831 GANAMHGIPGKPGNRGPPGEIFILPINLGISSPNALQARFRQSLMEHILLMKGVR--GKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGA---------EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL---IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI------------------------GLQGEIGPSGLKGSMGLRGEPGQIGESGFP---------------------GFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT------------------GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYI---------------------GLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPR------------------GNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGL---PGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQ------------GYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGP---PGR---------------------------VGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPN--NVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLK-SQNESEW-WLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIA-KDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            GA  + G PG+PG  G PG   +    L  ++P    A F+Q+    +LL    R  G  GP GE G  G  G                                   G+ GER                  G  GR G+ G +GP G++G  G  G  G+ G+ GP G  G  GP+G +G +G +G  G  G  G  GS GP G++G                         PG++G  G  G  G +G PG QG+ GM+GL      +GH G  GED                                                G  G  G  GA G  G+ G +G +GA G +GE GP G  GL G +G  G  G IG           G  GL GPKG+ G  GP G  G  G  G  G +G  G +GF+G KG+ GP G  G IG  G++G+ GA G  G+QG    IG  G  G  G PGP+G  GE G  G  G +G++G++G +G  G+ G  GP G KG  G  G                          GLQG +G +G KGS GL+G PG+ G+ G P                     GF G  G++G  G  G  G  G  G RG  G  GD    G PGPRGPT                  GL G  G +G  G  G DGP G  G  G+ G  G  GP G I                     G+PG  GEKG KG  G PG  GP GL G    QG  G  G  G  G  G  GD+G IG  GLQGP+                  GN+G  G  G  G PGS+G  G+ G  G  G+ GP G TG  G +GI G  G +G+   PG  G  G+ G KG++      G+ G PGL G  GP G KG+TG  G  G+ G PGP+G  G KG +            G +GP G  GP GL G +G  GE GD       G  G +G  GL GV GP G P                           GL G+ G  G  GP G+PG  G  GKPG  GR G+ G+    G +G  G  G  G  G +G +G+ G+R   GPRG  GE G  G++GLPG  G  G+QG  G+ GD G+ G  G+ G  GP   PGR                            GP+G PG+ G+ G  G  G  G  G       +       P      + ++      D+M   +  N   I  +L+ L+  L++L       +   G+K++P+ +C ++++  +    SG ++IDPN GS  D++ A C FSE   +TC+  + +    P   +L  S N S++ WLS L  + G   +    +    Q+ FL+   ++AEQ +  +C       ++ R       Q++   D    S+               +    DC+         + ++   +D+  LP+ DI    FGN  Q  G+    VCFS
Sbjct:  268 GAFGVRGRPGRPGFLGSPGPPGLPSFYLWRNTPEDWAA-FQQTSFFQLLLAGWPRAQGLPGPEGEMGKPGAQGP---------------------------------PGEPGER------------------GPPGRMGDMGDRGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKG------------------------KPGEKGSKGAPGAPGAVGPPGPQGIRGMEGL------EGHPGPDGED------------------------------------------------GMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGNKGARGAAGVQGIQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVGMYGFPGTVGMRGRPGHTGD---RGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGIDGEKGEKGMMGSPGDDGPLGLEGQ---QGLTGPAGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGLEGPWGDTGEQGEKGIKGAKGQIGMQGEPGLVGGVGHPGLKGAE------GVPGHPGLVGPDGPAGSKGKTGPSGSPGEPGNPGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGLSGPEGEKGEPGD------KGEPGLEGPDGLQGVQGPPGLP---------------------------GLEGSQGEAGMRGPPGLPGAQGGVGKPGPDGREGMKGE---KGDQGKNGAPGKLGHIGRRGKRGKAGLRATRGPRGEKGEKGDVGEKGLPGWGGSMGIQGPRGEPGDEGVKGAEGEKGDQGPFGSPGRDGIKGSLGPLGPPGPPGPKGDQGNIGPSGPRGTPGIPGLPGLFGDKGLKGFQGPPGPPGTRGLPGPPGPPGPPGISVNLTLIQIKDLMYSSDKPNFSLIQTLLDSLYHDLQLL------VDPPDGTKQHPASTCLELWL-CHPNYTSGFYYIDPNQGSPLDALLAYCNFSESGAETCLHPRDAHL--PTRTWLNDSGNNSKFHWLSSL--EGGFKFEYPALSVV--QLRFLRLQSNRAEQRVTYSCYPGHRLGETQR-------QVQFLTDAAKQSY---------------LGALQDCVSAKEVDPGPRESVFQFEDMDLLPLRDIGI--FGNSSQEFGFTIGPVCFS 1573          

HSP 2 Score: 216.468 bits (550), Expect = 5.528e-56
Identity = 302/828 (36.47%), Postives = 367/828 (44.32%), Query Frame = 3
Query: 1896 GEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDG---------------------------PKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGE---EGQRGDKGLLGDF------------------GIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGIT------------------GRPGILGLPGFSGETGYQGEKGSQGPVGEVGI------------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGIS---------GEVGDPGPIGYPGNIGRQGA------PGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGK---IGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAG---------------ITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G  GP+G  G  G+RG  G  G +G+ G  GL                             P+ Q G PGPEG  GK G  GPPG  G+ G  G  G+ GD GP G++G  G  G  G +G  GP G  G+ G +G  G  G  G  GE GE G+ G  G  G  G  G +G  G  G  G  GP GPQG  G  GL+G  GP    G  G+ G PG  G  G PG+ GL+G +G  G +GEPG  G     G +G +GL G                    G  G PGP GP G+RG  G EG+KG LG  GP GF G       +GN GPDG     G+IG KG KG RG  G++G                             G++G IG PG        GP+GNQG DG+ G  G  G +GS G +G +G  G PGP G  G +G RG T                  G+PG  GL G  G  G +G  G QG  GE G              G  G  G  G RG  G+TG +G QG  G+ G  G  G++G  G+ G  G PGP G  G  G +         GE G PGP G  G+ G QG       PG  GV+G IGKPG  G  G  G  G  G  G+ G  G  G+ G  G +G  G  G PG    +G +G+ GL G  GL G P                     G KG+ G RG +G  G+ G  G               + G EG  G  G+ G  G  G++GD G P   G  G  GP G  G QGE G+KG KG++G+    GEPGL+
Sbjct:  259 GYPGPKGDKGAFGVRGRPGRPGFLGSPGPPGLPSFYLWRNTPEDWAAFQQTSFFQLLLAGWPRAQ-GLPGPEGEMGKPGAQGPPGEPGERGPPGRMGDMGDRGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHPGPD---GEDGMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGI------KGNRGPDGDQ---GDIGPKGNKGARGAAGVQG---------------------------IQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVGMYGFPGTVGMRGRPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGIDGEKGEKGMMGSPGDDGPLGLEGQQGLTGPAGLDGAP---------------------GRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPP---GFTGLEGPWGDTGEQGEKGIKGAKGQIGM---QGEPGLV 1019          

HSP 3 Score: 147.902 bits (372), Expect = 5.839e-35
Identity = 255/653 (39.05%), Postives = 310/653 (47.47%), Query Frame = 3
Query: 2316 SGPQGDI--GMDG-----DRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPG------------------------FYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL---GPDGYIGLPGE------IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGIL------GLPGFSGETGYQGEKGSQGPVGEVGILGKP---GLGGYQGPRGPKGQTGF------EGDQGKFGVPGPQGAK------GLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGP---IGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSI------------GPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            +G QGDI  G DG      RGP GP GP G+ G  G  G  GP G KG+ G+RG PG+ G  G PG                        F+ LL L G P  +G PG +GE               MG PG +GP G  G  GP G  G++G+ GP G +G  G+ G  G     GP G  G+PG        GE G+ G++G  GI G  G  G  G  G +G +G PG  G +G  G +G  G+ GL+G  G  G DG  G  G+PG+ G+P      G QG  G  G PGPSG  GL G +G  G  G +      G PG SG  G  G KG  GPVG VGI G P   GL G  G  GPKG TG       +GDQG  G  G +GA+      G++GEQG +G  G+PG  G PG +G  GE G+ GP   +G  G+ G +G  GL G  GP G  G+ G++G  G  G  G  G  G  G  G  GT G QG  G  G  G  G QG PG  G+            +G  G  G  G  G  G+ G  G RG  G  GM G  G  G  G PG +G++G  G  G RG+PG  G  G IG              G PG  G QG+PG +G  G  G PG+ G  G+I
Sbjct:  221 TGRQGDIVRGSDGKMYRIQRGPMGPMGPPGEPGCPGNAGYPGPKGDKGAFGVRGRPGRPGFLGSPGPPGLPSFYLWRNTPEDWAAFQQTSFFQLL-LAGWPRAQGLPGPEGE---------------MGKPGAQGPPGEPGERGPPGRMGDMGDRGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHPGPDGEDGMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGNKGARGAAGVQGIQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQ------------DGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVGMYGFPGTVGMRGRPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVI 845          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col5a3a (collagen, type V, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-030131-968])

HSP 1 Score: 298.516 bits (763), Expect = 3.410e-81
Identity = 394/1165 (33.82%), Postives = 522/1165 (44.81%), Query Frame = 3
Query: 1851 GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDG------ETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGK------EGEKGAIGNPGPRGEPGE------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGP---------------AGPKGPQGDIGKIGLQGEIGPSGLKGSMG---------------LRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRG---------DKGLLGDFGIMGFPGPRGPTGLRGSSGPE---------------GIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGE---IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD------------------------PGPIGYPGNIGRQGAPGLVGVTG------PIGKPGKVGKQXXXXXXXXXXXXXXXXXXXP---------------IGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTD------------------------PDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            G  G+ G +G  G+ GEKGP G  G+ GL G+DG        GP G +G +GL G +G +G+PGP G  G +G  G  G  G++G+ GF G KG+ G  G  G  G+ GS+G  G  GP G  G +G+       GEKG +G PG  G PG       +G  G  G+ G  G  GP G  G DG+RGP                G KG  G  G  G  GE GP G +G  G               L G PGQ GE GF G  G  G  G+ G +G+ G  G  G RG         ++GL G  G  G  G  GP G  G SGP                G  G  G +GPLG  G +G  G +G+ GP G IG PG    +G  G  G++G PG KG  G  G  G QG  G+ G  G  G  G +GDKG  G PG +G +G++G  G  G  G  G  G P      GE G +G  G+ GP G  G  G +G TG PG+ G+PG  GE G  G  GS GP G+             GPRGP+G  G EG QG  G  G  G  G KGE G  G  G  G  GL G+KG  GE GD                        PGP+G+PG+ G  G PG+ G+ G        G+PGK G QG  G  G  G  G RG  GP                G  G +G  G  GP+G PG  G +G  G+ G  G  G  G  G  G  G  G  G  G+   KG+ GI+G  G  G+ G  G  G+ G  G+ G+ G+QG+ G +GD G  G  G  G  GPPG  G  GE G KG +G +G  G  G  G          M + +P R  R+ R   S                            + +  P  +  + A LN + T +E++        K LG+ E+P+R+CK++ M  +     G +WIDPN G   DS+   C F+  E +TC+          L  + K +  S W+    K +    +          Q+ FL+ L + A QT   +C+ S+ ++D +  N++ A++ R  ND ++       I +          + D C  R    T+  + + +     LP+ID+   DFG+ +Q  G++  +VCFS
Sbjct:  758 GIQGFPGPQGPIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQGKTGETGPTGDRGHPGAPGPPGEQGLPGAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGVAGPIGATGERGSSGPAGAIGQPGRQGGVGPAGPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGESGHVGSMGPPGQ------------HGPRGPQGAIGGEGPQGMPGAVGQPGVVGEKGEDGEAGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGPKGNPGPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPGKSGPQGASGEPGPPGPPGRRGHIGPEGKEGKQGKKGAKGSAGAEGPIGKTGPVGPQGHPGNPGPEGLRGIPGSAGEQGLNGPPGQTGPPGPMGPAGLPGL---KGDPGIKGDKGHGGLIGLIGPPGEMGEKGDRGLPGIQGIQGTKGDGGAGGPPGPTGPPGPPGLSGAIGEKGSKGDQGAIGARGDTGPAGPPGPPGPPAAMIEPLPIREGRKKRRRHSNRQGAESRAEAEEEEAVQLNMEDFLQADEALDEPEGMEEVFASLNSMKTEVELM-------RKPLGTFESPARTCKEL-MLCHPDYKDGEYWIDPNQGCHRDSIRVFCNFT-AEGETCLHPDKRFETVKLAAWNKEKPGS-WYSQYRKGKQFSYIDTEGNPVPVVQMTFLKLLSATAMQTFTFSCQNSIGWYDMSNHNHQHALRFRGSNDEEMTQDKSPFITA----------LYDGCQTRKGLDTTV-LQINSPRSELLPLIDVAISDFGSNNQKFGFHVGTVCFS 1886          

HSP 2 Score: 199.904 bits (507), Expect = 6.914e-51
Identity = 296/845 (35.03%), Postives = 374/845 (44.26%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP---IGAEGIRGL---------------------DGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEI---GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPE---GIKGELGNDGPLGFIGSVGIRGHQGNLG------------PDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT---------GLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD------------------------------QGKFGVPGPQGAK------------------------GLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            +G PG  G  G  G  G  G  G +G RG +G+ GP+G  G  G +G DG  GP    G  GIRGL                      GPKG +G  G  G  G++G  G  GF G +G  G  GEKG  G  G+ G  G  G  G  G  GP G +G  G  G +G +G PGPRG  G     GL+G  G  G DG  G +G++G+ GDRG  G  G +G+ G  G +G+ GP G  GS G+ GE G++G  G PG+ G  G +   G  G PGT G EG++G +G  G  G  G  GP G  G RG+ GP    G KG  G+DGP G  G  G +G QG  G             DG  G PG+ GE G +GK G P   GP+G++G                         +G  G  G  G RG+ G+ G  G QG+PG+ G  G +G+ G  G PG SG           GL GI G +G  G  G  G +G  G  GE+GS GP G +G  G+ G  G  GP G KG+ G +G                               +G+ G PG +G+K                        GL GE G  G  G  GP G  G++G  G  G PG  G PG  G +G  G VG  GP G+ G  G Q                           G+ G  GP+G+PG +   G+PG+VG  G  G+                      GN G  G  GLVG +G  GE G  G  G  G  GI+G+ G +G +G+P         G +G PG  GP GEPG+ G+ G  G  G +GEPG
Sbjct:  649 RGAPGETGAKGDRGFDGLPGLPGNKGHRGDRGKPGPQGPHGEPGHKGSDGPVGPRGQPGEPGIRGLVGPRGPPGPPGQQGIQGVDGVQGPKGNLGPLGEPGPPGQQGNPGIQGFPGPQGPIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSK---GSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPP---GPAGVVGP------------------------QGKTGETGPTGDRGHPGAPGPPGEQGLPGAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGVAGPIGATGERGSSGPAGAIGQPGRQGGVGPAGPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGESGHVGSMGPPGQHGPRGPQ---------------------------GAIGGEGPQGMPGAV---GQPGVVGEKGEDGE---------------------AGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGPKGNP---------GPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPG 1403          

HSP 3 Score: 182.185 bits (461), Expect = 1.735e-45
Identity = 303/846 (35.82%), Postives = 371/846 (43.85%), Query Frame = 3
Query: 1950 GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGE--IGPPGFIGDEGKRGFSGE----------------KGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKE---GEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLL---------GDFGIMGFPGPRGPTGLRGSSGPE---GIKGELGNDGPLGFIGSVGI---RGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGK------------------------------PGLGGYQGPRGPK------------------------GQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG---------YPGPHGLPGDKGISGEVGDPGPIGYP---------------------GNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRG------------------------------LVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGK---IGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G TGP G  G  G  GP+G+ G PG +G  G  G   + P  + GD  K                      KG  GP+GL G  G +      G PGP GL+G IG+    G +G  G+ GP G+PG+ G  G  G  G  G +G +GD G DG  G  G KG +GD GK G QG  G  G KGS G  G  GQ GE G  G  G  G  G PG +G  G DG +G +G+ G L         G+ GI GFPGP+GP GL G  GPE   G++G  G DGP G  G  G    +GHQG  G  G +G PG  G KG  G RGL G KG  G                         +G  G  G  G++G RG+ GS G  G  G  G +G  G  GE G  GI G  GK G+ G+ G  GR G  G  GF G  G +GEKG +GP G+ G  G+                              PG  G +GP+GP+                        GQ G  G QGK G PGP G  G +G+ G  GP G          PG  GLPG  G  G  GDPGP G P                     G+ G +G  G +GV GPIG  G+ G                    GP G  G  G QG  GP    G +G +G+PG  G IG  G+ G  G  G  G  G  G  G  G+KGETG  G                              L G  G+ G+ G+ G +G  GE G KG  G  G +G PG PG++G+   +GS+GPPG+ GP+G  G  G +G  G+PG  G+PG++
Sbjct:  518 GITGPPGPSGDPGDVGPEGRPGLPGADGIPGPPGTMLMLPFHYGGDSQKGPMISAQQAQAQAILQQTKLSLKGPPGPLGLTGRPGPV------GLPGPSGLKGDIGENGPPGPRGLPGSAGPNGKPGKRGRSGADGGRGAPGETGAKGDRGFDGLPGLPGNKGHRGDRGKPGPQGPHGEPGHKGSDGPVGPRGQPGEPGIRGLVGPRGPPGPPGQQGIQGVDGVQGPKGNLGPLGEPGPPGQQGNPGIQGFPGPQGPIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKG------------------------EDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQGKTGETGPTGDRGHPGAPGPPGEQGLPGAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGVAGPIGATGERGSS------------------GPAGAIGQPGRQGGVGPA---GPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGESGHVGSMGPPGQHGPRGPQGAIGGEGPQGMPGAVGQPGVV 1312          

HSP 4 Score: 169.474 bits (428), Expect = 1.404e-41
Identity = 282/794 (35.52%), Postives = 351/794 (44.21%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIG---NTGALGPKGFIGYVGKEGARG---------VQGEKGPRGITGLTGLRGVDG------------ETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEI------------GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHG------APGPIGLQGLIGKEGEKGAIGNPGPRGEPGE------------------------------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGT------------------------DGEEGQRGDKGLL---GDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGR---------QGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQ------------GPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPN 3344
            P+G  G +GP G  GM+G  G  GPPG  G +G PG KG +GL+G QG +G+PGP G  G +G       RG  G +G +GE G PG +G  G+KG  GD G  G +G  G +G  G  GP                                        GEPG  G     G LG  G  GY G++G++G         ++GEKG RG  G  G  G  G             TG  GA+G  G DGP G  G  GP+G  G+ GE             G PG  G  G+ GF G+ G  GP G++GP G  G  G  G      APGP G QGL G  G++G  G+PGP G+PG+                              +G+ G +G  G  G+SGP G IG  G +G  GP GP G+ G+ G +G IGP+G  G  G  G PG  G  G PG  G  G  G PG KG  G                         DGE G RG +G+    GD G  GF G  GP GL+G  GP G KGE G+ G +G  G  G RG QG +G +G  G+PG +G+ G  G++G  G                                G+ GN+G  GL G +G  G  GD G          +G+PGS G    +G  G  G PG SG +G  G+ GI G PG  G  G  G++G QG  G              GP G+ G  GK G  G  G  GP G+TG  G QG  G PGP+G +G+ G  G  G N
Sbjct:  768 PIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGV------RGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPL---------------------------------------GEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQGKTGETGPTGDRGHPGAPGPPGEQGLPGAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGVAGPIGATGERGSSGPAGAIGQPGRQGGVGPAGPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGESGHVGSMGPPGQHGPRGPQGAIGGEGPQGMPGAVGQPGVVGEKGEDG------------------------------EAGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGP---KGNPGPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPGKSGPQGASGEPGPPGPPGRRGHIGPEGKEGKQGKKGAKGSAGAEGPIGKTGPVGPQGHPGNPGPEGLRGIPGSAGEQGLN 1483          

HSP 5 Score: 149.058 bits (375), Expect = 2.885e-35
Identity = 255/751 (33.95%), Postives = 315/751 (41.94%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPK------------------GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKR------------------GFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI---------------------------GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGK---------RGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKG---------------------------------DHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQG 3158
            G+ G +G KG  G  GL G  G+             G  GF G +G +G++G+ G+ G PG  G DG  GPKG+ G                 G  G  G+ G++GK+G  G  G  G+ G +G  G  G  G  GEKG +G  G+ G+ G  GP G  G  G  G  GK                G KG  G  G PG  G  G  GP+                  G  G+ G+ G  G QG+ GP G  G+ G +G  GETGP G  G  G  GP G+ G P   GA+GKEG  G PG  G  GK                   G SG KG  GP+G+ GPIGA G +GS G        G IG+ G +G +G  GP GE GE G +G +G  GRDG  GP G  G  G  GP G  G +G+ G  G +G                             G  GL+G  G+ G  G  GE GF G  G  GL+G+PG  GE         +G+ G +G  G  G  GPRGP G  G  GP+G+ G +G  G +G  G  G  G+ GN+G  G +G  GE+GEKG  G          RG+PG  GP                            G+ G +G PG  GP G  G +G  G  G  G  G PG+ G +G                                   G  GP GKTG  G +G  G PG  GL G  G  G QG
Sbjct:  818 GYPGPRGVKGADGVRGLKGSKGEK------------GEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPL---------------GEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKP---------------GAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQGKTGETGPTGDRGHPGAPGPPGEQGLP---GAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGVAGPIGATGERGSSGP------AGAIGQPGRQGGVGPAGPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGE---------KGESGHVGSMGPPGQHGPRGPQGAIGGEGPQGMPGAVGQPGVVGEKGEDGEAGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGP---------------------------KGNPGPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPGKSGPQGASGEPGPPGPPGRRGHIGPEGKEGKQGKKGAKGSAGAEGPIGKTGPVGPQGHPGNPGPEGLRGIPGSAGEQG 1481          

HSP 6 Score: 110.153 bits (274), Expect = 1.742e-23
Identity = 280/719 (38.94%), Postives = 344/719 (47.84%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNG------------MKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGS------SGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLS---------GIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQG 3230
            +G  G +GE G +GP G  G +G+ G  G  G  G +G  G  G  G  G +G+ G  G  GL G  G  GP G+ G  G +G  G  G  G  GP G PG  G  G  GP G  GE G  G QG NG              GL G  G++G  G  G+ G  GP G  GP G+ G  G  G +            G  G  G  G+QG PG  G  G  G  G  G  GK G  G +G +G RG+ G+ G  G+ G  GP+G           G IG  G  G+SG  G IG PG  G  G  G  GEKG+ G  G IGP G  G QG  G PGP G  G  G +G+KG  G PG +G                      PG  GL G+ G+ G+ G  GP+GD G  G +G  GP G QG  G  G +GE   SG  GSM   G PGQ G  G  G  G  G +G+PG  G+PG  GE+G+ G+ G  G+ G  G  G +G  G +G       +GP GI+G  G+DGP            +GN GP G+ G  G  GE G  G  G PG KG +G  G  G QG  G  G PG  G  GH G +G  G  G +G +G+ G++G +G+ G  G QG PG  G +G  GIPG +G+ GL+         G  G  G PG+ G PG  G+ G+ G  G  GP GE+G  G  GL G QG
Sbjct:  862 NGSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQGKTGETGPTGDR------------GHPGAPGPPGEQGLPGAAGKEGTKGDPGPAGQPGKSGPAGRRGFRGERGLPGILGSSGLKGGEGPLGV---------AGPIGATGERGSSGPAGAIGQPGRQGGVGPAGPMGEKGEPGEKGSIGPAGRDGEQGPVGLPGPAGPPGPPGDDGDKGETGGPGQKGSKGDKGEGGPPGPPGSQGPAGQPGPPGLDGEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGE---SGHVGSM---GPPGQHGPRGPQGAIGGEGPQGMPGAVGQPGVVGEKGEDGEAGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGP------------KGNPGPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPGKSGPQGASGEPGPPGPPGRRGHIGPEGKEGKQGKKGAKGSAGAEGPIGKTGPVGPQGHPGNPGPEGLRGIPGSAGEQGLNGPPGQTGPPGPMGPAGLPGLKGDPGIKGDKGHGGLIGLIGPPGEMGEKGDRGLPGIQG 1541          

HSP 7 Score: 90.5077 bits (223), Expect = 1.623e-17
Identity = 51/223 (22.87%), Postives = 101/223 (45.29%), Query Frame = 3
Query:  132 IDILSAVELSKHSFAIQ-QPGICKTKNSKPGYTILSNNKLKINIDQIPMDTNKNSGLPTEFSILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQY-----KMLGEVKNVIRFISKIDDGKWHNVAFGIERSYIKLYVDCKEVET-QTWDYDQKYFSKSGKLIFAEKGLIS-----VIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYETS 764
            +D+L A+ELS+    +  + G+C  +       +      KI +         +S  P  FS++ TV+ ++     +  + D +      +++G + +  Y     +   ++  + R I+ + DGKWH +A+ +E   + LY+DCK+V+T +    D    S  G ++F  + L        I+   +V   +AA  +C+ +  +CD PL     + +  E S
Sbjct:   30 MDVLRALELSEDMEGVTVEAGLCTERKGTSETDMAYRIDKKIQLSAPTKQLFPDSAFPENFSLMTTVKAKRNSQFFLLSLYDEQGVQQLGLEMGRSPVFLYEDHKGQPAPDLYPLFRKIN-LSDGKWHRIAYSVEGKSVTLYLDCKKVQTLELMRGDDPVVSTDGVIVFGTRLLDEEVFEGEIQQLLLVDDPQAASDYCQDYIPDCDSPLPYSAQKLDPEEAS 251          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-61l1.4 (si:dkey-61l1.4 [Source:ZFIN;Acc:ZDB-GENE-070705-483])

HSP 1 Score: 291.582 bits (745), Expect = 2.687e-80
Identity = 375/1127 (33.27%), Postives = 506/1127 (44.90%), Query Frame = 3
Query: 1854 FIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDG-----DRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGE----PGTDGEEGQ-RGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGL-----------PGFSGETGYQGEKGSQGPVGEVGILGKPGLGGY------------QGPRGPKG---QTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPG------PHGLPGDKGISG---------------EVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPG------------LVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGS------------IGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDI--QVGMYQFV----PR-RVKRQ-----------ARDMKSTTDPDVMVIPN--NVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCI-PAQASSRGKPLTRFLKS-QNESEWWLSKLK-----DQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLI---AKDVRYLPIIDIKFQDFGNPDQLLGYYFD--SVCFS 4895
            ++   G  G  G  G KGP+G  G  G+RG  G+ G  G  G  G  G KG IG  GP G  G +G  GP G  GD G +GF G  G+ GP G  G  G  G +G  GAPG +G QG   + G+ G  G PG +G+PG  G+QG       DG  GPQG +G +G      RG  G  G  G  G  G  G+ GP G+ G +GLRG  G  G  G PG  G+ G  G PGDKG      G D    + R  +  L D   M      G  G  G  GP G  GE G  GP G  GS G  G QG  GP G+ GLPG                  PSGL G+                      G  G  G PG  GP+G++G  G +G  G PGS G  G+ GEKG+ G+PGP+G  G  G+ G  G PG +GL           PG  G+ G  G +G QGP G  G+LG PG  G             QGP+G KG     GF G QG  G+ G  G +GLKG +GY+G  G  G      P GL G +G+ G               E G PGP GYPG+ G QG  G  G+ G +GK G                        P+G+ G  G QG  GP+G PG+ G +G+PG            L G  G  G PG +G++  KG  G  G +G +G  G+ G RGL GP+G  G+ G  G  G PG  G  GL G+ GQ+G+ G  G  G+ G              G  G  G +G PG KG +G++G  GQ G PGL  +  +  + G+  +     P+ +  RQ           + ++  T   D+M + +  N P +  +L+ L   L          +   GSK++P+ SC ++ M +   + SG ++IDPN GS +D+++  C  SE +  TC+ P Q      P+  +LK   ++S  WLS +      D    ++ ++ F   NS+IV         +Q I  +C+ +                 + FN+R +    D R +S  GT L       DC       +  + ++     +D+  LPI D+    FG+ +    ++F    VCFS
Sbjct:  185 WLVRKGDAGPAGPIGRKGPQGPRGTDGIRGPPGQPGLQGLPGQGGPQGLKGDIGKEGPVGNRGLQGIEGPMGMTGDPGPKGFPGVTGNRGPDGEKGEEGPKGKKGPRGAPGIMGPQG---ERGQSGLTGLPGVKGQPGAAGIQGI------DGEVGPQGMLGKEGQKVRGSRGEPGGNGRTGSKGSRGRAGQHGPPGIPGIVGLRGSVGAEGPEGKPGTQGVSGSVGNPGDKGPHVWPEGCDWRTRKARSFRAHLDDQAKMVLKALLGYPGAIGLRGPPGHTGERGLAGPAGERGSRGPPGRQGETGPTGFQGLPG------------------PSGLPGA---------------------EGVTGKQGPPGSLGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKGDGSPGPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQGNQGLAGRRGLQGVMGKAG------------------------PLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKGRPGPKGEQGDIGPTGQRGTPGLPGMPGLFGEKGLKGYPGLTGPKGKRGRQGPPGLPGPPGLSLNLTLTQLKDLMYLSDKPNYPLLRTLLDSLQQDLRFF------IDPPDGSKDHPATSCLEL-MITFPNLTSGMYYIDPNQGSSADALWVYCNLSEGQ--TCLSPLQPQ---MPIRSWLKDGTSDSFTWLSTIDGGFQFDYTETSVVQMRFLRLNSRIV---------KQNITFSCQSN---------------SHQGFNERDIKFLADSRRQSFLGTLL-------DCEPSGPLDSGPRESVFQFETEDLDLLPIRDLAL--FGHRETAEEFWFTVGDVCFS 1194          

HSP 2 Score: 202.986 bits (515), Expect = 3.588e-52
Identity = 261/713 (36.61%), Postives = 317/713 (44.46%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETG---------PIGAEGIRGLDGPKGQIGF---------PGPEGASGKEGEIGPPGFIGDEGK--RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK---------GAIGNPGPRGE-----------------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGE---PGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPR---------GPTGLRGS--------SGPEGIKGELGNDGPLGFIGSVGIRGHQ---------GNLGPDGYIGLPGEIG---------------EKGTKGKR---------GLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGR------------PGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGL---------------------------------KGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGK 3494
            G+ G  GP G  G  G EG  G+ G+ GP+G  G+TG RG DGE G         P GA GI G  G +GQ G          PG  G  G +GE+GP G +G EG+  RG  GE G +G  G  G  G  G  G  G PG +GL+G +G EG +         G++GNPG +G                                 +G  G +G+ G  G++G +G  G  G+RG  GP G QG+ G  G QG  GPSGL G+ G+ G+   PG +G  G  G  G +GL G PG  G  G  GE+G++G  G  GD G +G  GP+         GPTG +G          GP G +GE G  G  G +G+ G RG +         GN GP G  G PG  G               E+G KG +         GL G  GPSGLMG  G  G +G  G  G  G  G  G  G  G PG Q   GNQG  G  G QG+ G  G  G  G KG  G+ GP G  G  G +G  GR             G  G  GF G+ G    KGS G  G  G  GK G  G +G RGPKG  G +G QG  G PG QG  GL                                 KG +G  G  G PGP G  GD G +G+ G PG  G PG  G +G  G  G+TGP GK G+
Sbjct:  235 GDIGKEGPVGNRGLQGIEGPMGMTGDPGPKGFPGVTGNRGPDGEKGEEGPKGKKGPRGAPGIMGPQGERGQSGLTGLPGVKGQPGAAGIQGIDGEVGPQGMLGKEGQKVRGSRGEPGGNGRTGSKGSRGRAGQHGPPGIPGIVGLRGSVGAEGPEGKPGTQGVSGSVGNPGDKGPHVWPEGCDWRTRKARSFRAHLDDQAKMVLKALLGYPGAIGLRGPPGHTGERGLAGPAGERGSRGPPGRQGETGPTGFQGLPGPSGLPGAEGVTGKQGPPGSLGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKGDGSPGPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQ---GNQGLAGRRGLQGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKGRPGPKGEQGDIGPTGQRGTPGLPGMPGLFGEKGLKGYPGLTGPKGKRGR 944          

HSP 3 Score: 181.8 bits (460), Expect = 1.575e-45
Identity = 291/829 (35.10%), Postives = 358/829 (43.18%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGL---------------------IGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGG------QGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGA---------LGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP--------------------------------IGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGF------SGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL------QGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDG---------------EEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG------------ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS------------QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG 3347
            +G IGRKG +G +G  G+                      GDIGK G         P+G  G +G  G +GM G+ G +G PG+ G+ G  G KGE G                            +GK GPRG       QGE G+ G+ GL G+KG  G  G +G  G +G  G  G  G +                                      +GEPGG G TG+          GP G  G VG  G+ G +G +G  G  G++G  G  G+ GP                                +G  G  GL GP G  G  G  G +G+ G  GPPG  G+ G  GF      SG  G  G  G  GP G++G QGS G  GPIGL       G+IG+ GEKG  G PGP G+PG +GL G  G  GR G  GP G  G DG  GP G  GP G       QGE GP   +GS G+ G PG  G+ G  G  G+ G +G  G KG+PG  G               E G +G+KG LG  G  G  G  GP+GL G  G  G++G            E G+ GP G+ G  G +G  G  G  G +G  G +G  G KG +GL G KG  G  G  G  G +G  G  G  GL G+NG  G  G  G    +G+ G  G  GR+G  G  G  G +G KG  G  G  G TG  G +G  G PGI G  G +G  G++GEKG             +G  G  G+ G+PG  G QG  GP GQ    G  G  G+PG  G KGLKG  G  GP G
Sbjct:  195 AGPIGRKGPQGPRGTDGIRGPPGQPGLQGLPGQGGPQGLKGDIGKEG---------PVGNRGLQGIEGPMGMTGDPGPKGFPGVTGNRGPDGEKGEEG---------------------------PKGKKGPRGAPGIMGPQGERGQSGLTGLPGVKGQPGAAGIQGIDGEVGPQGMLGKEGQKVRG----------------------------------SRGEPGGNGRTGSKGSRGRAGQHGPPGIPGIVGLRGSVGAEGPEGKPGTQGVSGSVGNPGDKGPHVWPEGCDWRTRKARSFRAHLDDQAKMVLKALLGYPGAIGLRGPPGHTGERGLAGPAGERGSRGPPGRQGETGPTGFQGLPGPSGLPGAEGVTGKQGPPGSLGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKG-DGSPGPKGKPGPNG------FQGEQGP---QGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQGNQGLAGRRGLQGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKGRPGPKGEQGDIGPTGQ---RGTPGLPGMPGLFGEKGLKGYPGLTGPKG 940          

HSP 4 Score: 166.777 bits (421), Expect = 6.513e-41
Identity = 253/698 (36.25%), Postives = 319/698 (45.70%), Query Frame = 3
Query: 2280 QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKG---------------------PQGDIGK------IGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG--------IKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXX-----XXXXXXXXXXXXXXXHNGD------KGNIGLP---GLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGD---HGIPGPSGKTGLSGIRGITGRPGIL------------GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKF--GVPGPQGAKGLKGEQGYMGPNGYPGPHGLPG---------------DKGISGEVGDPGPIGYPGN---------------------IGRQGAPGLVGVTGP---IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIP---------GKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGP---RGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            QG    + R G++GP G IG  G +GP G  G                      +GDIGK       GLQG  GP G+ G  G +G PG  G  G  G  G  G +G  G +G PG  G +G+RG  GL G  G+ G PG  G  G+ G  GP+G        ++G  G  G  G  GS G RG  G  GP G  G+ G  G  G +G  G PG +G SG +G+PG++G                    H  D      K  +G P   GL+GP G+ G  G  G  G  GS+G PG QGE G     G+PGPSG  G  G+ G  G PG L            GLPG  G +G  G+ G +G  G  G  G PG  G  GP+G  G+ G EG  G    G PGP+G  G  G QG  GP G  G  G PG               ++G  G+ GDPG  G+ G                      +G QG  GL+G  GP   +G  G +G +G  G  G  G KG  G  GP G  G  G+QG  G RG+          G +G +G  GL+G  G PG+ G  G  G +G  G+KG  G+ GN G +G  G  G    +G SG+ G  G+ G  G+ G +GL+G  G +      G +G  G+ GPPGR G  G PG++G KGE G  G +GE G
Sbjct:  180 QGLQDWLVRKGDAGPAGPIGRKGPQGPRGTDGIRGPPGQPGLQGLPGQGGPQGLKGDIGKEGPVGNRGLQGIEGPMGMTGDPGPKGFPGVTGNRGPDGEKGEEGPKGKKGPRGAPGIMGPQGERGQSGLTGLPGVKGQPGAAGIQGIDGEVGPQGMLGKEGQKVRGSRGEPGGNGRTGSKGSRGRAGQHGPPGIPGIVGLRGSVGAEGPEGKPGTQGVSGSVGNPGDKGPHVWPEGCDWRTRKARSFRAHLDDQAKMVLKALLGYPGAIGLRGPPGHTGERGLAGPAGERGSRGPPGRQGETGPTGFQGLPGPSGLPGAEGVTGKQGPPGSLGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKGDGSPGPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQGNQGLAGRRGLQGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHK------GQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKG 871          

HSP 5 Score: 155.221 bits (391), Expect = 2.364e-37
Identity = 200/509 (39.29%), Postives = 249/509 (48.92%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGAS------GKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAI--GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------PGEIGLQGQVGIIGRDGNSGPQ---GDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS---GLKGSMGLR---------------GEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG------MPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVG 3194
            ++G  G  G  G  GP GF            QG  GP   +GL G  GV G+ GP G+ G +G  G +G IG PG  G+S      G++GE G PG  GD G  G  G +G  G VGL GP G+   GS G  G PGP G QG  G +G +G +G PGPRG+          G  G +GQ G  G  G SG Q   G +G  G+RG  G KG  G  G+ GL G+IGPS   GL+G MGLR               G PG  G  G  G  GL G RGL G  G+ G  G  G +G +GL+G  G  G  GP+G  G RG  G +G  G  GN+GP GF G  G    +G+ G  G+ G  G+ G+ G +G RG  G KG  G  G+ G                    G +G  GLPG++G +G  G+ G  G +G       PG  G  G +G +G  G PGP G+ G  G  G  G PG+ G+PG  GE G +G  G  GP G+ G
Sbjct:  468 ERGSRGPPGRQGETGPTGF------------QGLPGP---SGLPGAEGVTGKQGPPGSLGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKGDGSPGPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQGNQGLAGRRGLQGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPP------------------GRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKGRPGPKGEQGDIGPTGQRGTPGLPGMPGLFGEKGLKGYPGLTGPKGKRG 943          

HSP 6 Score: 133.65 bits (335), Expect = 8.478e-31
Identity = 200/581 (34.42%), Postives = 250/581 (43.03%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKG--FIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKE------------GEIGPPGFIGDEGKRGFSGEKGDSGPVGL------------------------IGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGR---------------DGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR 2804
            G  G  GE+G +GP G  G+ G            P G+ G  GP G  G  G TG+QGPPG +G  GS                                          +G QG IG PG  G +GM G  G+ GE+G  G  G+ GS G  G                                        QG PG +G  G  G KG    G  GK G  G QGE+GP+G  G+ G  G  G+ G IG  GI G  GPKGQ G PG  G SG++            G  G  G++G +G+ G  G+ G SG +GL                         GP G  G QG+ G  G  GLQG++GK G  G +G  GP+G  G  G  GQ G  G                 GN+GP G  G +G+    G  G  G  G+ G  G+ GP GL+G  G +G+ G  G +G PG  G  GL G+ G KGE G  G EG++GD+GLLG  G  G  G RG  G++G  GP   KGE G+ GP G  G+ G+ G  G  G  G  G PG  G KG +G++
Sbjct:  461 GLAGPAGERGSRGPPGRQGETG------------PTGFQGLPGPSGLPGAEGVTGKQGPPGSLGPQGS------------------------------------------KGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYG---------------------------------------PQGHPGRVGLEGPTGSKGDGSPGPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQGPKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGDQGNQGLAGRRGLQGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGPKGEPGRRGPPGLKGPPGLTGNNGPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKGRPGP---KGEQGDIGPTGQRGTPGLPGMPGLFGEKGLKGYPGLTGPKGKRGRQ 945          

HSP 7 Score: 127.487 bits (319), Expect = 7.513e-29
Identity = 223/593 (37.61%), Postives = 274/593 (46.21%), Query Frame = 3
Query: 1398 PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALG---PKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPV------GLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKG---------------AIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEK---------GTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTG 3077
            PG +G  G PG  GERGL G  G                     +RG  GP G QGE G  G QGL G  GL G  G  G +G  G                 G  GS GK+G  G PG  G  G+IG  G KG+QG PG  G+ G++G   P+G  G VG EG  G +G+  P G  G  G  G  GE GP G++G+ G  GP+G+ G  GP G +G +G   P G  GD G RGFSG++G  G +      GL G  G +GSQG +G  G IG  GL+G EG  G                 G+PGP G PG+   QG  G+ GR G    QG +G  G  G  GPKGPQG +G  G  G+ GP         +GEPG+ G  G  G  GL G     G  G PG +G + ++G  G  G  G  G  G  GP GLRG  G +G +G  GN GP G  G  G+ G +G  G +G  G  GE G++         G KG RGL G+KG                                     PG +G +G+ G  G  G  G+PG  G  GE+G KG  G+ GP GK G
Sbjct:  445 PGAIGLRGPPGHTGERGLAGPAG---------------------ERGSRGPPGRQGETGPTGFQGLPGPSGLPGAEGVTGKQGPPGS---------------LGPQGSKGKQGPIGLPGSPGSSGMIGQTGEKGEQGVPGPAGDPGSVGLYGPQGHPGRVGLEGPTGSKGDGSP-GPKGKPGPNGFQGEQGPQGSQGVLGAPGPRGKEGGIGPPGITGNQG---PKGQKGDPGHRGFSGQQGPPGLLGDGGERGLKGNKGYLGSQGQNGLMGKIGPSGLMGLEGLMGLRGPPGANGPPGPKGETGSPGPNGYPGD---QGNQGLAGRRGL---QGVMGKAGPLGVVGPKGPQGLMGPKGFPGQEGP---------KGEPGRRGPPGLKGPPGLTGNN---GPSGFPGKEGNDARKGSSGKTGHAGRRGKAGKAGPRGLRGPKGHKGQQGAQGNTGPPGRQGQYGLPGIRGQKGENGAKGFEGEKGDRGLLGPPGGDGLKGNRGLQGVKG------------------------------------RPGPKGEQGDIGPTGQRGTPGLPGMPGLFGEKGLKGYPGLTGPKGKRG 943          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 341.273 bits (874), Expect = 1.151e-95
Identity = 377/1086 (34.71%), Postives = 463/1086 (42.63%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGF---------YGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPL------------GFIGSVGIRGHQGNLGPDGYIGLPGEIGEK------------GTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGP------------HGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGP---------------QGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G+ G  G KG  G  G+ G+ G  G  GP G  G  G  G  G +GP G  GIRG+ G +G    PGP+G +G  G  G  G  G  G RG +G+ G  G  GL+G  G  G  GS G  G  G  G  G EG  G  G  GPRGEPG IG  G           GP G+ G +GD+G  GP G +G  G  G  G  GP GL G+ G +GE G  G  GF G           G  G RG PGD G  G  G  G+RG  G  G  G +G  GPRGPTG  GS G +G  G  G +G L            G  G  G +G +G+ G  G  G PG  G +            G  G RG  G  GPSGL G              G  G  G  G  G+ G  G  G  G+ G  G+ G +G  G  GSPG  G  G HG  GP+G  G +G RG  G PG  G PG +G TG  G  G  GP G  G  GK       GPRGP+G +G  G  G+ G+ GPQG  G KG  G  GP G PG              GLPG +G  G  G PG  G  G  G  G+ G  G +GP+G PG  G  G  G +G  G  G  G     GL G  G +GY G  G  G +G  G PG VG  G  G                    G  G  G  G  G  GPRG SG+ G  G +G  GE G +GL G  G  G  GLPG  G  G  GP G  GP               +G  G  G  G +GL G  G  G                                D          + A L  L  ++E +  L  +     GSK+NP+R+C+D+ + S+   +SG +WIDPN G  SDS+   C FS  E  TCI A   S  +      K++     W  +  +   Q     + +T     +Q  F++ L + A Q I   C+ S+ Y D    N + AI ++  ND +L +  + R       ++LE    D C +         I         LPI+DI   D G  DQ  G     VCF
Sbjct:  337 GDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRG---LPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGP---------KGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGP------------RGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGK------DGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRD---GLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGN------------------RGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQGPAGPPGPPGLPGPAGASGGGYDGGFGGEFFRADQPARRPKDYEVDATLKSLNNQIETI--LTPE-----GSKKNPARTCRDLRL-SHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGE--TCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFT----FSVLE----DGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1353          

HSP 2 Score: 218.009 bits (554), Expect = 1.793e-56
Identity = 281/763 (36.83%), Postives = 327/763 (42.86%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFP------------GPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLI---GPIGAIGSQGSHGAPGPIGLQGLI------GKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRD---------------------GNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLR------------------GLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY------------IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVG 3401
            G  G  GP G  G  G  G +GP G  G  G  G  G RG+ G +G  G  G  G  G  G  G  G  G  GP G  G  G+PG+ G  G+ G  G  G  G +G  G                                   G  G  G  G  G +GEPG IG     GPKG  G  GK G +G QG  G RG  G  G  G  G  G  G  G +G  GP G  GF             G  G  G  G+ GP G  G  G+RG  GE G +GP+G +   GP GA GS G+ G PG  GL G +      G  GE+GA G PGP+GE G+ G  G+ G  GRD                     G SGP G  G+ G RG  G +G  G  G  G  G  G +G  G  G RG  G  GESG PG  G +G                    G PG  G PG  G  G  G  G++G  G  G PG  GP G RG SGP G  GE G  GP G IG  G  G  G  GP G              GLPG  GE+GT G  G  G  GP+G  GS                   G  G  G +G PGL G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G              G +G PG  G +G  G +G  GPVG  G +G        GPRGP GQ G  GD+G+ G    +GA+GL G +G+ G  G PGP G PG+ G +G  G
Sbjct:  352 GEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQ---------------------------------GIEGRSGPAGASGPRGEPGSIGFP---GPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGS------------------AGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSL------------GAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGP------AGPRGPSGQQGTRGDKGEAGE---RGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNG 1039          

HSP 3 Score: 211.846 bits (538), Expect = 1.473e-54
Identity = 323/841 (38.41%), Postives = 391/841 (46.49%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGP---------------IGAIGSQGSHGAP---------------GPIGLQGLIGKEGEKGAIGNPGPRGEPGEI------------------GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGP------KGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGL---LGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF------IGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDK---GNIGLPGLQGPRGNQGSDGDVGRQ------------GMPGSQGSPGEQG------------------EKGDHGIPGPSGKTGLSGIRGITGRPGILGL------PGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFE---GDQGKFGVPGPQGAKGLKGEQ------GYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP---IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGE---LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELG 3995
            G++G  G  G  G VG +GARG  G  G  G  G+ G  G+DG+ G  G  G++G  G  G+ G PG  GA G  GE G  G  G  G RG  G  G +GP G IG                IG+ GS GS GA                GP G  G  G  G KGA G PG  G PG                    GL G  G+ G  G++G +G+ G  G  GPAGP      +GP G+ G  G  G  G  G+ G+ GL G  G+ G  G PG  G     G RG  GD G PG  G  G RG  G  G  G  G  GP GP G+ G SGP G  G  G  G +GF       G  G  G +G+ GP G  G PG  G  G +G  GL G  G  G  G  G  G QG+ G  G  G +G +G++   G+ G  G  GPRG +G+ G+ G              G PGS G+ GE G                  E+G  G+PGP G+ G +G  G  G PG  G        G  G  G  G++G  GP G  G+ G  G  G +G  GP G TGF    G  G  GV G +G KG KGE       G +G +G  GP+G  G  G  G+ G PG  G+PG  GR GAPG  G+ GP    G PGK G +G  G  G  G  G +G+ GP GL G  GS G  GP G PG  G  G  G +G  GLPG  G  G  G  G  G  G +G  G+ G  G  G VG  G++G  G  G++G PG     G  GL GV G+RG PG  G  G +G++G PG VGP G+ G +G  G +G
Sbjct:  136 GHSGKSGRPGERGTVGSQGARGFPGTPGLPGFKGIRGHNGLDGQKGGPGVAGVKGETGANGENGSPGQSGARGLPGERGRGGPPGPAGSRGSDGSAGPTGPAGPIGSAGPPGLPGAPGAKGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVG 976          

HSP 4 Score: 205.297 bits (521), Expect = 1.594e-52
Identity = 289/812 (35.59%), Postives = 333/812 (41.01%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFP------------GPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGP---IGAIGSQGSHGAPGPIGLQGLIGKEG------EKGAIGNPGPRGEPGEIGLQGQVGIIGRDG---------------------NSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG------------------LPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIG------------LPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGP---------------------NGYPGPHGL 3368
            G  G KGE G  GP G  G  G+ G +G      P G  G  GP GN G+RG  G +G PG  G  G  G  G RG +G                          G  GP G  G  G+PG+ G  G+ G  G  G  G +G  G  G  G  GP G  G                                  +GEPG IG  G   PKG  G  GK G +G QG  G RG  G  G  G  G  G  G  G +G  GP G  GF             G  G  G  G+ GP G  G  G+RG  GE G +GP+G +GP    GA GS G+ G PG  GL G +G  G      E+GA G PGP+GE G+ G  G+ G  GRDG                      SGP G  G+ G RG  G +G  G  G  G  G  G +G  G  G RG  G  GESG PG  G +G  G                   PG  G PG  G  G  G  G++G  G  G PG  GP G RG SGP G  GE G  GP G IG  G  G  G  GP G  G            LPG  GE+GT G  G  G  GP+G  GS G                    G  G +G PGL G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G  G  G  G    +G+ G  G PG  G  G  G  G +GP G+ G  G  G  G +G RG  G+ G  G QG   +PGP G+ G  G  G  GP                     NG  GP GL
Sbjct:  346 GDTGAKGEPGSAGPSGPAGPSGEEGRRG------PNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPA------------------------GARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASG---------------------------------PRGEPGSIGFPG---PKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAG------------------SRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQG---LPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGL 1070          

HSP 5 Score: 192.2 bits (487), Expect = 1.532e-48
Identity = 313/847 (36.95%), Postives = 376/847 (44.39%), Query Frame = 3
Query: 1848 KGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL------------------QGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQI---------------GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------------------------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEG------------DQGKFGVPGPQGAKG---------------------------------LKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRV------GPQGEPGLKGVKGELGL---PGQDGEPGLIKIIDIQ 4046
            +GF G+ G+ G  G  G  G  G +G  G  G DG +G  G  G RG  G +G  GFPG  G          PGF G  G  G  G+KG  G  G+ G  GA G  GS G  G  GL                   G  G  G  G IG+ GP G PG  G +G++G  G  G++G  G  G  G  G  GP GP G+ G  G+ G  G +GL G  G  G PG                 G SG PG  G  G  G  G+ G  G  G  G  G++G  G  G  G  GP G  G+RG  G  G+ G  G  G +G  GS G  G  G  GP+G  G P   GE G  G RGLPG  G +G  G  G  G QGI+G+ G  G  G  G+ G+IG PG +GP G  G +GD G QG  G++G+PG  G  G  G PG +G TG  G +G  G PG                             G  G  GE G  GE G+ GP+G +G  G  G  G  G +G  G  G  G            ++G  GVPGP+G KG                                  +GE G  GP+G  GP G PG++G +G  G  G  G PG  G  G  G  G  GP G+ G  G  G +G  G  G  G  G +GP G  G  G+ G+ GP G  G  G  G  G  G  G PGK G  G  GD G  G  GE GI G +G  G +G  G  G +G  G +G  G+ G LGI GL G  G+RG PG PG  G+ G  GP G        GP G PGL GV GE G    PG DG PG   +  ++
Sbjct:  102 QGFQGHAGEPGEPGQPGPLGSTGPSGPPGKPGEDGHSGKSGRPGERGTVGSQGARGFPGTPGL---------PGFKGIRGHNGLDGQKGGPGVAGVKGETGANGENGSPGQSGARGLPGERGRGGPPGPAGSRGSDGSAGPTGPAGPIGSAGPPGLPGAPGAKGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRP---GEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVK 936          

HSP 6 Score: 169.474 bits (428), Expect = 1.436e-41
Identity = 298/841 (35.43%), Postives = 359/841 (42.69%), Query Frame = 3
Query: 1854 FIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG--------LDGPKGQIGFPGP---------------------EGASGKEGEIGPPGFIGDEGKRGFSG---EKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM------------------DGDRGPAGPKGPQGDIGKIGL------QGEIGPSGLKGSMGLRGEP---------GQIGESGFPGFYGLLGLRG---LPG------------------------DKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQG------YYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGE------AGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPG------RVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            ++     EG RG +G +G RG  G  G  GVDGE G  G  G  G         D  K   G PGP                     +G +G+ GE G PG +G  G  G  G   E G SG  G  G  G +GSQG+ G PG  GL G  G  G  G  G    +G PG  G++G+ G  G +G+ G  G  G+                  DG  GP GP GP G  G  GL      +GEIG +G  GS G  G           G +G +G PG  G+ G +G   LPG                         +G  G  G  G +GD G  G+ G  G  GP GP+G  G  GP    GE G+ GP G  G  G+ G +G  GPDG  G    +G  G++G  G  G +GP                           NGD G  G PGL G RG           G  GS G  G++G  G  GI G SG  G SG RG  G  G  G  G +GE G  G+KGSQGP G  G  G  G  G QGP G  G TG +G+QG  G PG QG  G  G  G +G +G     G PGD G +G  G  G  G PG  G  G  G +G  GP G PG  G +G  G                 GL+G +G  G        G  G+PG  G +G  G  G  G PG+ G  G  G  G  G  G +G +G  G  G  GL GPRG  GE      AG TG  G PG     G+KG +G  G +G+ G PG  G +GS GP G        GP+G+ G  G  G  G  G+ G PG   I+
Sbjct:   18 YLATCQSEGPRGDKGPQGERGPPGAPGRDGVDGEPGLPGPPGPPGLGGNFAAQYDPSKSGGGEPGPAGLMGPRGPPGPPGSPGAQGFQGHAGEPGEPGQPGPLGSTGPSGPPGKPGEDGHSGKSGRPGERGTVGSQGARGFPGTPGLPGFKGIRGHNGLDGQ---KGGPGVAGVKGETGANGENGSPGQSGARGLPGERGRGGPPGPAGSRGSDGSAGPTGPAGPIGSAGPPGLPGAPGAKGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGP---NGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAG---GMGAPGSRGASGPAGARGP---------------------------NGDAGRPGEPGLLGARG---------LPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGE---RGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGA---------------AGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIV 795          

HSP 7 Score: 167.162 bits (422), Expect = 8.644e-41
Identity = 265/681 (38.91%), Postives = 308/681 (45.23%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM---RGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP------------IGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL---KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTG---LRGSSGPEGIKGELGNDGPLGFIGSVGI---RGHQGNLGPDG---YIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG------IPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQ 3155
            GR G  G  GP G  G IG  G +G  G  G  G  G +GP GN G     GN G QGPPGL G+ G  G +G  G  GFQG  G  G  G  G  G  G PGD G  GP G +GE G PG    +G  G +G +G +G  GA G DG+                                             +GEPG  G  GALGP G  G  G+ GA GV G KG +G  G +G  G  G  G              GA G RG  GP G  G  GP GA G+ GE GP G  G        G  G  GE+G  GP G  G  GA+G+ GSHG  GP G  G  G  G+ GA G  G  G  G  G  G  GI+G      P G  G  G  GP GP+G  G +G+ G QG  GP GL   KGS G  G  G  G SG  G  G LG+ GLPG +GE GT G  G  G+ G  G  G  G  GP GP G   L G  G  G  G  GNDGP G  G  G+   RG+ G  GP G    +G PG +G  G  G RG PG  G +G +G  G +G  G              G +G+ G  G +G RG  G  G  G QG+PG  GSPGE G  G +G          +G +G  G  G +G  G +G  G  G  G+Q
Sbjct:  466 GRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGE---SGAAGPLGALGPRGPTGAPGSDGA---------------------------------------------KGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVG------PSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSG------------QQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGP---AGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQ 1077          

HSP 8 Score: 154.836 bits (390), Expect = 4.426e-37
Identity = 243/636 (38.21%), Postives = 285/636 (44.81%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP---------------------------PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGM------------KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGF---SGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGL------LGDFGIMGFPG---PRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKG---KRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQ 2966
            G IG  G KG  G  G  GD G  G  G  G  GP G  G +GP G  G  G+ GEQGP                           PG  G  G  GP+GERG  G  G  G  G  G             RG  G  G  G  G+PG  GLNG             +G  G  G KG KG  G  G YG                    G  G  G  G  G  G  G  GD+GE G  G +G  GP+G  G  G+ G  G  G  GP G  G TG++G   E GP G +G  G  G  G +G  GP G +G  G  GP G  G  G  GF   +G  G  GP G++GP GA G  G  G  GP G  G +G+ GE+G IG  GP+G  GE G  G+ G  G  G SGP G +G  G  G  G +G +G  G  G  GE GP+G  GS G RG  G +G  G  G +G  G  G PG+ G PG DG  G +G++G        G  G +G PG   P G +G RG  GP G  G +G  GP G  G  G RG +G  G  G  GL G  G  G +G     G PG  GP+G  G  G +G  G  G PG  G  GHNG  G +   GL+GP G+Q
Sbjct:  481 GSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGAPGDFGPAGPAGPRGERGAPGESGAAGPLGALG------------PRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYG------------------NPGRDGARGPAGASGAPGPAGAAGDRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKG---ERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQG-IG--GPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPV---GLRGPAGHQ 1077          

HSP 9 Score: 107.457 bits (267), Expect = 1.488e-22
Identity = 153/404 (37.87%), Postives = 187/404 (46.29%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE------KGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGII---------------GRDGNSGPQGDIGMDGDRGPAG 2366
            +GH G KGE+G KGP G  G  G +G  G  G  GP G  G  GPRG+ G  G  G  GP    G  G+PGP G  G +G  G  G                    G  GPRG  G +G+PG QG+ G +GL+G+ G  G  G  G                          G  G  GV+G  GI G+ G +G++G PGG G  G  GP    G  G  G+RG  G  G  G+TG+ G  G DG  G  G  G  GL G KG+ G+PG  G +G  G +G PG +G  GK G  GE       G  GP G  GP G  G++G  G  G  G +GL G++G  G  G PGP G PGE G  G  G                 GR G++GP G +G+   RGPAG
Sbjct:  723 AGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGP---AGRTGAPGPAGIVGPSGATGHPG------------------KDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAG------------------------PPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGP---AGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGL---RGPAG 1075          

HSP 10 Score: 63.5438 bits (153), Expect = 3.238e-9
Identity = 121/318 (38.05%), Postives = 149/318 (46.86%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGH---DGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK---PGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIG 2150
            H G  G +G +G  GP G  G+ G         + GP G  G +G  G  G  G  G  GP G++G     G PG +GERG  G  G  G  GP GP G  G  G  G  G  G  G  GE G+   PG  G  G  GL G  GE+G+ G  G                             G+ G +G PG +G  G  G++GEPG +G+ GA+GP G  G  G++G RG +GE G RG  GL G +G +         G++GL GP G  G  GP G++G  G  GP G  G  GK G SG  G  GPVGL GP G
Sbjct:  803 HPGKDGPRGPRGDSGPVGRPGEQG---------IGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGP---------------------------AGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHN---------GLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 1075          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 326.25 bits (835), Expect = 1.619e-91
Identity = 389/1059 (36.73%), Postives = 484/1059 (45.70%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGV---------DGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIR-----------GHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQG---APGLVGVTGPIGK---PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            +G+ G  G  G+ GP G  G  G+EG RG  GE G  G  G  G+RGV         DG  G +GA G RG  GP G  G   P G +G+ GE   PG +G  G  GFSG  G +G  G  GP G  G  G  GA GP G  G IG  G KG  G PG  G+ G  G  G  G  G DGN+G QG  G+ G+ G  G +GP G  G  GL G  G +G  G  G RGE G  GESG  G  G LG RG     G PG+DG +G+ G  GL G  G  G  G  G  G  G  GP+G KG+ G+ G  G  G  G R           G  G  GP G  G  G  GE+G  G  G  G  GP G  G                     H G KG  G  G +G  G+ G+ G VG  G  G  G  G  G +GD G PG     G  G  G TG PG  G+ G SG TG+ G+ G +GP G+ G +G+PG  G  GP+G  G+ G  G+ G  G PG  G  G+ G  G  G  G  G  G PG  G +GE G  GP G  G+ G  G   +PGL GV G  G+   PG  G  G  G  G KGE+G  G +GP G  G VG+ G  GP G   K G +G+PG VG  G  G        G +G  G +G  G +G  GE G RGL G +G +G  G+ G  G PGE G  G  G +G RG  G  G  GK G  G  G +GP    GL+G  G  G  G  G PGL        G Y         +A D  +    D  V         A L  L  ++E +  L  +     GSK+NP+R+C+D+ + S+   +SG +WIDPN G  SDS+   C FS  E  TCI A   S  +      K++     W  +  +   Q     + +T     +Q  F++ L + A Q I   C+ S+ Y D    N + AI ++  ND +L +  + R             ++D C +         I         LPI+DI   D G  DQ  G     VCF
Sbjct:  194 KGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARG---PNGDAGRPGE---PGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRG---PTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAG---------------------HTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPG---ANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSG---KSGNRGEPGPVGHAGAVGP------AGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPV---GLRGPAGHQGPAGPPGPPGLPGPAGASGGGYDGGFGGEFFRA-DQPARRPKDYEVD--------ATLKSLNNQIETI--LTPE-----GSKKNPARTCRDLRL-SHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGE--TCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSV--------LEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1180          

HSP 2 Score: 229.565 bits (584), Expect = 2.243e-60
Identity = 289/780 (37.05%), Postives = 338/780 (43.33%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGP---IGAIGSQGSHGAPGPIGLQGLIGKEG------EKGAIGNPGPRGEPGEIGLQGQVGIIGRDG--------------NSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG------------------LPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIG------------LPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVG 3401
            G  G KGE G  GP G  G  G+ G +G      P G  G  GP GN G+RG  G +G PG  G  G  G  G RG +G                          G  GP G  G  G+PG+ G  G+ G  G  G  G +G  G  G  G  GP G  G                                  +GEPG IG  G   PKG  G  GK G +G QG  G RG  G  G  G  G  G  G  G +G  GP G  GF G  G  G  GE+G     G+ G+RG  GE G +GP+G +GP    GA GS G+ G PG  GL G +G  G      E+GA G PGP+GE G+ G  G+ G  GRDG               SGP G  G+ G RG  G +G  G  G  G  G  G +G  G  G RG  G  GESG PG  G +G  G                   PG  G PG  G  G  G  G++G  G  G PG  GP G RG SGP G  GE G  GP G IG  G  G  G  GP G  G            LPG  GE+GT G  G  G  GP+G  GS G                    G  G +G PGL G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G              G +G PG  G +G  G +G  GPVG  G +G        GPRGP GQ G  GD+G+ G    +GA+GL G +G+ G  G PGP G PG+ G +G  G
Sbjct:  195 GDTGAKGEPGSAGPSGPAGPSGEEGRRG------PNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPA------------------------GARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASG---------------------------------PRGEPGSIGFPG---PKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELG---KHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAG------------------SRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSL------------GAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGP------AGPRGPSGQQGTRGDKGEAGE---RGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNG 866          

HSP 3 Score: 214.927 bits (546), Expect = 9.021e-56
Identity = 293/789 (37.14%), Postives = 349/789 (44.23%), Query Frame = 3
Query: 1554 GGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPG---------PRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQG------------EIGPSGLKGSMGLRGEPGQIGESGFPG-----------FYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS---VGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAG 3815
            GG+G+ G  G  G  G  G  G  GE+G +G  GE                               G  G  G  G++G+ G +G PG  G  G +G  G  G  G  GARG  G+ G  G  GL G RG+ G +G  G  G  G  GP+G  G  GP GASG  GE G  GF G +G  G  G+ GD G  G  G  GA G  G++GA GP GL G  G +GE+G  G PG           GE G+ G +G+ G  G  G +GP G +G  G  G  G  G +G+ G  GL G            E G +G+ G  G +G+ G  GE G PG            Y   G  G  G  G  G  G  G+RG+ G  G  G  G PG  G TG++G  GP+G KGE G+ G LG +GS    G  G  G  GP G  G PG  G  G  G+ G P   GP+G++G                          G  G PG  GPRG +G  G VGR G  G  G  G  GEKG  G  GP+G  G SG  G+ G  GI GLPG  GE G  G  G+ G  G  G  G  G  G  GP G  G TG  G+ G+ G PG  G  G  G  G  G  GYPG  G  G  G  G  G  GP G  GN G  G  G  G  GP G  G  G+Q                     G  G  G  G  G RG+ G+ G  G  GL G  G PG+ G  G  G  G +G  G SG  G +G +G  G +GP G+ G AG
Sbjct:  192 GGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGE------------------------------AGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAP---GPAGIVGP------------------------SGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQ---------------------GTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 902          

HSP 4 Score: 187.578 bits (475), Expect = 3.386e-47
Identity = 285/694 (41.07%), Postives = 340/694 (48.99%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEK---GHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKR-----GFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQ---------IGESGFPGFYGLLGLRGLPGDK---GEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGL------RGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPD---GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPG 3212
            SG  GR+G  G+ G  G  G+ G  G  G  G+ GP G  G  G  G+ G  G  G +GP G  G  G PG  G RGL GF G  G  G +GP GP+G  G  G  G  GPRG  G IG PG +G  G  G  GD G +   G++GA G DG+ G  GP G  G  G  G  G  G PG  G+ G  G  G  G  G++GE G  G +GA GP G +G  G  GA G  G KG  G  GL G  G  G  G  G  G  G+ GPKG+      +G +G  GE G PG  G    R        GE G +GP GL GP GA G +G  G  G  G  G  G  G  G  G  GP+G  GE G  G +G +G  G +GP G  G  G RG  G  G  G  G  G  G  GP+G+ G  G  G PG+          G  G PG  G+ G +GL G+K   GE G  G  G  G  G+LG  GI G PG RG  G        G SGP G  G  G+ GP G +GS G+ G  G  G D   G  G PG  G  G KG+RG PG  GP+G +G+ G  G  G  G+ G  G  G  G  G +G  G +GP G QG+ GD G  G  G++G  G +G  G  G+PGP+G  G +G  G  G  G  G  G SG  G +G  G  GP+G VG+ G  G
Sbjct:  215 SGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGE------KGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 902          

HSP 5 Score: 186.808 bits (473), Expect = 6.018e-47
Identity = 265/711 (37.27%), Postives = 324/711 (45.57%), Query Frame = 3
Query: 2124 PVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI------------GMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI------------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEG------------DQGKFGVPGPQGAKGLKGEQG--------------------YMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAG------ITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVG------PQGEPGLKGVKGELGL---------PGQDGEPGL 4025
            P+ L G IG+ GS GS GA GP G  G  G  G  G  GNPG  G  G  G  G  G+ G  G  GP+G              G+ GD G AG KG   D G  G  G  GPSG  G  G  G  G  GE+G  G  G  G+RG+PG +G PG DG  G             MG PG RG +G  G+ GP    G+ G  G  G +G+ G+ G  G+ GP          G++G  G +G+ G  GP+G  G                       G+ G+IG PG +GP G  G +GD G QG  G++G+PG  G  G  G PG +G TG  G +G  G PG             LG  G  GE G  GE G+ GP+G +G  G  G  G  G +G  G  G  G            ++G  GVPGP+G KG  G  G                    + G +G  GP GL G +G  GE G+ GP G  G  G  GA G  GV G  G  G  G+ G  G  G  G  G  G +GP G +G  G  G  G  G PG  G  G PG  G +G  G  G  G +G +G +G  G  G  G +G  G +GL+G +G SGE+G       +G  G+ G LGI GL G  G+RG PG PG  G+ G  GP G  G      P G PGL GV GE G          PG+DG PG+
Sbjct:  100 PLLLQGEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKG---DTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGG------------MGAPGSRGASGPAGARGP---NGDAGRPGEPGLLGARGLPGFSGSTGP---------AGKEGPAGPQGIEGRSGPAGASGP---------------------RGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGV 762          

HSP 6 Score: 150.214 bits (378), Expect = 9.600e-36
Identity = 247/615 (40.16%), Postives = 283/615 (46.02%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM---RGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGK------------IGPRG------GQGEIGKPGVQGLNGM------------KGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQG---EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQ 2966
            GR G  G  GP G  G IG  G +G  G  G  G  G +GP GN G     GN G QGPPGL G+ G    KGE+G  G  GF G PGP G  G  G  G  G+RG             +GPRG        G  G+PG  GLNG             +G  G  G KG KG  G  G YG  G  G            +    G  G  G  G+ G +G  G++GE G  G+TG  GP G  G+ G +G RG +G   E G  G  G  G  G  G  GP G  G RG  G  G  GFPGP   +G+ G  GP G +G  G  G  G+ G  GP G  GP+G  G QG  G   P GL G  G  GE G  G PG  G  G +G  G  G+ G  G  G  G  G +G+ GPAGP          G  G  GPSG  GS GL G  G+ G  G PG  G  G  GLPG KGE    G  G  G  G LG  G  G  GP G +G RG  GP G  G +G  GP G  G  G RG +G  G  G  GL G  G  G +G  G  G  G +G  GS G  G +G  G  G  G  G +G  G IG  GL+GP G+Q
Sbjct:  315 GRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGD---KGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHR----GESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGP---AGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGG---PQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGP---------AGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGE---RGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQ 904          

HSP 7 Score: 105.916 bits (263), Expect = 3.545e-22
Identity = 156/450 (34.67%), Postives = 192/450 (42.67%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPK------------------GERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGAR------GVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQ---GDIGMDGDRGPAGPKGPQGDI------------GKIGLQGEIGPSGLKGSMG 2447
            H G  G  G  G  GP G  G+ G+ G  G  G  GP G  G  G +G  G +G  GE G PG +G  GS GP                   G  G  G  G  G PGP G  GP G  G PG  G  GPRG  G +G+PG QG+ G +GL+G+ G  G  G  G                                                    PG  G +G LG  G  G  G  G R      G  GE GP G  G  G R   G +GP+G+ G+ G+ G  G+ G PG +G  G++G    PG  G+ G  G +G  G  G VG  G +G  G  G+ G PGP+G  G +G  G +G  G  G RG+ GE G +G  G+ GR G++G Q   G  G  G+ GPAG  GP G              G+ G  G IGP GL+G  G
Sbjct:  510 HRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAG---------------------------------------------------PPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSR---GPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGL---PGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 902          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 323.553 bits (828), Expect = 3.166e-91
Identity = 364/1070 (34.02%), Postives = 452/1070 (42.24%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGE--------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFI---------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGP------------HGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGP---------------QGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G+ G  G KG  G  G+ G+ G  G  GP G  G  G  G  G +GP G  GIRG+ G +G    PGP+G +G  G  G  G  G  G RG +G+ G  G  GL+G  G  G  GS G  G  G  G  G EG  G  G  GPRGEPG IG  G           GP G+ G +GD+G  GP G +G  G  G  G  GP GL G+ G +GE G  G  GF G  G  G  G  G  GE            G  G+RG  G  G  G +G  GPRGPTG  GS G +G  G  G +G LG           G+ G+ G +G   P   I    ++GE G  G  GL G +G  G  G                       G  G+ G  G  G  G+ G  G+ G +G  G  GSPG  G  G HG  GP+G  G +G RG  G PG  G PG +G TG  G  G  GP G  G  GK       GPRGP+G +G  G  G+ G+ GPQG  G KG  G  GP G PG              GLPG +G  G  G PG  G  G  G  G+ G  G +GP+G PG  G  G  G +G  G  G  G     GL G  G +GY G  G  G +G  G PG VG  G  G                    G  G  G  G  G  GPRG SG+ G  G +G  GE G +GL G  G  G  GLPG  G  G  GP G  GP               +G  G  G  G +GL G  G  G                                D          + A L  L  ++E +  L  +     GSK+NP+R+C+D+ + S+   +SG +WIDPN G  SDS+   C FS  E  TCI A   S  +      K++     W  +  +   Q     + +T     +Q  F++ L + A Q I   C+ S+ Y D    N + AI ++  ND +L +  + R             ++D C +         I         LPI+DI   D G  DQ  G     VCF
Sbjct:   89 GDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRG---LPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGP---------KGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERG---------------------EAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGK------DGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRD---GLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGN------------------RGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQGPAGPPGPPGLPGPAGASGGGYDGGFGGEFFRADQPARRPKDYEVDATLKSLNNQIETI--LTPE-----GSKKNPARTCRDLRL-SHPDWSSGFYWIDPNQGCTSDSIRVFCDFSTGE--TCIHANPDSIPQKNWYTSKTKQRKHVWFGETINGGTQIEYNEEGVTSKDMATQFAFMRLLANHASQNITYHCKNSIAYMDGQTGNLKKAILLQGSNDVELRAEGNSRFTFSV--------LEDGCTQHTGEWGRTVIEYRTNKPSRLPILDIAPLDIGGDDQEFGLDIGPVCF 1080          

HSP 2 Score: 208.379 bits (529), Expect = 7.900e-54
Identity = 275/747 (36.81%), Postives = 329/747 (44.04%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPG-----------FIGDEGKRGFSGEKGDSGPVGLI---GPIGAIGSQGSHGAPGPIGLQGLI------GKEGEKGAIGNPGPRGE------------------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGD---IGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVG 3401
            G  GP G  G  G  G +GP G  G  G  G  G RG+ G +G  G  G  G  G  G  G  G  G  GP G  G  G+PG+ G  G+ G  G  G  G +G  G                                   G  G  G  G  G +GEPG IG     GPKG  G  GK G +G QG  G RG  G  G  G  G  G  G  G +G  GP G  GF G  G  G  GE+G  G           + G  G+RG  GE G +GP+G +   GP GA GS G+ G PG  GL G +      G  GE+GA G PGP+GE                              PGE G  G  G  G  G  G  G  G+ G+RGP GPKG  G    +G +G  G  GP+G  G+ G RG+ G  G +GFPG  G        G+ G  G  G PG DG  G RGD G +G  G  G  GP+G  G +GSSG  G  G  G  GP G +G++GI             GLPG  GE+GT G  G  G  GP+G  GS                   G  G  G +G PGL G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G              G +G PG  G +G  G +G  GPVG  G +G        GPRGP GQ G  GD+G+ G    +GA+GL G +G+ G  G PGP G PG+ G +G  G
Sbjct:  107 GSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQ---------------------------------GIEGRSGPAGASGPRGEPGSIGFP---GPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGIS------------GLPGARGERGTPGGPGANGESGPAGPAGS------------------AGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSL------------GAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGP------AGPRGPSGQQGTRGDKGEAGE---RGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNG 766          

HSP 3 Score: 202.216 bits (513), Expect = 6.556e-52
Identity = 292/763 (38.27%), Postives = 336/763 (44.04%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGV---------DGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQG------DIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSM--------GLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDF------------GIMGFPGPRG------------------PTGLRGSSGPEGIKGELGNDGPLGFIG---------SVGIRGHQGNLGPDGYIGLPGE---IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGM---SGEAGITGKEGLPGELGIKGLQGVNGQRG 3887
            +G+ G  G  G+ GP G  G  G+EG RG  GE G  G  G  G+RGV         DG  G +GA G RG  GP G  G   P G +G+ GE   PG +G  G  GFSG  G +G  G  GP G  G  G  GA GP G  G IG  G KG  G PG  G+ G  G  G  G  G DGN+G QG      + G  G++GPAG  G QG  G  G  GE+G  G + S         G+ GE G  GESG  G  G LG RG     G PG+DG +G+ G  GL G              G  G PGP+G                  P G  G +GP G  GE G  GP G  G           G++G +G  GP G  G PG    +G  G  G  G  G  GP G  G+PG  G  G  G+ G  G  G  G  G  G PG  GPRG +G  G VGR G  G  G  G  GEKG  G  GP+G  G SG  G+ G  GI GLPG  GE G  G  G+ G  G  G  G  G  G  GP G  G TG  G+ G+ G PG  G  G  G  G  G  GYPG  G     G  G VG PG +G  G  G +G PG VG  G +G  G  G                     P G  GT G +G  G RG  G  G +G  GL G   LPG                       G+ GETG  G  GP G    +G +G  GKEG  G  G  G  G+ G  G
Sbjct:   97 KGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARG---PNGDAGRPGE---PGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRG---PTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTG---PAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRG---------------------PSGQQGTRGDKGEAGERGARGLDGRKGHNGLQG---LPGP---------------------AGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 802          

HSP 4 Score: 188.348 bits (477), Expect = 1.605e-47
Identity = 291/787 (36.98%), Postives = 346/787 (43.96%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPG-----------FIGDEGKRGFSGEKGDSGPVGLIGP---IGAIGSQGSHGAPGPIGLQGLIGKEG------EKGAIGNPGPRGE------------------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGD---IGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLG------LRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTG------------FEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL 3368
            G  G KGE G  GP G  G  G+ G +G      P G  G  GP GN G+RG  G +G PG  G  G  G  G RG +G                          G  GP G  G  G+PG+ G  G+ G  G  G  G +G  G  G  G  GP G  G                                  +GEPG IG  G   PKG  G  GK G +G QG  G RG  G  G  G  G  G  G  G +G  GP G  GF G  G  G  GE+G  G           + G  G+RG  GE G +GP+G +GP    GA GS G+ G PG  GL G +G  G      E+GA G PGP+GE                              PGE G  G  G  G  G  G  G  G+ G+RGP GPKG  G    +G +G  G  GP+G  G+ G RG+ G  G +GFPG  G  G      + G  G  G PG DG  G RGD G +G  G  G  GP+G  G +GSSG  G  G  G  GP G +G++GI G  G  G  G  G PG  GE G  G  G  G +GPSG +GSPG  G  G  G+ G  G   ++G  G  GLPG++G RG  G  G  G  G  G+ G+ G  G+ G+ G PGP G  G  G  G  G  G  G  G  GE G +G +G  G  G  G+ G PG  G  G  GP G  G              G +G+ G  GP G  GL+G  G+ GP G PGP GL
Sbjct:   98 GDTGAKGEPGSAGPSGPAGPSGEEGRRG------PNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPA------------------------GARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASG---------------------------------PRGEPGSIGFPG---PKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPG---NDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQGPAGPPGPPGL 815          

HSP 5 Score: 186.808 bits (473), Expect = 4.155e-47
Identity = 241/650 (37.08%), Postives = 305/650 (46.92%), Query Frame = 3
Query: 2226 KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGE------------IGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGH---QGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG------------------EKGDHGIPGPSG-KTGLSGI--RGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGY------QGPRGPKGQTGFE------GDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGE---LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            +G  G+PG  G  G+ G +G+ G  G  G +GP G+ G  G  G AG  GP G+ G  G+ G             +G  G +G+ G  G  G  G++G PG  GLLG RGLPG  G  G  G+EG  G +G+ G  G  G  GPRG  G  G  GP+G  GE G +G  G  G  G RG     GN G  G  GL G  G+KG +G  G PG +G     G    +  +  +          + G  G  G PG  G  G  G+ G  G  G PGS G+ GE G                  E+G  G+PGP G K  +  I  +   G  G  G  G +G  G  GE+G  GP G  G  G PG  G+      +GP+GPKG++G        G  G  G  GP G  G +G+ G  G NG+PGP G  G  G +G VG  G  G+PG  G +G     G +GP+G+PG+ G                  + GP GL G  GS G  GP G PG  G  G  G +G  GLPG  G  G  G  G  G  G +G  G+ G  G  G VG  G++G  G  G++G PG     G  GL GV G+RG PG  G  G +G++G PG VGP G+ G +G  G +G  G  G  G
Sbjct:   85 RGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQG-LPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGP---RGDSGPVGRPGEQG------------------IGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAG 712          

HSP 6 Score: 166.777 bits (421), Expect = 6.369e-41
Identity = 260/685 (37.96%), Postives = 303/685 (44.23%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGI------------TGLTGLRGVDGETGPIGA---EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL---KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTG---LRGSSGPEGIKGELGNDGPLGFIGSVGI---RGHQGNLGPDG---YIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG------IPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQ 3155
            +G  GR GE G  G  GL G  G  G  G+EG  GP G  G  GP G  G RG  G  G PG  G  G PG  G++G                            +G  G RG  G  G  G QG  G+ G  GD GE+G  GA G  G  GP G  G +G          K          R    GV G +G  GE G  G  GALGP+G  G  G +GA+G  G  G  G              G  G+ G  GE  PI A   +   G  GP G  G  GP GA G+ GE GP G  G        G  G  GE+G  GP G  G  GA+G+ GSHG  GP G  G  G  G+ GA G  G  G  G  G  G  GI+G      P G  G  G  GP GP+G  G +G+ G QG  GP GL   KGS G  G  G  G SG  G  G LG+ GLPG +GE GT G  G  G+ G  G  G  G  GP GP G   L G  G  G  G  GNDGP G  G  G+   RG+ G  GP G    +G PG +G  G  G RG PG  G +G +G  G +G  G              G +G+ G  G +G RG  G  G  G QG+PG  GSPGE G  G +G          +G +G  G  G +G  G +G  G  G  G+Q
Sbjct:  178 NGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKG---------------------------SQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELG----------KHGERVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVG------PSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSG------------QQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGP---AGPSGPPGKEGRSGHNGPIGPVGLRGPAGHQ 804          

HSP 7 Score: 120.168 bits (300), Expect = 1.595e-26
Identity = 170/482 (35.27%), Postives = 206/482 (42.74%), Query Frame = 3
Query: 2751 GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILG---LPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKG---EQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPG------------NIGRQGA--------PGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVG------------------RIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPG------RVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            G  G PG  G KG  G +G PG  GPSG  G  G                    G +G  G  G  GP GN G  G  G +G+PG  G  G  G  G  G  GP+G  G +G  G  G PG+LG   LPGFSG TG  G+   +GP G  GI G+ G  G  GPRG  G  GF G +G  G PG  G KG +G    +G  GP+G  G  G PG  G +G+ G+ GP G PG             +G+ G             GV G  G PG+ G                         +G +G+ G  GP G PG  G +G+PG  G                    G+PG  G          K   GESG  G  G  G RG  G RG +G AG TG  G PG     G+KG +G  G +G+ G PG  G +GS GP G        GP+G+ G  G  G  G  G+ G PG   I+
Sbjct:   86 GLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSG------------------EEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGK---EGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERVSFTHCRESYGGVWGERGAPGESG------------------------AAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIV 522          

HSP 8 Score: 93.9745 bits (232), Expect = 1.780e-18
Identity = 142/376 (37.77%), Postives = 168/376 (44.68%), Query Frame = 3
Query: 3027 QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP---------------RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGL------QGVNGQRGDPGLPGDR---------------GKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            +G  GD G+ G  G TG  G  G  G  G  G  G  G  G  GE GS GP G  GI G PG  G  GP                GP G  G  GD G+ G PG  GA+GL G  G  GP G  GP G  G +G SG  G  GP G PG+I   G PG  G  G  GK G  G QG  G  G  G  G  G  GP GL+G  G +G  GP G PG  G  G  G  G +G  G+  +      +   G+ GE G  G  G  G  G +GPRG +G  G  G +G PG  G+ G        G+ G+RG  G+PG +               G+ G  GP G  GP+G PG +G  G  G  G  G PG      ++
Sbjct:   85 RGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSI---GFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGE-RVSFTHCRESYGGVWGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKVPIMAIINKYQLGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVK 456          

HSP 9 Score: 64.6994 bits (156), Expect = 1.398e-9
Identity = 121/318 (38.05%), Postives = 149/318 (46.86%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGH---DGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK---PGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIG 2150
            H G  G +G +G  GP G  G+ G         + GP G  G +G  G  G  G  G  GP G++G     G PG +GERG  G  G  G  GP GP G  G  G  G  G  G  G  GE G+   PG  G  G  GL G  GE+G+ G  G                             G+ G +G PG +G  G  G++GEPG +G+ GA+GP G  G  G++G RG +GE G RG  GL G +G +         G++GL GP G  G  GP G++G  G  GP G  G  GK G SG  G  GPVGL GP G
Sbjct:  530 HPGKDGPRGPRGDSGPVGRPGEQG---------IGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGP---------------------------AGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHN---------GLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAG 802          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000032329.1 (collagen, type XXVII, alpha 1 [Source:NCBI gene;Acc:100490770])

HSP 1 Score: 308.531 bits (789), Expect = 2.495e-84
Identity = 418/1341 (31.17%), Postives = 553/1341 (41.24%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG---LDGPKGQIGFPGPEGASGKEGEIGPPGF------------------IGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH------------GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGD------------------------------------------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------LGLPGFSGETGYQGEK----------GSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG-----------------------LIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G + RKG+KG  GP G  G+ G                   RGP G+ G +G  G QG PG +G  G   PKG RG  G                          G  G  G  GE G PGV G  G  G  G  G+ G +G  G D                                                G PG +G  G  G  GFIG +G  GA G  G KG +G+ G +G  G+ G+ G  G  GI G     G KG  G PGP G  GK G +G PG                   IG  G+ G  G KG  G  G  GP G  G +G              G PG  G  G++G EG KG  GN G  G+ GE GLQG +G +G  G +G +GD                                           G+ G +G  G +GP G  G+ GL G  GPSG++G  GL G  G++GE G PG  G  G+ G  G  GE G  G  G  G +G +G  G +G  GP+G  G  G  G  G+KG+L   GPLG  G  G+ G +G+ G +G  GL G  G KG  G+ G  G KG  G+ G+ G  G  G  G PG+ G+ G  G +G  G PG    +G++G +G +G  G+PG QG  G QG KG  G  GP G  G  G +G  G PG          LG PG  GE G QG+           G +GPVG+ G  G+PG  GY G  GP+G  G  G QG  G  GP+G +GL+G +G +G  G PG  G  G  G  G +G  GP G  G  G++G  G  G+ G  G PG  G+QG  G                IGL+GT+G +G     G+PG  G QG PG  G  GLPG+                      G  G+ G+ G +G  G  GE G  G+ G PGE+G  G+ G+ G +G PG  G +G  G  GP G +G +G  G  G+ G  G PG  G+ G                          +I        F             S    + M++ N         + +F  L  L  L+      LG+++NP+R C+D+ M   + +  G +WIDPN+G  SD++   C F+E   +TC+        KP+T+                        K+ F     Q+ FL  L S+A Q+I   C     +  S++     A++ +A++           I    G    E+ + D C  +        +    +D    PI+D+      +P   +     SVCF
Sbjct:  549 GPLSRKGQKGYPGPQGHPGEPG------------------VRGPEGSPGAKGYPGRQGLPGPIGVSG---PKGNRGYIGPP------------------------GLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLD------------------------------------------------GNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDL---GPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQ---KGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGE---------------IGLAGTLGKRGN---TGVPGLPGAQGPPGFRGERGLPGE---------------------IGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGMPGPRGPPGPRGKPGPPGPSVILDSYRQEDFAASYQALMDSSGTSYQSTNYMMVDNG--------SEIFKTLHYLSSLIQSIKSPLGTRDNPARICRDL-MNCQQKMGDGTYWIDPNIGCSSDTIEVTCNFTEGG-QTCL--------KPITK-----------------------SKMEFEVGRVQMNFLHLLSSEAMQSITFHCLNVPAWEKSSK-----AVRFKAWSG---------HIFGTEGMFQPEVSV-DGCKVQDGRWHQTVLIFRTQDPTQFPIVDVLNLPLPSPGMTIHLEVGSVCF 1695          

HSP 2 Score: 210.69 bits (535), Expect = 4.895e-54
Identity = 319/789 (40.43%), Postives = 389/789 (49.30%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMR------------------GNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP------RGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVG------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLR---GEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE---KGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQG 3446
            +SG  G KG+KG +G  G+ GDIG  G++G +G+ GP G  G  G  G  G +                  G  GE GP G+ G  G+   PGP+G+ G  G +G +G PG  G  G  G  G PG  G  GP+G  G  G+ G  G  G++G +G VGE G  G  G+ G  G  GP G  G  G  G+ G  G PG PG  G PG  G  G++G +G  G  G  G  G  G  G  G  G +G QG  GP      RGI G  G  G+ G +GP G +GI G  GP G     GP GA G+ G  GP G  G+ G  G +G KGD GP+G+ G  G IG +G    PG  G  GL G +G KG IG PGP GE GE G++G  G            + G +G  G QG+ G  G +G  G +G  G+ G  G QG  G  G KGS G R   G PG++G  G PG  G  G +G PG  G PG  GE+G++GD G     G  G PG RGP G  G  G  G  G  G DGP G  G+ G +G  G+ GP G  GL G  G  G KGK G PG  G                            +G  G IG+ G +G  G QG +G  G  G+PG  GSPG +GE+GD G  G +G  G  G  G+ G PG  G PGF GE G  GE    G +G  G +G+ G  G  G +G  G  G+ GF G  G FG  GP G  G KG QG  GP G  G  G  G  GI G  G+PGP+G  G+ G  G
Sbjct:  691 NSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQ---GPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGD---PGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKA--EGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESG---------------------------AHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNG 1444          

HSP 3 Score: 206.838 bits (525), Expect = 7.565e-53
Identity = 312/818 (38.14%), Postives = 395/818 (48.29%), Query Frame = 3
Query: 1890 VQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGP---KGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFP---------GPRGP------TGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGN------------------LGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNI------------------------GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPG---------LVGVTGPIGKPGKVGKQXXXXXXXXX------XXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRI----------------------------GLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            + G KG +G  GL+  + ++G  G  G  G+ G+ GP   KGQ G+PGP+G  G+ G  GP          G  G KG  G  GL GPIG  G +G+ G  GP GL GL G +GE+G  G PG RG  G  G           G+ G +G  G+DG+ G  G  GP G  G IG  G +G  G  G  GL+G PG  GESG  G  G+ G  G+PGD G  G  G +G  G  G+ G  G+MG P         GP GP       G  G +GPEGIKG+ G     GF G  G  GH+G+                   G  G +G  G  GE G  G+ G  G +G  G +G  G  G  G +G  G +G  G  G+KG +                        G PG++GP+G +G+ G  G  G PG  G+ G  G +G  G+ GP GK G  GI G  G PGI    G PG  G TG  G  G+QGPVG +G +G  G  G +G  GP G+TG +GD G  G+PG QG  G +G+ G  G +G  GP G+       GE+G PGP G  G  G +G  G         + GV G  GKPGK G++G  G +G K      GE G+ G  GP G  G  GS+G  GP G PG++G QG+PG+ G                              G PG PG  G  GD G++G  G+ G  G  G  G RG  G +G+ G +G  G +GL G  G  GL+G  G+ G+ G  G  G IG  GP G VG QG+   +G  G  G+PG+DG PGL
Sbjct:  514 MHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGP---------EGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGF---------PGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGAR---GFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGM------KGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQ---EGPAGPDGIPGKDGSPGL 1301          

HSP 4 Score: 180.259 bits (456), Expect = 9.778e-45
Identity = 286/774 (36.95%), Postives = 353/774 (45.61%), Query Frame = 3
Query: 2055 I---------------GPPGFIGDEGK---RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNS---GPQGDIGM---DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQI---------------GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY------IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQ---GEKGDH------------------------------------------GIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGN---IGRQGAPGL---VGVTGP------IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGEL---------------GIKGLQGVNGQ-RGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
                            GP G  GD G    +  +G KGD G  GL G  G +  +G  G PGP   QG  G+ G +G  G+PG +G PG  GL G +G+ G  GN    GP G  G+   DG+RG  G  G +G +G+ G  G+    G +G  GL G PG++               G  G  GF GL GL+GLPG+ GE             GL GD GI GFPG  G  G +G  G +G+ G  G  G  G +G  G +G  G  GP G       IG PGE G +G KGK G  G  GP G  G  G++G  G  G PG+ G  G  G  G +G  G +G  GN G  G +G QG+ G  G  GE    GEKGD                                           G+ GP G+ G  G  G  G PG+ G  G SG  G QG  G QG +GE GI G  G  G  GP GP G+ G  G+ G  G  GP GA G  G +G  G  G PGP   PG+ G+ G++   GP+G PG    IG++G PGL    G+TGP      IG+PG  G++G  G EG KG+ G  G SG  G+ G  G  G  G +G PG+ G++G  G +G  G+PG                    G  GN+G  G RG  GP G  G  G  G+ G+PG                 G KG QG +G+  G PG PGDRG +G  G  G  G  G PG  G +G  G  GQ G PG
Sbjct:  500 RGPPGPHGNPGPPGMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGP---QGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDF---GERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGE------------SGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGP---PGETGLKGDL---GPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGD------------------QGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPG 1231          

HSP 5 Score: 148.673 bits (374), Expect = 4.197e-35
Identity = 208/566 (36.75%), Postives = 259/566 (45.76%), Query Frame = 3
Query: 2544 GTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYI---GLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE------------------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQ---------------GPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGA---PGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPI---------------------------GLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            G  G +GQ+GD GL     I G  G  G  GL G  GP   KG+ G  GP G  G  G+RG +G+ G  GY    GLPG IG  G KG RG  G  G  GL G+                     +G++G  G+PG +G  G  G  GD G +G PG  G+PGE                         G KG  G+PG SG++GL G +GI G PGI G  GF G+ G QG  G  G  G+ G++GKPG  G+                GP G  G  G +G  G  G PGP+G  G +G++G +GP G PG  G PG KG  G +G  GP G  GN GR G     GL G  GP+G+ G  G++G  G  G  G  G +G  G                             G  G  G++G  GP G PG  GT+G  G+ G+ GL G                      QG  GE GI G  G  G+SG +G  G++G+ G  G  G QG  G  G+ G  G +G  G  GPPG  G +G+ G  G+ GE GL GQ G+PGL
Sbjct:  513 GMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGA---------------------DGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGP---------------------QGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGL 1036          

HSP 6 Score: 142.895 bits (359), Expect = 2.559e-33
Identity = 191/518 (36.87%), Postives = 237/518 (45.75%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQ---------------GEKGPRGITG-LTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL---QGLIGKEGEKGAIGN---PGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGD---------IGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPR---GPTGLRGSSGPEGI 2666
            H G  G KGE G  G  GL GD+G +G           G  G  G RG+ G+ G +G  GP G+ G  G PGP+GE+G  G +G  G  GP GP G  G       RG  G  G QGE GKPG +G  G +G +G+ G  G +G  G                                                +QG  G  G  G +G  G +G  G+ G  G Q               GEKG +G  G   G  G  G+ GP+G  G RG  G  G  G  GPEG  G  G+ G PG     G RG  G +G  G VGL G  G  G  G+HG PG IG+   +G++G++G++G  G    PG  G PG  G QG  G IG  G  G +G+ G+ G  G  GP G +G+          GK G++G +G SG KG +G +G+PG  GE GFPG  GL G +G PGD G  G  G +G  G  G  G  G MG  GP    GP G RGS G  G+
Sbjct:  994 HKGPQGAKGEPGPPGETGLKGDLGPLGIP---------GEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGV------RGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTG------------------------------------------------NQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGH---SGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGM 1445          

HSP 7 Score: 93.9745 bits (232), Expect = 1.864e-18
Identity = 152/415 (36.63%), Postives = 191/415 (46.02%), Query Frame = 3
Query: 2934 LPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE------------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP---------GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP---RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI---------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPG---------------LVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK---------EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGE 3989
             P L GP G +G+ G  G  G+PG  GSPG+                   G KG  G PG S    ++G++G  G PG+ G+P         G+ G  G+ GE G +GP G  G  G PG  G  GP    GPKG  G+ G  G FG+PG  G +GL G  G  G  G PG  G  G++G  G  G+PG +         G+ G++G  GA G  G+ G  G PG  G+ GL G +G +G  G+ G    IG  G  GSQG  GP G+ GK G  GKPG                 G IG PG+                  +G +G KG+ G RG  GPRG  G  G  G          EG PG  G  G+ G  G +G+ G  G  GKIG  G  G +GP GE G+ G KG+
Sbjct:  466 FPFLMGPPGPKGNQGSPGPPGLPGLTGSPGKRGPRGPPGPHGNPGPPGMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGD---IGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGE------------------NGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGD 859          

HSP 8 Score: 77.7962 bits (190), Expect = 1.991e-13
Identity = 182/551 (33.03%), Postives = 238/551 (43.19%), Query Frame = 3
Query:  828 AGANAMHGIPGKPGNR---------GPPGEIFILPI--NLGISSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSP------------GPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGL------TGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIG 2393
            AGA    G  G+ G++         GPPGE  +      LGI     L  +     +E    + G  G +G  G+ G  G  GE G++G  G  G  G  G  G+RG  G  G  G+ G+ G++            G+ G  GH+G  G  G +GP G  G  G                   RG RG +G  G  G QG PG+ G+ G              G KGE+G                   EG PG PGDRG +G  G +GE G PG  G +G +G  G+ G++G  G  G  G  G  G +G VG                                  +G+PG  G +GA G  G IG  G  G  G QG++GP G  G+       GL+G  G+ G IG  G  G  G  G  G PG +G  G  GE G PG IG  GKRG  G       +GL G  G +G++G  G PG +G  G+ G  G KG    PG  G  G  G +G +G++G++G  GP G +G +G+ GP G +G QGD G
Sbjct:  980 AGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQK------------GSKGFEGHLGETGVPGDQGPTGNQGPKGS------------------RGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQG--------------DDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGL---------------------------------KGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGG------MGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGP---PGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNG 1444          

HSP 9 Score: 53.1434 bits (126), Expect = 5.176e-6
Identity = 111/332 (33.43%), Postives = 141/332 (42.47%), Query Frame = 3
Query: 3330 YMGPNGYPGPHGLPGDKGIS---------------------------------------GEVGDPGPIGYPGNI-----GRQGAPGLVGVTGPI------------GKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGP---------------RGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIK---------GLQGVNGQRGDPGLPGDRGKIGSIGPPG------------------RVGPQGEPGLKGVKGE---LGLPGQDGEPG 4022
            ++ P  +P   G PG KG                                         G+ GDPG    PG       G  G PGL GV GP+            G PG+ G +G  G  G KG  G +GL GPIG+SG  G++GY GP                G+PGK GT G+PG  G  G  G PG+DG+ G+ G  G  G  G  G+ G  G  G  G +G+ G  G +G+ GL G+ GI+         G QG  G +G PG PG RGK G +G PG                   +GP GE G +G+KG+    G PG  G+PG
Sbjct:  460 WLDPTPFPFLMGPPGPKGNQGSPGPPGLPGLTGSPGKRGPRGPPGPHGNPGPPGMHGPKGQKGDPGL--SPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPG 789          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000017769.1 (collagen, type XXVII, alpha 1 [Source:NCBI gene;Acc:100490770])

HSP 1 Score: 308.145 bits (788), Expect = 2.867e-84
Identity = 418/1341 (31.17%), Postives = 553/1341 (41.24%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG---LDGPKGQIGFPGPEGASGKEGEIGPPGF------------------IGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH------------GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGD------------------------------------------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------LGLPGFSGETGYQGEK----------GSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG-----------------------LIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G + RKG+KG  GP G  G+ G                   RGP G+ G +G  G QG PG +G  G   PKG RG  G                          G  G  G  GE G PGV G  G  G  G  G+ G +G  G D                                                G PG +G  G  G  GFIG +G  GA G  G KG +G+ G +G  G+ G+ G  G  GI G     G KG  G PGP G  GK G +G PG                   IG  G+ G  G KG  G  G  GP G  G +G              G PG  G  G++G EG KG  GN G  G+ GE GLQG +G +G  G +G +GD                                           G+ G +G  G +GP G  G+ GL G  GPSG++G  GL G  G++GE G PG  G  G+ G  G  GE G  G  G  G +G +G  G +G  GP+G  G  G  G  G+KG+L   GPLG  G  G+ G +G+ G +G  GL G  G KG  G+ G  G KG  G+ G+ G  G  G  G PG+ G+ G  G +G  G PG    +G++G +G +G  G+PG QG  G QG KG  G  GP G  G  G +G  G PG          LG PG  GE G QG+           G +GPVG+ G  G+PG  GY G  GP+G  G  G QG  G  GP+G +GL+G +G +G  G PG  G  G  G  G +G  GP G  G  G++G  G  G+ G  G PG  G+QG  G                IGL+GT+G +G     G+PG  G QG PG  G  GLPG+                      G  G+ G+ G +G  G  GE G  G+ G PGE+G  G+ G+ G +G PG  G +G  G  GP G +G +G  G  G+ G  G PG  G+ G                          +I        F             S    + M++ N         + +F  L  L  L+      LG+++NP+R C+D+ M   + +  G +WIDPN+G  SD++   C F+E   +TC+        KP+T+                        K+ F     Q+ FL  L S+A Q+I   C     +  S++     A++ +A++           I    G    E+ + D C  +        +    +D    PI+D+      +P   +     SVCF
Sbjct:  549 GPLSRKGQKGYPGPQGHPGEPG------------------VRGPEGSPGAKGYPGRQGLPGPIGVSG---PKGNRGYIGPP------------------------GLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLD------------------------------------------------GNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDL---GPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQ---KGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGE---------------IGLAGTLGKRGN---TGVPGLPGAQGPPGFRGERGLPGE---------------------IGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGMPGPRGPPGPRGKPGPPGPSVILDSYRQEDFAASYQALMDSSGTSYQSTNYMMVDNG--------SEIFKTLHYLSSLIQSIKSPLGTRDNPARICRDL-MNCQQKMGDGTYWIDPNIGCSSDTIEVTCNFTEGG-QTCL--------KPITK-----------------------SKMEFEVGRVQMNFLHLLSSEAMQSITFHCLNVPAWEKSSK-----AVRFKAWSG---------HIFGTEGMFQPEVSV-DGCKVQDGRWHQTVLIFRTQDPTQFPIVDVLNLPLPSPGMTIHLEVGSVCF 1695          

HSP 2 Score: 210.69 bits (535), Expect = 4.979e-54
Identity = 320/789 (40.56%), Postives = 391/789 (49.56%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMR------------------GNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALG------PKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVG------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLR---GEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE---KGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQG 3446
            +SG  G KG+KG +G  G+ GDIG  G++G +G+ GP G  G  G  G  G +                  G  GE GP G+ G  G+   PGP+G+ G  G +G +G PG  G  G  G  G PG  G  GP+G  G  G+ G  G  G++G +G VGE G  G  G+ G  G  GP G  G  G  G+ G  G PG PG  G PG  G  G++G +G  G  G  G  G       KG  G  GK+G  G QG+ G RGI G  G  G+ G +GP G +GI G  GP G     GP GA G+ G  GP G  G+ G  G +G KGD GP+G+ G  G IG +G    PG  G  GL G +G KG IG PGP GE GE G++G  G            + G +G  G QG+ G  G +G  G +G  G+ G  G QG  G  G KGS G R   G PG++G  G PG  G  G +G PG  G PG  GE+G++GD G     G  G PG RGP G  G  G  G  G  G DGP G  G+ G +G  G+ GP G  GL G  G  G KGK G PG  G                            +G  G IG+ G +G  G QG +G  G  G+PG  GSPG +GE+GD G  G +G  G  G  G+ G PG  G PGF GE G  GE    G +G  G +G+ G  G  G +G  G  G+ GF G  G FG  GP G  G KG QG  GP G  G  G  G  GI G  G+PGP+G  G+ G  G
Sbjct:  691 NSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQ---GPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGD---PGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKA--EGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESG---------------------------AHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNG 1444          

HSP 3 Score: 206.838 bits (525), Expect = 8.237e-53
Identity = 312/818 (38.14%), Postives = 394/818 (48.17%), Query Frame = 3
Query: 1890 VQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGP---KGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFP---------GPRGP------TGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGN------------------LGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNI------------------------GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPG---------LVGVTGPIGKPGKVGKQXXXXXXXXX------XXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRI----------------------------GLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            + G KG +G  GL+  + ++G  G  G  G+ G+ GP   KGQ G+PGP+G  G+ G  GP          G  G KG  G  GL GPIG  G +G+ G  GP GL GL G +GE+G  G PG RG  G  G  G  G          +G  G+DG+ G  G  GP G  G IG  G +G  G  G  GL+G PG  GESG  G  G+ G  G+PGD G  G  G +G  G  G+ G  G+MG P         GP GP       G  G +GPEGIKG+ G     GF G  G  GH+G+                   G  G +G  G  GE G  G+ G  G +G  G +G  G  G  G +G  G +G  G  G+KG +                        G PG++GP+G +G+ G  G  G PG  G+ G  G +G  G+ GP GK G  GI G  G PGI    G PG  G TG  G  G+QGPVG +G +G  G  G +G  GP G+TG +GD G  G+PG QG  G +G+ G  G +G  GP G+       GE+G PGP G  G  G +G  G         + GV G  GKPGK G++G  G +G K      GE G+ G  GP G  G  GS+G  GP G PG++G QG+PG+ G                              G PG PG  G  GD G++G  G+ G  G  G  G RG  G +G+ G +G  G +GL G  G  GL+G  G+ G+ G  G  G IG  GP G VG QG+   +G  G  G+PG+DG PGL
Sbjct:  514 MHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGP---------EGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFG---------ERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGAR---GFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGM------KGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQ---EGPAGPDGIPGKDGSPGL 1301          

HSP 4 Score: 180.259 bits (456), Expect = 9.695e-45
Identity = 286/774 (36.95%), Postives = 353/774 (45.61%), Query Frame = 3
Query: 2055 I---------------GPPGFIGDEGK---RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNS---GPQGDIGM---DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQI---------------GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY------IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQ---GEKGDH------------------------------------------GIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGN---IGRQGAPGL---VGVTGP------IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGEL---------------GIKGLQGVNGQ-RGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
                            GP G  GD G    +  +G KGD G  GL G  G +  +G  G PGP   QG  G+ G +G  G+PG +G PG  GL G +G+ G  GN    GP G  G+   DG+RG  G  G +G +G+ G  G+    G +G  GL G PG++               G  G  GF GL GL+GLPG+ GE             GL GD GI GFPG  G  G +G  G +G+ G  G  G  G +G  G +G  G  GP G       IG PGE G +G KGK G  G  GP G  G  G++G  G  G PG+ G  G  G  G +G  G +G  GN G  G +G QG+ G  G  GE    GEKGD                                           G+ GP G+ G  G  G  G PG+ G  G SG  G QG  G QG +GE GI G  G  G  GP GP G+ G  G+ G  G  GP GA G  G +G  G  G PGP   PG+ G+ G++   GP+G PG    IG++G PGL    G+TGP      IG+PG  G++G  G EG KG+ G  G SG  G+ G  G  G  G +G PG+ G++G  G +G  G+PG                    G  GN+G  G RG  GP G  G  G  G+ G+PG                 G KG QG +G+  G PG PGDRG +G  G  G  G  G PG  G +G  G  GQ G PG
Sbjct:  500 RGPPGPHGNPGPPGMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGP---QGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDF---GERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGE------------SGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGP---PGETGLKGDL---GPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGD------------------QGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPG 1231          

HSP 5 Score: 148.673 bits (374), Expect = 4.268e-35
Identity = 208/566 (36.75%), Postives = 259/566 (45.76%), Query Frame = 3
Query: 2544 GTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY---IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE------------------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQ---------------GPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGA---PGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPI---------------------------GLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            G  G +GQ+GD GL     I G  G  G  GL G  GP   KG+ G  GP G  G  G+RG +G+ G  GY    GLPG IG  G KG RG  G  G  GL G+                     +G++G  G+PG +G  G  G  GD G +G PG  G+PGE                         G KG  G+PG SG++GL G +GI G PGI G  GF G+ G QG  G  G  G+ G++GKPG  G+                GP G  G  G +G  G  G PGP+G  G +G++G +GP G PG  G PG KG  G +G  GP G  GN GR G     GL G  GP+G+ G  G++G  G  G  G  G +G  G                             G  G  G++G  GP G PG  GT+G  G+ G+ GL G                      QG  GE GI G  G  G+SG +G  G++G+ G  G  G QG  G  G+ G  G +G  G  GPPG  G +G+ G  G+ GE GL GQ G+PGL
Sbjct:  513 GMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGA---------------------DGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGP---------------------QGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGL 1036          

HSP 6 Score: 142.895 bits (359), Expect = 2.412e-33
Identity = 191/518 (36.87%), Postives = 237/518 (45.75%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQ---------------GEKGPRGITG-LTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGL---QGLIGKEGEKGAIGN---PGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGD---------IGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPR---GPTGLRGSSGPEGI 2666
            H G  G KGE G  G  GL GD+G +G           G  G  G RG+ G+ G +G  GP G+ G  G PGP+GE+G  G +G  G  GP GP G  G       RG  G  G QGE GKPG +G  G +G +G+ G  G +G  G                                                +QG  G  G  G +G  G +G  G+ G  G Q               GEKG +G  G   G  G  G+ GP+G  G RG  G  G  G  GPEG  G  G+ G PG     G RG  G +G  G VGL G  G  G  G+HG PG IG+   +G++G++G++G  G    PG  G PG  G QG  G IG  G  G +G+ G+ G  G  GP G +G+          GK G++G +G SG KG +G +G+PG  GE GFPG  GL G +G PGD G  G  G +G  G  G  G  G MG  GP    GP G RGS G  G+
Sbjct:  994 HKGPQGAKGEPGPPGETGLKGDLGPLGIP---------GEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGV------RGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTG------------------------------------------------NQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGH---SGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGM 1445          

HSP 7 Score: 93.9745 bits (232), Expect = 2.115e-18
Identity = 152/415 (36.63%), Postives = 191/415 (46.02%), Query Frame = 3
Query: 2934 LPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE------------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP---------GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGP---RGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI---------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPG---------------LVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK---------EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGE 3989
             P L GP G +G+ G  G  G+PG  GSPG+                   G KG  G PG S    ++G++G  G PG+ G+P         G+ G  G+ GE G +GP G  G  G PG  G  GP    GPKG  G+ G  G FG+PG  G +GL G  G  G  G PG  G  G++G  G  G+PG +         G+ G++G  GA G  G+ G  G PG  G+ GL G +G +G  G+ G    IG  G  GSQG  GP G+ GK G  GKPG                 G IG PG+                  +G +G KG+ G RG  GPRG  G  G  G          EG PG  G  G+ G  G +G+ G  G  GKIG  G  G +GP GE G+ G KG+
Sbjct:  466 FPFLMGPPGPKGNQGSPGPPGLPGLTGSPGKRGPRGPPGPHGNPGPPGMHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGD---IGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGE------------------NGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGD 859          

HSP 8 Score: 77.411 bits (189), Expect = 2.112e-13
Identity = 182/551 (33.03%), Postives = 238/551 (43.19%), Query Frame = 3
Query:  828 AGANAMHGIPGKPGNR---------GPPGEIFILPI--NLGISSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSP------------GPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGL------TGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIG 2393
            AGA    G  G+ G++         GPPGE  +      LGI     L  +     +E    + G  G +G  G+ G  G  GE G++G  G  G  G  G  G+RG  G  G  G+ G+ G++            G+ G  GH+G  G  G +GP G  G  G                   RG RG +G  G  G QG PG+ G+ G              G KGE+G                   EG PG PGDRG +G  G +GE G PG  G +G +G  G+ G++G  G  G  G  G  G +G VG                                  +G+PG  G +GA G  G IG  G  G  G QG++GP G  G+       GL+G  G+ G IG  G  G  G  G  G PG +G  G  GE G PG IG  GKRG  G       +GL G  G +G++G  G PG +G  G+ G  G KG    PG  G  G  G +G +G++G++G  GP G +G +G+ GP G +G QGD G
Sbjct:  980 AGAQGPVGALGEIGHKGPQGAKGEPGPPGETGLKGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQK------------GSKGFEGHLGETGVPGDQGPTGNQGPKGS------------------RGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQG--------------DDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGL---------------------------------KGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGG------MGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGP---PGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNG 1444          

HSP 9 Score: 53.1434 bits (126), Expect = 5.308e-6
Identity = 111/332 (33.43%), Postives = 141/332 (42.47%), Query Frame = 3
Query: 3330 YMGPNGYPGPHGLPGDKGIS---------------------------------------GEVGDPGPIGYPGNI-----GRQGAPGLVGVTGPI------------GKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGP---------------RGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIK---------GLQGVNGQRGDPGLPGDRGKIGSIGPPG------------------RVGPQGEPGLKGVKGE---LGLPGQDGEPG 4022
            ++ P  +P   G PG KG                                         G+ GDPG    PG       G  G PGL GV GP+            G PG+ G +G  G  G KG  G +GL GPIG+SG  G++GY GP                G+PGK GT G+PG  G  G  G PG+DG+ G+ G  G  G  G  G+ G  G  G  G +G+ G  G +G+ GL G+ GI+         G QG  G +G PG PG RGK G +G PG                   +GP GE G +G+KG+    G PG  G+PG
Sbjct:  460 WLDPTPFPFLMGPPGPKGNQGSPGPPGLPGLTGSPGKRGPRGPPGPHGNPGPPGMHGPKGQKGDPGL--SPGKAINGLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPG 789          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col1a2 (collagen, type I, alpha 2 [Source:MGI Symbol;Acc:MGI:88468])

HSP 1 Score: 347.051 bits (889), Expect = 1.221e-97
Identity = 453/1361 (33.28%), Postives = 580/1361 (42.62%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY---------------VGKEGARGVQGEKGPRGITGL---------------TGLRGVDGETGPIGAEGIRGLDGPKG---------------QIGFPGPEGASGKEGEI---------GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR------GEPGEIGLQGQVGIIGRDGNSGPQGD------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG------------------LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE------------------------------KGDHGIPGPSGKTGLS------------GIRGITGRPGILGLPGFSGET---------------------GYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI---GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR------GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ------------VGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            PMG  G RGP G +G  G  G QGP G  G  G  GP G RG        G PG  G  G  G PG PG+RG +GP+G +G  G PG+ G  G+KG  G  G KG  GA G  G  G  G  G  G+ G  G  G++               G  G  G  G  G  G+ G +GP G IG                +G  G  G  G  GPRG  GL                GL G  G TG  G  G  GL GP+G                +G PGP G+ G+ G           GPPG  G+EGKRG  GE G +GP    GP G  GS GS G PG  G  G++G  G +G+ G  G R      G PGE GL G  G+ G  GN GP G        G+DG  GP GP GP+G+ G IG  G  GPSG  G  G RG PG  G  G PG  G  G +G PG +      G +G +G++G  G  G  G PGP G TG  G  G  G+ GE G  GP G  G  G  G  G  GP G IG  G  G  G  G +G                  LPG +G +G+ G  G +G  G++G  G  G  G  G  G +G PG  G  G++G  G  G  G  G +GSPGE+GE                              KG++GI GP+G  G +            G RG  G PG+ G PG +G T                     G +G +G QGPVG  G  G  G  G+ G +GP G+       G  G PG  G +GL G  G +G  G  G  GLP   GI+G +G+PGP+G  G  G +G PG VG  G  G PG+ G+ G  G +               G  G  G  G+ G RG PG I   G  G PG  G +G  GK                      GN+GE G        G VGPRG SG  GI G +G PG+ G +GL G+ G  G  GLPG  G  G  G PG VGP G  G  G  G +G  G+ G+PG +    ++                   P  V     D     D      P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+    S ++WIDPN G   D++   C FS  E  TCI AQ  +       + ++Q     WL +  +   Q    ++ ++     +Q+ F++ L ++A Q I   C+ S+ Y D    +   A+ ++  ND +L +  + R             + D C ++        I         LP +DI   D G  DQ        VCF
Sbjct:   98 PMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPA------GSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGER---------------GRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPA---GPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQ------GVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEP------GTAGAPGTAGPQGLLGAPGILGLPGSRGERGLP---GIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSD---------------GPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGK---------------------HGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGDFYRADQPRSQPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGE--TCIQAQPVNT-PAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSV--------LVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          

HSP 2 Score: 195.667 bits (496), Expect = 9.661e-50
Identity = 309/852 (36.27%), Postives = 363/852 (42.61%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP---RGGQGEIGKPGVQGLNGMKGL---VGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLR---------GVDGETGPIGAEGIRGLDGPKGQIGF---PGPEGAS---GKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGK---------------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDF---------------------GIMGFPGPRGPT------------------------GLRGSSGPEGIKGELGNDGPLGFI------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            G  G KGE G KG  G +G  G            P G  G  G RG+ G  G+ G  GPPGL G  GS   PG  G  G+                      G PG+RG  GP   RG  G+ G+PG  GL G +GL    G+VG  G +G +G  G                                               G PG IG  G  G  G IG+ G +G  G  G+ G RG  GL G R         G  G  GP G +G +G  GP G  GF   PGP G +   GK GE G PG  G  G  G  GE+G  G  G  GP G IGS+G  GAPGP G +G  G                 GE+GA G PG +GE GE GL+G  G  GRDG  G  G +G        GP G  GD G+ G  G  GP+G +GS G RGE G  G +GF G  G  G  G  G+KG  G  GE G  G  G +G                       G+ GFPG  G T                        G RG  GP G  GE G  GP GF+      G  G  G  G  GP G +G PG +G  G++G+RGLPGI G  G  G              GI G  G  G  G +G PG+ G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G  G  G  G  G          +G+ G +GE G  G VG VG +         GPRGP G  G  GD+G+   PG +G +GL G +GY G  G PG  GL GD+G  G VG  GP G  G  G  G  G  G  GP+G  G  G Q
Sbjct:  355 GPAGSKGESGNKGEPGSVGAQG------------PPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVM---------------------GPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGI---------------------------------------------DGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGA------PGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGP------------LGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGP---------AGKHGNRGEPGPAGSVGPVGAV---------GPRGPSGPQGIRGDKGE---PGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQ 1089          

HSP 3 Score: 192.2 bits (487), Expect = 1.208e-48
Identity = 364/1026 (35.48%), Postives = 427/1026 (41.62%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVD---------GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKR------GFSGEKGDSGPVGLIGPIGAIGSQGSHGAP---------------GPIGLQGLIGKEGEKGAIGNPGPRGEPGE------------IGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGK---------------PGLGGYQG------------PRGPKGQTGFEGDQ---GKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGP---------------IGYPGNIGRQGAPGLVGVTGPIGK---------------------------PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIK------------GLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            P G  G  GPRG  G+ G  G  GPPG  G  GS       GLT                 +G    PG  G +GPRG  G +G PG QG  G  G  G+ G+ G  G  G                                      G  G  G  G  G+PG  G  G +GP+G  G+ G  G  G +G KG  G+ GL G  G           GE G  G  G RGL G +G++G PGP GA G +G +GP G  G  G        G  G KG+ GPVG  GP G  G +G  G P               G  G +G  G  G  GA G PGPRG PG             +G  G  G  G  GN G  G +G  G  GP+G +G +G  G+ G  G  GP GL+GS G RG PG  G +   G  G  G RG  G  G  G +G+ G+ G+ GL+G  G+ G PG  GP+G  G  G  GI G  G  GP G  G  G  G  G  GP G  G PGE G  G  G RG PG  G                           +NG +G  G  G+QG +G QG  G  G QG+PG  G+ GE G+ G+ G+PG  G  G +G RG  G PG  G  G SG  G +G  G+ GP G  G  G                PG  G  G             RG  G TG +G +   G  G PGP GA G +GE G  GP+G  GP G PG++   GEVG  GP                G  G  G +G  G+VG TG +G                            PG  G+ G  GP G  G  G  G +G  G+ G  G Q   GP G  G+ G  G PG VG  G  G+PG  G  G  G          QG  G  GI GL G RG  G  GI G  G PG LGI             G  GVNG    PG  G  G  GS GPPGR G  G  G +G  G +G  G  G PG
Sbjct:   40 PRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGS---PAPPGLT--------GNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGP------------------------------------AGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRA---GVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDG---------------------------NNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGER---GEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQ---GPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGP---------QGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGA---PGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPG 970          

HSP 4 Score: 184.882 bits (468), Expect = 2.536e-46
Identity = 304/777 (39.12%), Postives = 362/777 (46.59%), Query Frame = 3
Query: 1923 GLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDS------GPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG------------------------DFGIMGFPGPRGPTGLRGSSGPEGIKGEL---------GNDGPLGFIGSVGIRGHQGNLGPDG---------------YIGLPGEIGEKGTKGKRGLP---GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLP------GLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS---QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLV---------GRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G TG RG  G+ GP G  G  G+DGP G  G     G+ G  G   PPG  G+     F+ +  D       GP+GL+GP    G  G+ GAPGP G QG  G+ GE G  G  GPRG  G  G  G+ G  G+ G  G +G +G  G RG  G  G  G  G  G  G  G  G  G+ G++GEPG  GE+G P   G  G RGLPG++G  G  G  G RG  G +G                        + G +G PGP GP G RG  G  G+ G +         G  G  G  G  G+ G  G  GP G                +G PG  G KG  G +G P   G +GP G  G  G +G+ G  G  G  G  G  G  G+ GLP      G+ GP GN+GS G  G +G  G  G PGE G  G  G+PG  G  G SG  G  G PGI G PG  G  G +GE G+    GP G  G  GKPG  G+ G  G +G  G +G+ G  G PGPQG +G KGEQG  GP G+    GLPG  G +GEVG PG  G PG     G PG  G  G  G PG+ G                       G SG +GS+   GP G PG  G +G+ G V         G  GLPG+ G  G  G KGEKG  G  G  GN G  G RG+ G  G  G AG +G     GE G  G  G  G RG    PG+RG++G  GP G  GP G  G  G KGE G  G  GE G++
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGP---PGSPGPPGSPAPPGLTGN-----FAAQYSDKGVSSGPGPMGLMGP---RGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTP---GQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF---QGLPGPSGTTGEVGKPGERGLPGEF---GLPGPAGPRGERGTPGESGA---------------------AGPSGPIGSR---GPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDR---GEAGAAGPSGPAGPRGS---PGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIV 759          

HSP 5 Score: 170.629 bits (431), Expect = 4.767e-42
Identity = 276/785 (35.16%), Postives = 336/785 (42.80%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGN---TGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGE------KGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIG------------------FPGPEGASG---KEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGP---------------RGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL------------------KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF------------IGSVGIRGHQGNLGPDGYIGL---PGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYM 3335
             +G +G  G +G  GP G+ G  G  G           G  G  GPRG  G  GN   +G++GP GL G DG PGP G  G                       G  G+ G  GP+G  G+ GKPG +G  G+ G  G  G  G+ GA G                                      G  GV+G KG+QG  G  G  G  GP G  G VGK G RG+ GE       GPRG  G  G  G  G +GPIG+ G  G  GP G  G                   PG  GA+G    +GE G  G  GD G  G  G +G  G VG  GP GA G +G  GA GP G  G  G  GE+G +G  GP               +GE G  G +G+ GI+G  G+ G  G  G +G  GP G +G  G  G  G  G  G +G                   +G  G RG+ G +G +G  G  G  G  G  G  GEPGT G  G  G +GLLG  GI+G PG RG  GL       GI G LG  GPLG             +GS G+ G  G  G DG  G    PG  G+ G KG+RG PG  GP+G  G+P                     G  G++G  G  G RG  G  G VG  G  G +G  G QG +GD G PG  G  GL G++G +   G+ GLPG +   G  G++G+ GPVG              GPRGP G +G  G  G+ G PGP G  G++G QG  
Sbjct:  419 RAGVMGPPGNRGSTGPAGIRGPNGDAGRP---------GEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPR---------------------GEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPP------------------------------------GPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGL------PGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAP---------------------GPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYS---GLQGLPGLA---GLHGDQGAPGPVGPA------------GPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQ 1092          

HSP 6 Score: 170.244 bits (430), Expect = 6.872e-42
Identity = 264/712 (37.08%), Postives = 305/712 (42.84%), Query Frame = 3
Query: 2223 EKGAIGNPGPRGE----------------------------------------------------PGEIGLQ------GQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS------GLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS------------------VGIRGHQGNLGPDGYIGLPG------------EIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGI------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGI------------RGLVGPRGMSG---------EAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELG 3995
             KG  G+ GPRG+                                                    PG +GL       G VG  G  G  GP G+ G  G  GPAGP+GP G  GK G  G  G        G+ G  G RG PG  G  GF G  G  G+ GL G  G  G  GE G  G+ G  G  G  G PG RG  G  G +G  G  G +G  GP G IGS                  VG  G  G  GP G +GLPG              G  G KG  GLPG+ G  GL G              GI G  G  G  G  GL G  GP G++G  G+ G  G  G+QG PG  GE+G  G PG +G  G +G  G+ G PG  GLPG  G  G  G  G++G  G  GI       G+PG  G  GPRG  G  G  G  GK G  G  G  G  G  G  GP G  G  G PG KG SG+ G PG  G+PG  G +GAPG  G  G  G PG  G QG  G +G  G  G +GL GP G +G VG  G    RG+PG+ G  G  G  G  G PG+ G  G  G  G +G  G  G  GNKGE G              GL G RG +G         E G+ G  G  G  G +G+ G  G  G  G  GDRG+ G+ GP G  GP+G PG +G  G  G
Sbjct:   31 RKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGP------------RGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGE---RGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAG 727          

HSP 7 Score: 128.642 bits (322), Expect = 3.538e-29
Identity = 192/561 (34.22%), Postives = 228/561 (40.64%), Query Frame = 3
Query: 2565 QRGDKGLLGDFGIMGFPGPRGPTGL-------------------------------------------RGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPD---GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGI---------------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE------------VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G  G  G  G  G  GPRG  G+                                            G  GP G  G +G  GP GF G  G  G  G  GP    G  G PG+ GE G  GK G PG +G  G  G+                      G  G  GLPG +G +G+ G D         G +G PG QG KG+ G PG +G  G +G RG+ G  G +G PG +G  G  G  G  GP G +G                LG  G  G  GP GP+G+ G  G  G  G PG  G  GL G +G  G  G  G  GLPG +GI G             VG+PGP G  G  G +G PG VG  GP G  G+ GK+                     G  G  GS G  GP G+ G  G++G PG  GR G+ G PG                   +G+ G  GIRG  G  G  GE G+ G  GLPG  G  G  G  G  G PG+ G  G IG  GP G  G  G PG KG  G+ G PG+ G PGL 
Sbjct:   31 RKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGA---------------------RGFPGTPGLPGFKGVKGHSGMD---------GLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKR---------------------GSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGN------------------RGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLA 522          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col27a1 (collagen, type XXVII, alpha 1 [Source:MGI Symbol;Acc:MGI:2672118])

HSP 1 Score: 305.064 bits (780), Expect = 2.972e-83
Identity = 426/1312 (32.47%), Postives = 550/1312 (41.92%), Query Frame = 3
Query: 1326 MGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGAL---GPKGFIGYVGKEGARGVQGEKGPRGITGLT------GLRGVDGETGPIGAEGIRGLDGPKGQIGF---------PGPEGASGKEG---------------EIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIG------AIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM---------------------------------------------DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFY------GLLGLRGLPGD------------------KGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSS---------GPEGIKGELGNDGP---LGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT----------GLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQ------TGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK---GVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPN--NVPSIGAVLN--RLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDST-RKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDI 4829
            MG  G  G  G +G +G+ G  G  G  G  G PGP+G  G  G+ G  GFPGP                G  GP+G +G IG PG+ GL G  G  G  G  G +G +G                                         G  G  G++G PG  GN G +   GP G +G +G  GA G  G  GP+G+ GL       GL+G  GE G  G  G  G  G KG  G          PGP G +G +G               +IGPPG  G EG +G  G +G  GP G +GP G        G  G  G PG  G  G  G +G KG  G+PG  G  GE GL G +G++G  G  G +GD G+                                              G RGP GP GP G+ G  GL+G +GP G  G  G +G  G+ G SG  GF       G  G +GLPG+                  KG PG  GE G  GD G+ GD G +G PG +G  G RG           GP+G+KG+ G+ GP    G  G  G++G  G+ GP G  G+PG  G+ G +G++G  G KG  G  G  G  G  G  G PG  G  G  G  G  G PG  G +G  G  G  G +G+ G  G PG +GEKGD G     GKT          G  G RG  G PG  G PG  G  G +GE G QG  G  G  G+PG  G +G  GPKG+      +G  G QG  G+PGP+G  G +G +G  G +G PG  G PG +G  G  GDPGP+   G  GR+G PG+ G+ G  G P                                    G+ G  G+PG++G  GK G  G  GLPG                      QG  G  G  G  G  G  G AG+ G +G PG++G KG+Q   G RG PGL    GK G IGPPG +GP G PG K   G +G+LGL G  G PG           +  +  +        ++  D    V     + P   A+     +F  L  L  L+      LG+KENP+R C+D+ M+  + +A G +W+DPN+G  SD++   C F+ Q  +TC+        KP+                       T  K  F  +  Q+ FL  L S+  Q I + C    V+ +   R + R A++ RA+N +            EAG         D C            T   +D + LPI+ +
Sbjct:  678 MGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPV---------------GDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRP---------------------------------------GFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPGREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGRMGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGE---DGKTEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDPGPV---GPAGRRGNPGVAGLPGAQGPP------------------------------------GFKGESGLPGQLGPPGKRGTEGGTGLPGN---------------------QGEPGSKGQPGDSGEMGFPGVAGLFGPKGPPGDIGFKGIQ---GPRGPPGL---MGKEGIIGPPGMLGPSGLPGPKGDRGSRGDLGLQGPRGPPGPRGRPGPPGPPWHPIQFQQDDLGAAFQTWMDAQGAVRSEGYSYPDQLALDQGGEIFKTLHYLSNLIQSIKTPLGTKENPARVCRDL-MDCEQRMADGTYWVDPNLGCSSDTIEVSCNFT-QGGQTCL--------KPI-----------------------TASKAEFAVSRVQMNFLHLLSSEGTQHITIHCLNMTVWQEGPGRSSARQAVRFRAWNGQVF----------EAGGQFRPEVSMDGCKVHDGRWHQTLFTFRTQDPQQLPIVSV 1823          

HSP 2 Score: 222.246 bits (565), Expect = 1.033e-57
Identity = 314/801 (39.20%), Postives = 387/801 (48.31%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIG---AEGIRGLDGPKGQIGFPGPEG------ASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGK---------------IGLQGEIGPSGLKGSMGLRGEPGQIGE------------------SGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVP---GPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETG-------IRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            + G PG  GN G LG KG  G+ G  G  G QG+ GP G  G  G  G  G  GP+G    +G RG  G  G  G PG +G        GK GE+G PGF GD G+RG  G  G+ G +GL GP G +G  G  GA GP+G  G  G +G  G +G PG +G+ GE G+ G  G  G  G+ G  G  G+ G RG  GP G  GD G                IG  G+ GP G+KG  G RG PG  G+                   G PG  G  G  GL G KGEPG  G  G  G++GL+G  G++G PG               I GE G+ G +G  G+ G +G  G+ G  G IG PGE G  G  G RGLPG++G  G                        H G +G  G  G QG +G +G  G  GR G PG QG+ GE+G  G  G  G  G +G  G +G+ G PG  G  G  G  G  G KG  G VGE G+ G  G+ G  GP GP G+ G  G +G+ G+    GP G  GLKG++G  GP+G    HG  G +G+ GE G PGP G  G  GR+G PG  G  G  G  G  G QG +G  G  GE G  G        G  GS+G  GP G PG++G QG+PGL G  G  G           G  G  G  G +G++GE G         G  GP G  G+ G  G  G PG+ G++GL+G  GQ+G PG PG RG+ G  G  G  GP+G+PG  G  G  G  G  G PG   ++  Q
Sbjct:  677 NMGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPG---------------IVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKG------------------------HRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGE---HGEKGQEGLKGEDGSPGPPGITGVPGREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGT------PGPKGSRGTLGPTGAPGRMGAQGEPGLAGYNGHKG---------ITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQGLQGLPGPRGVVGRQ 1420          

HSP 3 Score: 167.162 bits (422), Expect = 8.968e-41
Identity = 270/749 (36.05%), Postives = 331/749 (44.19%), Query Frame = 3
Query: 2262 PGEI--GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKG---------------NIGLPGLQGPRGNQGS------------------------------DGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGIL---------------------------------------------GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG------------AKGLKGEQGY------------MGPNGYPGP---HGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGL-------------------------------------QGVNGQRGDPGLPGD------RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            PG+   G +G +G+ G  GN GP G  G  G  G AG  G QG  G  G  G  G  G +G  G  G+PG  G  G+ G  GL GL G  G++G PG  G+ G+ G  G  GDFG  G PG  G  G  G  GP G+ G +G+ G LG +G  G +G +G +G     G+ GE G KG KG++G+PG+ G  G  G  G+ G  G+ G  G  G +G  GDKG               +IG PG  GP G +G                               +G  GR+G PG  G  G +GE GD G PGP G+ GL G  G+ G PGI+                                             GLPG  G  G++G +G  GP GE G     GL G  GPRG  GQ G +G  G+ G  G +G            AKGL GE G             MGP G PG     GLPGD G+ G++G  GP G  G IG++G PGL G  GP+G  G  G +G  GP+G+ GEK         G  G  G  G  GP GI G  G +GKPG  G  G  G  G  GH+G  GE G+ GE G  G  G  G RG +GP G  G  G  G+ GL G  G KG+                                     +G  G+ GDPG PG       RG+ G  G PG  GP+G PG KG KGE G  G+ G+ G
Sbjct:  667 PGQAHDGAKGNMGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMG-----GV-GEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGSK---GLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEK---------GQEGLKGEDGSPGPPGITGVPGREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGRMGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAG 1397          

HSP 4 Score: 133.265 bits (334), Expect = 1.766e-30
Identity = 181/466 (38.84%), Postives = 226/466 (48.50%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGP---------------------KGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIG---KPGVQGLNGMKGLVGDVGEKG---HKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARG---VQGEKGPRGITGLTGLRGVDGETGPIG---AEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG 2519
            G  G KG+ G  GP G  G IG+ GE G EG  GP+G  G +G RG+ G  G  GE+G  GL G DGSPGP                     +G +G  G QG+LG  G  G PGP G PG  G RG +GP G  G +G   +PG+ G NG KG+ G +G  G    KG  GEDG             P                               D+GEPG  G  G  G +G  G  G++G  G    +G  GP+G  G  G +G  G+ GP G    +G++GL GP+G +G  GPEG +G +G        G +G+ G+ G++G+ G  G +GP G  G+ G  G PG  G  G  G+ G  G +G PG RG  G  GL G  G  G  G  G  G++G  G  G  GPKGP GDIG  G+QG  GP GL G  G+ G PG +G SG PG  G  G RG
Sbjct: 1147 GDSGMKGDLGPLGPPGEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPGREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGRMGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRG--------------------------DRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQGLQGLPGPRGVVGRQGPEGTAGSDG------IPGRDGRPGYQGDQGNDGDPGPVGPAGRRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMGFPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPPGMLGPSGLPGPKGDRGSRG 1580          

HSP 5 Score: 132.109 bits (331), Expect = 3.651e-30
Identity = 174/437 (39.82%), Postives = 214/437 (48.97%), Query Frame = 3
Query: 2907 HNGDKGNIGLPGL---------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL---------PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXX---------PIGLSGTVGSQGYYGP---------------------RGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGEL---------------GIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            H+G KGN+GLPGL         +G +G+ G+ G  G QG PG +GSPG +G  G  G PGP G  G  G RG  G PG+ GLPG  GE G  G  G +G       +G+PG  G  G RGP G    +G+ G+ G+PGP G  GL G+ G +GP GYPGP G+         PG KG  GE G PG  G PG  G +G+ GL G+ G  GKPG +GK G  G  G  G  G  G  G         P G+ G  G++G  GP                      G PG+ G  G+PGL G  G PG PG  G  G++G  G  G  G  G  GE G RG++GP G  G  G  G  G PG +               G+ G++G  G RG  G  G  G+ GS G  GRVGP+G PG  G +G  G  G  G  G +
Sbjct:  671 HDGAKGNMGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRG------EMGRPGFPGDFGERGPPG---LDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFL 1098          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col24a1 (collagen, type XXIV, alpha 1 [Source:MGI Symbol;Acc:MGI:1918605])

HSP 1 Score: 299.671 bits (766), Expect = 1.247e-81
Identity = 423/1365 (30.99%), Postives = 570/1365 (41.76%), Query Frame = 3
Query: 1344 RGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP---IGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFI---------------------------------GDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIG---------MDGDRGPAGPKGPQGDI------GKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDK---------------------GLLGDFGIMGFP------GPRGPTGLRGSSGPEGIKGELGNDGPLGF------IGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI-------------------------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRG---------------MSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLP------GDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI---------------------------------------------KIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRI-KDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            RGPRG  G  GN      PGL G  G  GPKG+ GL+                                +   GE G PG+ GL G  GL G  G KGH G  G                                             ++G+ G PG  GN G+       GY G++G  G +G  G +G+ G  G  G  G+ GP    G  G+RG  GPKG+ GFPG  G  G  G  G PG +                                 G  G  G  G+KG+ G  G  G  G  G +G+ G+PGP G++G  G  G+ G  G  GP G PG  G  G +GI G++G  GP+G +G         + G +G  GP GP G++      G+ G  GE GP GLKG +G +G+ G+ GE+G  G  G +G+ G  G+KGE G+ G  G +G+K                     GL+G  G  G P      GPRGP GL G  G  G KGE GN G  G        GS G RG QG  G  G  G  G++G  G  G RGLPGI G  G MG  G  G +G  G  G  G  G  G  G+ G  G  GPRG  G+ G+ G Q      G PG  G PGE G+KG+ G+PG +G  G  G  G+ G  GI+G PG  G  G +G+KG  GP GE G  G P   G  G  GPKG  G  G  G  G+ GP+G  G+    GY G  G PGP GLPG KG  G  G+   +                         GY G++G  G  G  G  GP G+PG  G QG  G  G +G +G RG+ GP G  G  G  G+ GP+G+ G  G  G  G  G+ GLPGK               +G  G+ G+ G TG+ G  GP+G                 GE G+ G+ G+PG+ G +G  G  G RG PGL       GD+G  G  G PG  GP+G+ G+ G+ G  G  GQ G  G +                                             + +DI   +   +       A+ M+S  + +  +I ++        + +F  L  L  L++     LG++ENP+R CKD+ +     ++ G +WIDPN+G  SD+    C FS    +TC+         P+                       ++ K+ F  +  Q+ FL  L S+A  TI + C  +  +  +        I  + +N +    +            LLE ++  DDC  +  +   A+     ++   LP+ +++       +Q      +SVCF
Sbjct:  531 RGPRGIPGPHGN------PGLPGLPGPKGPKGDPGLSPG------------------------------QAASGEKGDPGLLGLVGPPGLQGAKGLKGHPGLPG---------------------------------------------LRGEHGLPGLAGNIGS------PGYPGRQGLAGPEGNPGSKGVRGFIGSPGEVGQLGPEGERGTPGVRGKKGPKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGVTGSVGPAGPTGPPGAPGPMGLSGSRGPSGIKGDKGEQGVAGEPGEPGYPGDKGNIGSPGPPGIRGKSGPSGQPGDPGPQGPSGPPGPEGFPGDIGIPGQNGPEGPKGHLGNRGPPGPPGLKGTQGEEGPIGPFGELGSRGKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPP---GSVGENGPKGARGTRGAVGPLGLMGPEGEPGIP---GYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGMSGYPGKPGLPGK---------------QGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGPKGPIGQRGNTGPLGREGIIGPTGGTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRRQMDINAAIRALI---ESNSAQQMESYQNTEGTLISHS--------SDIFKTLTYLSSLLSSIKNPLGTRENPARICKDL-LSCQYKVSDGKYWIDPNLGCSSDAFEVFCNFSAGG-QTCL--------SPV-----------------------SVTKLEFGVSKVQMNFLHLLSSEATHTITIHCLNTPRWSSTWADGPELPISFKGWNGQIFEEN-----------TLLEPQVLSDDCKIQDGSWHKAKFLFHTQNPNQLPVTEVQNLPHLGTEQKRYIESNSVCF 1732          

HSP 2 Score: 247.284 bits (630), Expect = 2.272e-65
Identity = 309/778 (39.72%), Postives = 370/778 (47.56%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRG------ITGLTGLRGVDGETGPIGAEGIRG------------------LDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGI---IGRDGNSGPQGDIGMDGDRGPA---------GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL---RGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS------VGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP---------------------------------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIG 3437
            G +G +G  G+ G  GE G PG  G+ GSPGP G RG +G  G  G PGP GP GP GP G PGD G  G  G +G  G  G +G  G  GL G  GE+G  G  GE                                              G +G+PG  G  G  GP+G  G VG +G  G  GE GP G      ITG  G +G  G  GP+G +G +G                  L G  G  G PG  G  G+ G  GP G  GD+G  G  GEKG+ G  GL G  G  GS G  G  G  G QGL G  G+ G  G PGPRG PG  GL G++G+    G +G+SG QG+ G  GD GPA         GP+G  G  G+ GLQG+ G  G  G  GL GE G  GE G PG  G +G     GLPG +G  GT G+ G+ G KG  G  G  G  G RGP G  G +GP+G +G  G  GPLG +G        G RGHQG  GP    GLPG  GEKG  G+         S ++G PG  G  G  G+ G  G  G  G KG++G+PGL+G  G QG  G+ G QG  G +G  G +G +G  G+PGPSGK G+ G+ G  G  G+ G PG  G +GY G+ G  G  G +G+ G PG  G  G  GP                                 +G  G  GDQG  G PG +G  G  G+QG  G  G+PGP G  GD GI G VG  GPIG  GN G
Sbjct:  730 GIKGDKGEQGVAGEPGEPGYPGDKGNIGSPGPPGIRGKSGPSGQPGDPGPQGPSGPPGPEGFPGDIGIPGQNGPEGPKGHLGNRGPPGPPGLKGTQGEEGPIGPFGE---------------------------------------------LGSRGKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGYRGHQGQPGPS---GLPGPKGEKGYPGED--------STVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGPKGPIGQRGNTG 1451          

HSP 3 Score: 189.504 bits (480), Expect = 1.284e-47
Identity = 276/720 (38.33%), Postives = 331/720 (45.97%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGP---PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGE----------------EGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQG---------------SPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGE---TGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK 3278
            G +GE+G  GPFG +G  GK G +G  G  GP G  G  G +G+IG  G TG  G PG +G  GS G KGERG  G  G  G  G  G PGP G PG  G  G  G  G +G  G PG +G  G +G  G  G++G  GA GE G+ G  G  G                                      G+ G  G  G  G  GF G  G  G  G  GE GPRG+ G+ GL G  G  GP G EG  GL G  G  G  GP G++G  GE GP   PG  G+EG +G  G KG  G  GL G  G  G  G  G  GP+G  G +G  G +G +G PG RG  G+ G +GQVG  G  G+ GP G +   G+ GP G +G +G +G +GL   +GP G  G  G RG  GQ G SG PG           G+KG PG D                  +G+ G+ G  G  G MG PG RG T   G  GP G  G+ G  GP G  GS G +G +G  GP G  G+PG  G  G KG +G PG+ G SG                             G  GLPG QG  G  GS G  G  G PG QG                 GEQG  G  G+PG  G  G  G +G+ G PG+ G PG  G+    G+QG  G +GP G+ GI+      G  GP+GP GQ G  G  G+
Sbjct:  823 GTQGEEGPIGPFGELGSRGKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLP------------------------------------GKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSV---GENGPKGARGTRGAVGPLGL---MGPEGEPGIPGYRGHQGQPGPSGLPGPK---------GEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGAT---GQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGMSGY---------------------------PGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIV------GIVGPKGPIGQRGNTGPLGR 1455          

HSP 4 Score: 176.792 bits (447), Expect = 9.601e-44
Identity = 250/709 (35.26%), Postives = 321/709 (45.28%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP------PGLMGHD------------------------GSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGAL---GPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGL---QGEIGPSGLKGSMGLRGEPGQ-------------------------IGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEK---GDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQ 3155
            G  GRKG  G+ GP GL G++G  G+ G+ G  GP+G  G  G  G+IG +G  G  GP       G+MG+                         GSPGPKG+RG                          G  G  G +GG G  G+ G QG  G+ GL G  G  G +G  G+ G                                              QG PG  G+ G     GP+G  G  G  G  GV+G  G  G +GL G  G  G+ GP G+ G  G  GP+G+ G PG EG  GK+G  G P      G  G  GE GD G +GL G  G +G  G  G PGP   +G++G  G++G +G  G +G+ G  G  G  G  G  G +GP+G  G  G  GP G  GP+G+ G  G    QG+ GPSGL G  G +G PG+                          GE G+ G  G+ GLRG  G +G PG  G++G +G KG  G        GP+G  G+ G SG  GI G  G  GP G  G  G+         DG  G PG+ G  G +G  G+PG  G +G+ GSPG QG +G  G PG  G  G  G++G  G PG+ G RG++G+ GD G +G PG +G PGE G++   G  G PGP G  G +GI GI G  G +G  G +G  G +
Sbjct:  841 GKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRG------------------------PRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGF---------------------------------------------QGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKDGLKGAP------GGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGP---EGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSE------GPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGV---------DGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGPKGPIGQRGNTGPLGRE 1456          

HSP 5 Score: 160.229 bits (404), Expect = 1.105e-38
Identity = 239/644 (37.11%), Postives = 299/644 (46.43%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGP----------------------------QGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG---------------IKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGL---PGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ 2993
            +G IG KGE+G  GP G  G+ G +G  G  G  GPM      G  G RG  G+ G +G  G +GP GL G  G  G KGE+G  G +G  G P                  GK G  G +G  GKPG QGL G  G VG  GE G +G  G                    G  G+ G+ G PG  G  G+ G  G KGD G  G  G TG  GP+G  G  G+E   G+QG+ G +G  G +GL G DG+ G +G  G  G  G  GQ+G PGPEG  G  G+ G  G  GD+G+ G +GE G  GP G +G  G  G++G+ GA GP+   GL+G EGE G  G  G +G+PG  GL G  G  G  G                                +G +G+ G RG  G +GP G+ G  G QG  G  G +G  G RG PG  G+ G PG  G  G +GL   +G PG DG  G  G  GL G  G++G PG  G TG+ GS GP+G                KGE G  G  G  G  G RG  G+ G  G  GL   PGE G++G  G +G PG +GP                            GD G +G+ G +GP G +G+ G +GR+
Sbjct:  885 TGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLP------------------GKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPG------------------IAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEE---GLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPL---GLMGPEGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGL---QGYPGVDGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGP---------------------------EGDAGIVGIVGPKGPIGQRGNTGPLGRE 1456          

HSP 6 Score: 53.5286 bits (127), Expect = 3.185e-6
Identity = 123/311 (39.55%), Postives = 145/311 (46.62%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXX-------------XXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE 2108
            + GH G+ G  G  GP G  G  G+                 G++G  G  G  G++G  G  G+RG TG+QGPPG  G  G  GPKGERG                          G +GK G  G  G+ G PGV G  G KGL G  G  G  G  G+ G  G  G  G  G PG  G  G  G  G  G  G PG  G  G KG+QG PG  G  G  G +G  G  G  GA G++G+ G  G  GL G +G  G  GP G  GI G+ GPKG IG  G  G  G+EG IGP G  G  G++GF GE
Sbjct: 1190 YRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERG------------------------SEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGPKGPIGQRGNTGPLGREGIIGPTGGTGPRGEKGFRGE 1476          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col5a2 (collagen, type V, alpha 2 [Source:MGI Symbol;Acc:MGI:88458])

HSP 1 Score: 288.5 bits (737), Expect = 2.265e-78
Identity = 419/1287 (32.56%), Postives = 522/1287 (40.56%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---PGEIGLQGQVGIIGRDGN---------------------SGPQGDIGMDGDRGPAGPKG---PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIG------ESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMG---FPGPRGPTGLRGSSGPEGIKGELG---NDGPLGFIGSVGIRGHQGNLG------PDGYIGLPGEIGEKGTKGKRGLPG---------------IKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEV------------------------------------GILGKPG---------------LGGYQGPRGPKGQTGFEGD------QGKFGVPGPQG------------AKGLKGEQGYMGP---NGYPG---------------------------PHGLPGDKGISGEVGD---------------PGP---------------------IGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVG------------------------------------------------PQGEPGLKGVKGELGLPGQDGEPG----------LIKIIDIQVGMY-QFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATN---SQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
             GEPG  GNTG +G  G  G  G  GA G+ G KG RG  GL G +G   E G  GA+G  G  GP G +G  GP G  G+ G +GP G  G  G  G  G+ G  GP+G+ G  G  G+ G  G  GP G +G  G +G++G  G PGP G    PG +G  G  G  G  G+                     +GPQG  G  GD G  G KG   P+G+ G  G+QG IGP G +G  G RG+PG +G      E G PG  G  G  GLPG KG  G  G  G  G KG  GD G  G    PG RG TG  G  GPEG  G LG    DG  G  GS+GIRG  G++G        G +G PGE G  G  G+RG PG               + G  G  G PG  G QG+ G PG  G  G  GD+G  G PG  GP G +G  G+ G +G PG  G PGE+G  G HG  GP G  G +G  G TG PG+ G+PG  G  G  G KG +G +GE                                     G++G PG                 G+ GP+GP GQ G +G+      +G  G PGPQG              GLKG +G  GP    G+PG                           P GL GD G  G VGD               PG                      +G PG  G +G PGL    GP G PGKVG  G  G +G  G  G  G +GP+G  G  G  G  G  G  G +G +G  G  G  GLPG                      QG  G  G  G  G  G  GE G  G  G PG  G +GL G  G R   G  GD G  G  G  G  G                                                P G PG++G  GE G  G  GEPG          L   +   +G Y + +P  +     D  +  D +        P I   L  L +++E +           GSK++P+R+C D+ +  + T  SG +WIDPN GS  D++   C     E  TCI A  +S  +      KS +    W   L    G       + + N   +Q+ FL+ L  +A Q +   CR +V Y D   KN + A+ ++  ND +        IK E         ++D C +R             ++V  LPIID+   D GN DQ  G     VCF
Sbjct:  264 DGEPGRNGNTGEVGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKG---EIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGL---PGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGS---------------------QGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPR---GDKGDNGDRGDRGQKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPGVRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDENMPDPLPEFTEDQAAPDDTN-----KTDPGIHVTLKSLSSQIETM-------RSPDGSKKHPARTCDDLKL-CHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGE--TCISANPASVPRKTWWASKSPDNKPVWYG-LDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLE--------IKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNADQEFGLDIGPVCF 1496          

HSP 2 Score: 211.46 bits (537), Expect = 1.936e-54
Identity = 344/929 (37.03%), Postives = 405/929 (43.60%), Query Frame = 3
Query: 1536 GKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAP------------GPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGD---------IGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQ---------------------GPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGP---IGYPGNIGRQGAPGL---------VGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPR---------------------------------------GIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK---EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGS------IGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            G  G RG  G  G PG++G  G KGL G  GE G  GA GE                                                 G  G +G  G LGP+G  G  G+ G +G  G++G  G+ G  G  G  G  G  G  G  G+ G  G  G  GPEG  G+ GE GPPG  G +   G  G  G  G  G  GP G+ G+ G  G              GP G++G  G  G  G  G  GP+GEPG  G+QG +G  G +G  GP+GD G  G  GP G +G  G+          G  G QGE GP G  G  G +G+PG+ GE G PG  GL          G PG  G EG+ G    LG  G  G PGP G  G+RG        G +G  GP G  G +G  G  GN G  G  G PG+ GE G  G  G PG+ G  G  G PG  G QG+ G PG  G  G  GD+G  G PG  GP G +G  G+ G +G PG  G PGE+G  G HG  GP G  G +G  G TG PG+ G+PG  G  G  G KG +G +GE G  G  G  G +                     GPRG  G  G  G+ G  G  GP GA G  G Q   GP+G PG  G PG+ G  G+ G PGP    G PG  G  G PGL          G TG  G  G+VG  G  G  G  G  G  G  GP GL G  GS G  G R                                       G+PG+ G +G PGL G  G PGK G  G  GDKG  G  G  G  G  GE G  G  G  G  G  G  G+    G PG  G+ G QG  G  G  G PGD G+ G       +GPPGR G +G PG +G +G+ G  G  G+
Sbjct:  280 GSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGE------------------------------------------------AGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQ---GLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLT---------GNPGVQGPEGKLGP---LGAPGEDGRPGPPGSIGIRGQP------GSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQ---GPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGD 1136          

HSP 3 Score: 199.519 bits (506), Expect = 8.661e-51
Identity = 353/979 (36.06%), Postives = 427/979 (43.62%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR------GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG---------------------DFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS------------------DGDVGRQGM---PGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGK---PGLGGYQGPRGPKGQTGFEGDQGKFGVP------------------GPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---------------VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRG 3914
            G KG +G KG  G  G+IG  G +G+ G  GPMG  G  GPRG  G RG  G QG PG  G  G PG                                    K GP G  G  G  G  G  GMKG  G  G +G +G  G+                                     G  G  G  G QG PG +G  G  G KG  G  G  G  G+ G  G  G  G TG +G+ G++G  G  G +G  GPKG+   PGP G    +G IGPP   G+EGKR   G +GD G VG  GP+G  G+ G+ G PG  GL G  G +GE+G +G+ GP+      G PGE GL G  G+ G  G  GP+G +G  G  G  G  GP G IG  G  G +G  G KGS G  G+PG+ G +G PG  G  G  G  G  G  G  G  G+RG++G  G                     D G+ G PG  GP G RG     G  GE G  G  G  G  G+ G  G  GP G  G  G IG+ G  G +G+PG +G +G  G                       GD+G IG  G +G  GN G+                   G+ G +G+   PGS+G+PG +GE       GP+G  G +G +G  G+PG+ G PG  G+ G  G  G QG  G  G  G    PGL G +G +GP G TGF G  G+ G P                  GP G +G  G  G +G  G  GP G PGDKG  GE                G  G +G PG  G +G PGL    GP G PGKVG  G  G +G  G  G  G +GP+G  G  G  G  G  G  G +G +G  G  G  GLPG             +G  G  G  G  G+ G RG  G RG  G  G  GK GLPG  G +G +G NG RGD G  G RG
Sbjct:  295 GLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPG------------------------------------KPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQ------------------------------------RGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGE---PGPHGI---QGPIGPP---GEEGKR---GPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGE---RGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGP---------------------KGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGEN------GPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGL---PGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGS------------QGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGHRG 1144          

HSP 4 Score: 186.808 bits (473), Expect = 7.293e-47
Identity = 326/883 (36.92%), Postives = 384/883 (43.49%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIR------GLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD---EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL---IGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGN---SGPQGDIGMDGDRGPAGPKGP---------------------QGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEP---GTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG---------------------ELGNDGPLGFIGSVGIRGHQGNL---------------GPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVG---------------------------RQGMPGSQGSPGEQG---------------EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLG---------------GYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTG 3473
            G  G KGE G  GP G +G +G  G  G+ G +GP G  G RG  G  G  G  G  G PG  G  G+PG KGE G TG                         RG  GP+G +GE G PG  G  G+ G VG  G  G KG  G  G+ GP G  GP G PG  GS G +                  GI+G  G+PG  G  G  GPKG  G  G +G  G  GE+G RG  G  G  G  G  G  GA G R      GL GPKG  G  GP G+SG +G  G PG  G+    G RG +G  G  GP G +GP+GA G  G  G PG IG++G    +G  G KG+ G+ G  GE G  G+ GQ G  G+DG    SGP G  G+ G+RG  GP GP                     QG  G+ G  G +GP G +G+ G RGEPG    +G PG  G+ G  G  G KG P   GT G+ G  G +G+ G+ GI G PGP+G  G  G  G EG  G                     E G  GP G +G  G RG+ G+                GPDG  G+ GE GE G KG  G P   GP GL GSP                     G  G  G+PGL+G RG QG  G  G                           ++G PG +G PG  G               +KGD G  G  G  G  G  G TG+ GI+G+PG  GE G  G  G  G  G+VG  G  G                 G  GP GP G  G  G  G  G  G +G  G  G  G  G  G PGP G PGD G  GE G  GP+G PG  G++G PG  G  G
Sbjct:  313 GAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGA------------------------RGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQ------------------GIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGI---TGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSP---GPQGLAGSP---------------------GPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRG 1126          

HSP 5 Score: 174.096 bits (440), Expect = 5.612e-43
Identity = 316/839 (37.66%), Postives = 380/839 (45.29%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP------PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP------------------------RGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIG---------FPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLI---------------GKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLR------------------GLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ---------------------GSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGA---KGLKGEQGYMGP---------NGYPGPHGLPGDKGISGEVGDPGPIGY 3422
            G  G  G  G+ GP G +G  G  G  G  G+ G  G  G RGP G  G RG TG  GP      PG +G DG+PG KG  G  G  G  G  GP G PGP+G           GP+G +G+ G PGV G  G  G  G+ G  G +G IG  G  G  GPRG  G                                   G PG +G  GA G +GF G  G  G +G QGE+GP                        RG+TG  G++G +G+ GP+GA G  G  GP G IG          PGP+G+SG  G+ G  G  G  G+RG  G+ G+ GP G +GP G  G +G  G PGP G QGL                G  GE GA+G  GPRGE G  G +G+ GI G  G  G  G  G DG +G  GP G  GD G  GLQG  G  G+ G+ G +G+ G IGE G  G  G  G R                  G PG +G  G  G  G  G +G  G  G +GF GP+GP G        G+KGE G  G  G  GS G +G  G+ GP G  G+PG  G +GT+G  G  G  G +G +G PG  G  G  G  G  G  G  G +G+ G  G  G RG  G  G  G +G PG                       G PG++GE+G  G+PGP+G  G  G  G TG  G  G  G  G  G  GE G +GP G  G  G+ G  G +G RG  G  G  G QG  G PGP GA    G +GE G  GP          G PGP G  GDKG +G+ GD G  G+
Sbjct:  352 GKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQG---------STGPQGIRGQSGDPGVPGFKGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTV---------------------------------GPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQ------PGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGH 1142          

HSP 6 Score: 103.99 bits (258), Expect = 1.180e-21
Identity = 229/659 (34.75%), Postives = 286/659 (43.40%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGER---------------------GLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---------------RGLDGPKGQIGFPGPEGASGKEGEIGPP---GFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL---------------------QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQG 3014
            +G+ G +G +G+ GP G  G+ G+ G  G  G+ G  G  G  GP+G+ G  G  GE G  G+ G  G+PG  GE                      G TGFQG  G PGP G  G  G  G+PG+ G +GP G +GE G PG +G  G+ GL    GEKG  G  G DG                                              +G PG  G  G  GP G  G  G+   RG+ G  GP+G  G  G +G +G  G  GA G+               +G  GP+G +G PG  G  G  GE GP    GF G +G  G  G KG+ G  G  G  G+ G QG  G+PGP G  G+ G +G +G  G PG  G PG  G                      +G  G+ G  G+ G  GD G  G  G  G KG  G+ G+ G  G  GP+G  G  G+ G PGQ GE G P   GL G  G PG  G  G  G++G  G  G  G  G +G PGP GP G  G+ G +G  GE G+    G  G  G+ G Q      G  G PG +G  G  G+RG PG +GP G  G                          G  GLPG QGPRG++G +GD G +G  G +G
Sbjct:  573 TGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEPGITGL---PGEKGMAGGHGPDGP---------------------------------------------KGNPGPTGTIGDTGPPGLQGMPGE---RGIAGTPGPKGDRGGIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMP---GLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGD---RGDPGPAGLPGSQ------GAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGR------------------------AGKRGLPGPQGPRGDKGDNGDRGDRGQKGHRG 1144          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col11a2 (collagen, type XI, alpha 2 [Source:MGI Symbol;Acc:MGI:88447])

HSP 1 Score: 234.572 bits (597), Expect = 1.719e-61
Identity = 456/1347 (33.85%), Postives = 603/1347 (44.77%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFS------GEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL---------------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLR------------GSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIG---------------EKGT---------------------KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQ---------------------GSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRP------------------------GILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVP------GPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEA---GITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G+ GR G  GQ G  GL G+ G +G QG      P G  G  GP G  G RG  G     G  G  G PG KG+RG  G  G                       G+ G RG  G  G PG  G +G +G  G++G +G  G  G  G  GP GP G  G PG  G  G  G  G+ G  G PG  G +G  G QG PG         P+G IG  G++GARG  G     G+ G  GL G  G+ GP G +G +G  GP+G +G+PGP G  G +G  G  G  G++G+ GF       G KGD G VG+ G  G  G +G  G  GP G  G  G  GEKG +G PG  G PG  G +G +G  G  G SG +G  G+ G  GP G +GP G  G+ G +G  G SG KG+ G  G  G  GE G PG  G                 GL G PG +GE G  G+ G  G  G++G  G  G  GP G  G              G+SG EG KG+ G  G  G  G  G+RG  G  G  G  G PG  G               E+G                       G++G+PG KGP G  G  G QG  G+ G  G  G+ G +GDKG +G PG +G +GN+                     G+DG+ G +G  G  G+ G++G +G +G PGP G  GL G  G  G                          G  G PG  G  G  GEKG  G  G  G+ G+PG+ G +G RG KG++G  G+ G  G        GP+G  G  G  G  GP G  GP G  G KG  GE G+PG  G PG  G  G PG +G  GP G PG  G+QG  G +G  G  G  G +GP+G +G  G  G  G RG+PG +G QG+PG  G+       G  G  G  G  G++G++G +G KG  G+ GL+GP G  GE    G+ G +G PG+ G  G+ G +G  G  G PG  G  G  G  G  GP G  G KGV+G  G PG  GE  +I+ + IQ      +P++ +R     K   D +  V     P   A L  +F  L+ L E + +  +  G++++P+R+C+D+ +  +  +  G +W+DPN G   D+    C F+    +TC+  +       +T+F               D  G  +  +       Q+ FL+ L   A Q +   C  S V  D         +++R  N+ +L       +K            +D C  +   +     T +   +  LP++D  F D G P +  G     VCF
Sbjct:  493 GYTGRPGPLGQPGSPGLKGESGDLGPQG------PRGPQGLTGPPGKAGRRGRAGAD---GARGMPGEPGMKGDRGFDGLPGLP---------------------GEKGQRGDTGAQGLPGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPG---------PQGAIGPHGEKGARGKPGLP---GMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPAGKDGLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGTAGESGPMGERGHSGPPGPPGEQGLPGTSGKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPAGPPGPAGSPGERGAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAKGDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDGGPMGPPGPPGPRGPAGPNGADGPQGSPGGVGNLGPPGEKGEPGESGSPGVQGEPGVKGPRGERGEKGESGQAGEAGPPGPKGPTGDNGPKGNPGPVGFPGDPGPPGEAGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKRGPAGTPGPEGRQGEKGAKGDPGAVGAPGKTGPVGPAGLAGKPGPDGLRGLPGSVGQQGRPGATGQA------GPPGPVGPPGLPGLRGDAGAKGEKGHPGLIGLIGPTGEQGEKGDRGLPGPQGSPGQKGETGIPGASGPIGPGGPPGLPGPSGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGE--VIQPLPIQ------MPKKTRRSVDGSKLIQD-EEAVPTGGAPGSPAGLEEIFGSLDSLREEIEQMRRPAGTQDSPARTCQDLKL-CHPELPDGEYWVDPNQGCARDAFRVFCNFTAGG-ETCVTPRDD-----VTQF------------SYVDSEGSPVGVV-------QLTFLRLLSVSAHQDVSYPC--SGVSQD-------GPLKLRGANEDELSPETSPYVKE----------FRDGCQTQQGRTVLEVRTPV---LEQLPVLDASFADLGAPTRRGGVLLGPVCF 1734          

HSP 2 Score: 140.198 bits (352), Expect = 1.495e-32
Identity = 217/577 (37.61%), Postives = 264/577 (45.75%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKG-------------------------------------------------FIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQ---GEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGP---------VGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY 3350
            QG PG +G+ G  GP G                                                  +   G  G  G  G  GP G  G  GL+G  G+ GP G  G +GL GP G+ G  G  GA G  G  G PG  GD   RGF G        GL G  G  G  G+ G PGP       G++GE+G  G  GPRG PGE G +G +G  G  G  GP G  GMDG  GP G  GPQG+ G  G QG  G  GL G  G  G  G+ G  G PG  G+ G  GLP   G PG +G  G +G++G  G  G +G+PGPRG  G+ G  G +G KGE G DG  GF G +G++G +G +   G  G  GE G +G KG+ G  G  GP+GLM                        G+KG +G+PGL G  G QG  G +G  G PG+ G  G +   G+ G  G  GP+G  G  G RG TG+ G  G  G  G  G  GE+G  GP          G  G  GK GL G+ G R   G+ GF+G  G  G PG  G +G  GE G MG  G+
Sbjct:  416 QGNPGPVGDPGERGPPGRAGLPGSDGPPGPPGTSLMLPFRFGSSGGDKGPVVAAQEAQAQAILQQARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGMKGD---RGFDGLP------GLPGEKGQRGDTGAQGLPGP------PGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHGEKGARGKPGLPGMPGSDGLP---GHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEV---GVPGSRGEDGPEGPKGRTGPTGDPGPTGLM------------------------GEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPAGKDGLPGHPGQR---GEVGFQGKTGPPGPPGVVGPQGTAGESGPMGERGH 944          

HSP 3 Score: 137.502 bits (345), Expect = 8.746e-32
Identity = 182/466 (39.06%), Postives = 226/466 (48.50%), Query Frame = 3
Query: 2220 GEKGAIGNPGPRGEPGEIGLQGQVG----------------IIGRDGNSGPQGDIGMDGDRGPA--------------------GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXX------XXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGIL---GLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEV---GDPGPIGYPGNIGRQGAPGLVGVTG 3473
            G  G  GNPGP G+PGE G  G+ G                +  R G+SG        GD+GP                     GP GP      +G  G  GP G  GS GL+GE G +G  G  G  GL G  G  G +G  G DG  G  G+ G+ GD G  G PG  G  G RG +G +G+ G  G DG  G  G +G RG  G  GP G +G  G  G  G  G RG+ G  GP G +G  G  G  G QG PG        G IG +G+KG  G PGL G  G+ G  G  G++G PG++G+ G  G +G  G PGP G  G+ GIRG+ G  G     G PGF G+ G +G++G  G  G  G  G  G  G  GP G  G TG  G++GK GVPG  G  G +G +G +G  G+PG  G  G +G+SG+    G+ GP G  G  G +GA G  G  G
Sbjct:  411 GPPGIQGNPGPVGDPGERGPPGRAGLPGSDGPPGPPGTSLMLPFRFGSSG--------GDKGPVVAAQEAQAQAILQQARLALRGPPGP------MGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGMKGDRGFDGLPGLPGEKGQRGDTGAQGLPGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHGEKGARGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKG 862          

HSP 4 Score: 110.538 bits (275), Expect = 1.502e-23
Identity = 193/514 (37.55%), Postives = 229/514 (44.55%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGE------QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEI---GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG------------ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGK 2801
            PMGY G  GP G  G  G  GE      QGP G  G  G PG  G RG  G  G                      RG  G  G +G+ G  G+ GL G KG  GD G +G  G  GED                                                   G  G+ G +GP+G     G+ G RG+ G KGP GI G  G+RG+DG  GP G+ G +G  GP GQ G PG +G  G +G IGP             GEKG  G  GL G  G+ G  G  G  GP G +G  G  G +G +G PGPRG  G     GL+G  G  G DG  G +GDIG+ GDRG  G  G +G+ G  G +G  GP+G  G  GL GE G++G  G PG+ G  G +G  G  G PG  GE+G RG  G  G  G  G  GPRG  G RG++G  G KG            E G  GP G  G  G +G  G  G DG  G PG+ GE G +GK
Sbjct:  491 PMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGA---------------------RGMPGEPGMKGDRGFDGLPGLPGEKGQRGDTGAQGLPGPPGED---------------------------------------------------GERGDDGEIGPRGL---PGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGP------------HGEKGARGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPAGKDGLPGHPGQRGEVGFQGK 917          

HSP 5 Score: 105.145 bits (261), Expect = 6.587e-22
Identity = 138/346 (39.88%), Postives = 176/346 (50.87%), Query Frame = 3
Query: 3057 GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQG------------APGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKI---------GSIGPPGRVGPQGEP---GLKGVKGELGLPGQDGEPG 4022
            GP G  G +G  G  G+PG  GL G SG+ G QG +G QG  G  G  G+ G  G  G RG  G+ G +GD+G  G+PG  G KG +G+ G     G PGP G  G++G  GE+G   P G PG  G +G             PG+ G+ GP G  G +G QG  GP G++G  G +GL GP G  G  G +G  G  G+PG  G+ G PG  G+ G PG                      +GN+G +G +G +G  G  G  G+ G  GL G  G KG  G  G +GD G+ GDRG++         G  GP GR GP G+P   GL G KG+LG+PG  G PG
Sbjct:  487 GPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGMKGDRGFDGLPGLPGEKGQRGDTGA---QGLPGPPGEDGERGDDGEIG---PRGLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHGEKGARGKPGLPGMPGSDGLPGHPGKEGPPG---------------------TKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLPGYPG 805          

HSP 6 Score: 72.7886 bits (177), Expect = 4.567e-12
Identity = 119/325 (36.62%), Postives = 144/325 (44.31%), Query Frame = 3
Query: 3117 LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQG---------KPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPG------LKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            L L G  G  GY G  G  G  G  G+ G+ G  G QGPRGP+G TG  G  G+ G  G  GA+G+ GE G  G  G+ G  GLPG+KG  G            + G QG PG                                    P G  G  G  G  GPRG+PG+ G +G          PG  G  G+ G  G  G  G +GE G  G+ G  G +G  G +G +GP G   E G  GK GLPG  G  GL G  G+ G PG  G++G  G  GP G  GP+G  G      LKG KGE    G+DG PG    I ++
Sbjct:  483 LALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGMKGDRGFDGLPGLPGEKGQRG------------DTGAQGLPG------------------------------------PPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHG---EKGARGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEK---GEDGFPGFKGDIGVK 753          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01149|CO1A2_MOUSE (Collagen alpha-2(I) chain OS=Mus musculus OX=10090 GN=Col1a2 PE=1 SV=2)

HSP 1 Score: 347.051 bits (889), Expect = 8.541e-97
Identity = 453/1361 (33.28%), Postives = 580/1361 (42.62%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY---------------VGKEGARGVQGEKGPRGITGL---------------TGLRGVDGETGPIGAEGIRGLDGPKG---------------QIGFPGPEGASGKEGEI---------GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR------GEPGEIGLQGQVGIIGRDGNSGPQGD------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG------------------LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE------------------------------KGDHGIPGPSGKTGLS------------GIRGITGRPGILGLPGFSGET---------------------GYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI---GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR------GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ------------VGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            PMG  G RGP G +G  G  G QGP G  G  G  GP G RG        G PG  G  G  G PG PG+RG +GP+G +G  G PG+ G  G+KG  G  G KG  GA G  G  G  G  G  G+ G  G  G++               G  G  G  G  G  G+ G +GP G IG                +G  G  G  G  GPRG  GL                GL G  G TG  G  G  GL GP+G                +G PGP G+ G+ G           GPPG  G+EGKRG  GE G +GP    GP G  GS GS G PG  G  G++G  G +G+ G  G R      G PGE GL G  G+ G  GN GP G        G+DG  GP GP GP+G+ G IG  G  GPSG  G  G RG PG  G  G PG  G  G +G PG +      G +G +G++G  G  G  G PGP G TG  G  G  G+ GE G  GP G  G  G  G  G  GP G IG  G  G  G  G +G                  LPG +G +G+ G  G +G  G++G  G  G  G  G  G +G PG  G  G++G  G  G  G  G +GSPGE+GE                              KG++GI GP+G  G +            G RG  G PG+ G PG +G T                     G +G +G QGPVG  G  G  G  G+ G +GP G+       G  G PG  G +GL G  G +G  G  G  GLP   GI+G +G+PGP+G  G  G +G PG VG  G  G PG+ G+ G  G +               G  G  G  G+ G RG PG I   G  G PG  G +G  GK                      GN+GE G        G VGPRG SG  GI G +G PG+ G +GL G+ G  G  GLPG  G  G  G PG VGP G  G  G  G +G  G+ G+PG +    ++                   P  V     D     D      P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+    S ++WIDPN G   D++   C FS  E  TCI AQ  +       + ++Q     WL +  +   Q    ++ ++     +Q+ F++ L ++A Q I   C+ S+ Y D    +   A+ ++  ND +L +  + R             + D C ++        I         LP +DI   D G  DQ        VCF
Sbjct:   98 PMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPA------GSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGER---------------GRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPA---GPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQ------GVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEP------GTAGAPGTAGPQGLLGAPGILGLPGSRGERGLP---GIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSD---------------GPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGK---------------------HGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGDFYRADQPRSQPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGE--TCIQAQPVNT-PAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSV--------LVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          

HSP 2 Score: 195.667 bits (496), Expect = 6.758e-49
Identity = 309/852 (36.27%), Postives = 363/852 (42.61%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP---RGGQGEIGKPGVQGLNGMKGL---VGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLR---------GVDGETGPIGAEGIRGLDGPKGQIGF---PGPEGAS---GKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGK---------------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDF---------------------GIMGFPGPRGPT------------------------GLRGSSGPEGIKGELGNDGPLGFI------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            G  G KGE G KG  G +G  G            P G  G  G RG+ G  G+ G  GPPGL G  GS   PG  G  G+                      G PG+RG  GP   RG  G+ G+PG  GL G +GL    G+VG  G +G +G  G                                               G PG IG  G  G  G IG+ G +G  G  G+ G RG  GL G R         G  G  GP G +G +G  GP G  GF   PGP G +   GK GE G PG  G  G  G  GE+G  G  G  GP G IGS+G  GAPGP G +G  G                 GE+GA G PG +GE GE GL+G  G  GRDG  G  G +G        GP G  GD G+ G  G  GP+G +GS G RGE G  G +GF G  G  G  G  G+KG  G  GE G  G  G +G                       G+ GFPG  G T                        G RG  GP G  GE G  GP GF+      G  G  G  G  GP G +G PG +G  G++G+RGLPGI G  G  G              GI G  G  G  G +G PG+ G  G  G DG+ G  G PG  G PG +GE+G  G  GP+G  G  G  G  G          +G+ G +GE G  G VG VG +         GPRGP G  G  GD+G+   PG +G +GL G +GY G  G PG  GL GD+G  G VG  GP G  G  G  G  G  G  GP+G  G  G Q
Sbjct:  355 GPAGSKGESGNKGEPGSVGAQG------------PPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVM---------------------GPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGI---------------------------------------------DGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGA------PGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGP------------LGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGP---------AGKHGNRGEPGPAGSVGPVGAV---------GPRGPSGPQGIRGDKGE---PGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQ 1089          

HSP 3 Score: 184.882 bits (468), Expect = 1.774e-45
Identity = 304/777 (39.12%), Postives = 362/777 (46.59%), Query Frame = 3
Query: 1923 GLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDS------GPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG------------------------DFGIMGFPGPRGPTGLRGSSGPEGIKGEL---------GNDGPLGFIGSVGIRGHQGNLGPDG---------------YIGLPGEIGEKGTKGKRGLP---GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLP------GLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS---QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLV---------GRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G TG RG  G+ GP G  G  G+DGP G  G     G+ G  G   PPG  G+     F+ +  D       GP+GL+GP    G  G+ GAPGP G QG  G+ GE G  G  GPRG  G  G  G+ G  G+ G  G +G +G  G RG  G  G  G  G  G  G  G  G  G+ G++GEPG  GE+G P   G  G RGLPG++G  G  G  G RG  G +G                        + G +G PGP GP G RG  G  G+ G +         G  G  G  G  G+ G  G  GP G                +G PG  G KG  G +G P   G +GP G  G  G +G+ G  G  G  G  G  G  G+ GLP      G+ GP GN+GS G  G +G  G  G PGE G  G  G+PG  G  G SG  G  G PGI G PG  G  G +GE G+    GP G  G  GKPG  G+ G  G +G  G +G+ G  G PGPQG +G KGEQG  GP G+    GLPG  G +GEVG PG  G PG     G PG  G  G  G PG+ G                       G SG +GS+   GP G PG  G +G+ G V         G  GLPG+ G  G  G KGEKG  G  G  GN G  G RG+ G  G  G AG +G     GE G  G  G  G RG    PG+RG++G  GP G  GP G  G  G KGE G  G  GE G++
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGP---PGSPGPPGSPAPPGLTGN-----FAAQYSDKGVSSGPGPMGLMGP---RGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTP---GQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF---QGLPGPSGTTGEVGKPGERGLPGEF---GLPGPAGPRGERGTPGESGA---------------------AGPSGPIGSR---GPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDR---GEAGAAGPSGPAGPRGS---PGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIV 759          

HSP 4 Score: 170.629 bits (431), Expect = 3.335e-41
Identity = 276/785 (35.16%), Postives = 336/785 (42.80%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGN---TGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGE------KGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIG------------------FPGPEGASG---KEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGP---------------RGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL------------------KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF------------IGSVGIRGHQGNLGPDGYIGL---PGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYM 3335
             +G +G  G +G  GP G+ G  G  G           G  G  GPRG  G  GN   +G++GP GL G DG PGP G  G                       G  G+ G  GP+G  G+ GKPG +G  G+ G  G  G  G+ GA G                                      G  GV+G KG+QG  G  G  G  GP G  G VGK G RG+ GE       GPRG  G  G  G  G +GPIG+ G  G  GP G  G                   PG  GA+G    +GE G  G  GD G  G  G +G  G VG  GP GA G +G  GA GP G  G  G  GE+G +G  GP               +GE G  G +G+ GI+G  G+ G  G  G +G  GP G +G  G  G  G  G  G +G                   +G  G RG+ G +G +G  G  G  G  G  G  GEPGT G  G  G +GLLG  GI+G PG RG  GL       GI G LG  GPLG             +GS G+ G  G  G DG  G    PG  G+ G KG+RG PG  GP+G  G+P                     G  G++G  G  G RG  G  G VG  G  G +G  G QG +GD G PG  G  GL G++G +   G+ GLPG +   G  G++G+ GPVG              GPRGP G +G  G  G+ G PGP G  G++G QG  
Sbjct:  419 RAGVMGPPGNRGSTGPAGIRGPNGDAGRP---------GEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPR---------------------GEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPP------------------------------------GPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGL------PGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAP---------------------GPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYS---GLQGLPGLA---GLHGDQGAPGPVGPA------------GPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQ 1092          

HSP 5 Score: 170.244 bits (430), Expect = 4.807e-41
Identity = 264/712 (37.08%), Postives = 305/712 (42.84%), Query Frame = 3
Query: 2223 EKGAIGNPGPRGE----------------------------------------------------PGEIGLQ------GQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS------GLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS------------------VGIRGHQGNLGPDGYIGLPG------------EIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGI------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGI------------RGLVGPRGMSG---------EAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELG 3995
             KG  G+ GPRG+                                                    PG +GL       G VG  G  G  GP G+ G  G  GPAGP+GP G  GK G  G  G        G+ G  G RG PG  G  GF G  G  G+ GL G  G  G  GE G  G+ G  G  G  G PG RG  G  G +G  G  G +G  GP G IGS                  VG  G  G  GP G +GLPG              G  G KG  GLPG+ G  GL G              GI G  G  G  G  GL G  GP G++G  G+ G  G  G+QG PG  GE+G  G PG +G  G +G  G+ G PG  GLPG  G  G  G  G++G  G  GI       G+PG  G  GPRG  G  G  G  GK G  G  G  G  G  G  GP G  G  G PG KG SG+ G PG  G+PG  G +GAPG  G  G  G PG  G QG  G +G  G  G +GL GP G +G VG  G    RG+PG+ G  G  G  G  G PG+ G  G  G  G +G  G  G  GNKGE G              GL G RG +G         E G+ G  G  G  G +G+ G  G  G  G  GDRG+ G+ GP G  GP+G PG +G  G  G
Sbjct:   31 RKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGP------------RGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGE---RGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAG 727          

HSP 6 Score: 128.642 bits (322), Expect = 2.475e-28
Identity = 192/561 (34.22%), Postives = 228/561 (40.64%), Query Frame = 3
Query: 2565 QRGDKGLLGDFGIMGFPGPRGPTGL-------------------------------------------RGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPD---GYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGI---------------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE------------VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G  G  G  G  G  GPRG  G+                                            G  GP G  G +G  GP GF G  G  G  G  GP    G  G PG+ GE G  GK G PG +G  G  G+                      G  G  GLPG +G +G+ G D         G +G PG QG KG+ G PG +G  G +G RG+ G  G +G PG +G  G  G  G  GP G +G                LG  G  G  GP GP+G+ G  G  G  G PG  G  GL G +G  G  G  G  GLPG +GI G             VG+PGP G  G  G +G PG VG  GP G  G+ GK+                     G  G  GS G  GP G+ G  G++G PG  GR G+ G PG                   +G+ G  GIRG  G  G  GE G+ G  GLPG  G  G  G  G  G PG+ G  G IG  GP G  G  G PG KG  G+ G PG+ G PGL 
Sbjct:   31 RKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGA---------------------RGFPGTPGLPGFKGVKGHSGMD---------GLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKR---------------------GSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGN------------------RGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLA 522          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P02466|CO1A2_RAT (Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3)

HSP 1 Score: 344.354 bits (882), Expect = 6.691e-96
Identity = 454/1362 (33.33%), Postives = 585/1362 (42.95%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEG------------ARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEI---------GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR------GEPGEIGLQGQVGIIGRDGNSGPQGD------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDK---------------------GEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL---------------GPDGYIGLP------------GEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGL------------SGIRGITGRPGILGLPGFSGET---------------------GYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKI---GTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR------GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMV------------IPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G +G  G +G +GP G  G+ G+             G  G RGP G  G  G  G  G PG  G  G  GP+G RG  G  G  GF G  G  G +G  G PG +G  G  G  GE G PG  G  G+ G  G VG  G  GA G DGS GPVGP GP+G  G  G  G                       G +GE G +GN G  GP G  G  G  G            A G+ G KG  G+ G+ G  G+ G  G  G  G  G  GP+G +G PGP G+ G+ G           GPPG  G+EGKRG  GE G +GP    GP G  GS GS G PG  G  G++G  G +G+ G  G R      G PGE GL G  G+ G  GN GP G        G+DG  GP GP GP+G+ G IG  G  GPSG  G  G +G PG  G  G PG  G  G +G PG +                     G  GT GE G+ G++GL G+FG+ G  GPRG  G  G SG  G  G +G  GP G  G  G +G  G +               G  G  G+P            GEIG  G  G RG PG  G  G  G+ G++G  G  G  G  G  G  G++G +      GP G  G  G  G  G PG++G  G +G KG++GI GP+G  G             +G RG  G PG+ G PG +G T                     G +G +G QGPVG  G +G  G  G+ G +GP G+ G  G       PG  G +GL G  G +   G PG  G  G  GI+G +G+PGP+G  G  G +G PG VG  G  G PG+ G+ G  G +               G  G  G  G+ G RG PG I   G  G PG  G +G  GK                      GN+GE G        G VGPRG SG  GI G +G PG+ G +GL G+ G  G  GLPG  G  G  G PG VGP G  G  G  G +G  G+ G PG +    ++       P                                 P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+    S ++WIDPN G   D++   C FS  E  TCI AQ  +       + ++Q     WL +  +   Q     + ++     +Q+ F++ L ++A Q I   C+ S+ Y D        A+ ++  ND +L +  + R             + D C ++        I         LP +DI   D G  +Q        VCF
Sbjct:  109 GAVGAPGPQGFQGPAGEPGEPGQ------------TGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAP---------------------GPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPA---GPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAIGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEV------GPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGEPGTTGP------PGTAGPQGLLGAPGIL---GLPGSRGERGQPGIAGALGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSD---------------GPPGRDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGK---------------------HGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGARGLPGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPIGKDGRSGHPGPVGPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGGFYRADQPRSQPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWKSDYYWIDPNQGCTMDAIKVYCDFSTGE--TCIQAQPVNT-PAKNAYSRAQANKHVWLGETINGGSQFEYNAEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGRLNKAVILQGSNDVELVAEGNSR--------FTYTVLVDGCSKKTNEWDKTVIEYKTNKPSRLPFLDIAPLDIGGTNQEFRVEVGPVCF 1371          

HSP 2 Score: 223.787 bits (569), Expect = 1.505e-57
Identity = 306/775 (39.48%), Postives = 364/775 (46.97%), Query Frame = 3
Query: 1824 GNTGALGPKGFIG----------------------------YVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAP---------GPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS---QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G  G  GP+G  G                            +  +   +GV    GP       GL G  G  G +GA G +G  GP G+ G PG  G +G  G  GPPG  G++G  G  G  G+    G++GP GA G  G+ G P         G  GL+G  G +G KG  G PG  G PG+ G +G  G  GR G  GP G  G DG  GP GP GP   IG  G  G  G  G KG +G  G PG  G +G  G  GL GL G  G  G PG +G  G +G  GL G  G  G PGPRG  G  G++G  G +G +G  GP G  G  G +G  G+ G  G  G  GE G++G+ G+ G  G  GP GL GS                   G  G  G  G  G+ GP GN+GS G  G +G  G  G PGE G  G  G+PG  G  G +G  G  G PGI G PG  G  G +GE G+    GP G  G  GKPG  G+ G  G +G  G +G+ G  G PGPQG +G KGEQG  GP G+    GLPG  G +GEVG PG  G PG  G  G  G  G  GP G+ G  G                    GPIG+ G  G+ G  G +G  G +G  G  G  G  GLPG+ G  G  G KGEKG  G  G  GN G  G RG  G  G  G AG +G     GE G  G  G  G RG    PG+RG++G  GP G  GP G  G  G KGE G  G  GE G++
Sbjct:   42 GQRGPAGPRGRDGVDGPVGPPGPPGAPGPPGPPGPPGLTGNFAAQYSDKGVSAGPGP------MGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGER---GVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGP---IGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGS------------------PGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF---QGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPS------------------GPIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAIGAPGPAGASGDR---GEAGAAGPSGPAGPRGS---PGERGEVGPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIV 759          

HSP 3 Score: 220.32 bits (560), Expect = 1.815e-56
Identity = 286/715 (40.00%), Postives = 341/715 (47.69%), Query Frame = 3
Query: 1923 GLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPG---------PIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS---QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRG------------------IPGKIGTQGKPG---------LVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVG 3950
            G  GL G  G  G +GA G +G  GP G+ G PG  G +G  G  GPPG  G++G  G  G  G+ G   ++GP GA G  G+ G PG           GL+G  G +G KG  G PG  G PG+ G +G  G  GR G  GP G  G DG  GP GP GP   IG  G  G  G  G KG +G  G PG  G +G  G  GL GL G  G  G PG +G  G +G  GL G  G  G PGPRG  G  G++G  G +G +G  GP G  G  G +G  G+ G  G  G  GE G++G+ G+ G  G  GP GL GSPG                    G  G  G  G+ GP GN+GS G  G +G  G  G PGE G  G  G+PG  G  G +G  G  G PGI G PG  G  G +GE G+    GP G  G  GKPG  G+ G  G +G  G +G+ G  G PGPQG +G KGEQG  GP G+    GLPG  G +GEVG PG  G PG  G  G  G  G  GP G+ G  G  G                  PIG+ G  G+ G  G +G                  +PG+ G  G PG         L G IG PG+ G  G  G  G  G  G SG +G  G  G  G  GPRG  GE G  G  G  G  G  G  G  G +G+ G  G +G+ G +GP G VG
Sbjct:   97 GPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERG---VVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGP---IGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPG------------------SRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF---QGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSG------------------PIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAIGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIVGPTGPVG 766          

HSP 4 Score: 181.415 bits (459), Expect = 2.028e-44
Identity = 296/820 (36.10%), Postives = 353/820 (43.05%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP---RGGQGEIGKPGVQGLNGMKGL------VGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGF---PGPEGASG---KEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGK---------------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG------------------------IMGFPGPRGPT------------------------GLRGSSGPEGIKGELGNDGPLGFIGS------VGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGP---SGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQG---------------------PRGPKGQTGFE---GDQGKFGVPGPQGAKGLKGEQGYM 3335
            +G  G +G  G+ GP G  G+ G  GE G  G  GP G  G  G RG+ G  G+ G  GPPGL G  GS   PG  G  G+ G  G                     +RG  GP   RG  G+ G+PG  GL G +GL      VG  G++G  G  G DG  GP+G                                         G  G  GN G  GPKG  G  GK G +G  G  G RG  G  G  G  G  GP G +G +G  GP G  GF   PGP G +G   K GE G PG  G  G  G  GE+G  G  G  GP G IG +G  GAPGP G +G  G                 GE+GA G PG +GE GE GL+G++G  GRDG  G  G IG  G      P G  GD G+ G  G  GP+G +GS G RGE   +G +G  GF G  G  G PG KGE GT G +G+ G  G  G  G                        + GFPG  G T                        G RG  GP G  GE+G  GP GF G        G  G  G  GP G +G PG +G  G++G+RG PGI G     G +G  G  G +G  G  G  G+ G  G+ G  G PG  GP G  G  G  G +G PG+ G  G  G  G HG  GP+GK G  G  G  G  G +G  G  G +G QG +G +G  G+ G  G PGL G+ G                     P GP+G  G     G  G+ G PGP G  G++G QG  
Sbjct:  342 AGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPG---------------------NRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIG---------------------------------------PAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAIGAPG------PAGASGDRGEAGAAGPSGPAGPRGSPGERGE---VGPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGIRGPRGDQGPVGRTGEIGASGPPGFAGEKGPSGEPGTTGPPGTAGPQGLLGAPGILGLPGSRGERGQPGIAGALGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGNIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGARGLPGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPIGKDGRSGHPGPVGPAGVRGSQGSQ 1092          

HSP 5 Score: 176.792 bits (447), Expect = 5.069e-43
Identity = 242/627 (38.60%), Postives = 284/627 (45.30%), Query Frame = 3
Query: 2319 GPQGDIGMDGDRGPAGP----------------------------------------KGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLR---GLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQG---------------SDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQ---GPVGEVGILGKPGLGGYQGPRGP------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGL 3998
            GP GD G  G RGPAGP                                        KG     G +GL G  GP G  G+ G +G  G  GE G PG  G  G R   G PG  GE G  G+ G+ G++G++G  G  GFPG  G  G +G  G  G+ G  G  G  G  G  G  G  G  G  G  GLPGE G  G  G  G  G  G  G +G  G  G+ G  G PG  G  G  G  GN G  G  GPRG  G               ++G  G +G  G  G  G  G  G  GIPGP G  G +G RG+ G PG  G  G +G  G  G  G+Q   GP GE G  G PG  G  GP GP       G  G  G  G+ GV GP G +G  G  G  GPNG     G PG+ G+ G  G P   G PGN+G  G  G VG+ G  G+PG +G                    GP G +G +G  G  GP G PGK G +G PGL G  G PG  G +G +G  G +G++G  G QG  G  G +GL GP G +GE G  G+ GLPGE G+ G  G  G+RG    PG+ G  G  GP G  GP G PG  G KGE G 
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPVGPPGPPGAPGPPGPPGPPGLTGNFAAQYSDKGVSAGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGVRGPNGD---AGRPGEPGLMGPRGLP---GSPGNVGPAGKEGPVGLPGIDGRPGPIGPA------------------GPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGP---PGESGAAGPSGPIGIRGPSGAPGPDGNKGEAGA 632          

HSP 6 Score: 134.42 bits (337), Expect = 4.577e-30
Identity = 192/558 (34.41%), Postives = 224/558 (40.14%), Query Frame = 3
Query: 2565 QRGDKGLLGDFGIMGFPGPRGPT-------------------------------------------GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY---IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVG---------------EVGILGKPGLGGYQGPRGPKGQTGFEGD---------QGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            ++G  G  G  G  G  GPRG                                             G  G  GP G  G +G  GP GF G  G  G  G  GP G     G PG+ GE G  GK G PG +G  G  G+                      G  G  GLPG +G RG+ G D   G +G PG+QG  GE G  G++G PG +G  GL G RG  G PG  G     G  G  G  G  GP+G               E+G +G PG  G  GPRG  G  G  G           G  G  G  G  G+ G  G  GP G PGP G  G  G  G VG+PGP G  G  G +G PG  G  GP G  G+ GK+                     G  G  GS G  GP G+ G  G++G PG  GR G+ G PG                   +G+ G  G+RG  G  G  GE G+ G  GLPG  G  G  G  G  G PG+ G  G IG  GP G  G  G PG KG  G+ G PG+ G PGL 
Sbjct:   31 RKGPTGDRGPRGQRGPAGPRGRDGVDGPVGPPGPPGAPGPPGPPGPPGLTGNFAAQYSDKGVSAGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGA---------------------RGFPGTPGLPGFKGIRGHNGLD---GLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGA---RGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPVGPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSKGETGNKGEPGSAGAQGPPGPSGEEGKR---------------------GSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGN------------------RGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLA 522          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|A0MSJ1|CRA1B_DANRE (Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.714e-95
Identity = 439/1261 (34.81%), Postives = 578/1261 (45.84%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIG---KPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKG------PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNG------YPGPHGLPGDKGISGEVG---DPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGI------KGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE------------PGLIKIID---IQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSA-IQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G  G+KG+ G  G  GD G+ G  G +G  G +G  G  G  G IG  G  G  GPPGL+G  G PG  GE GL G                        D+G++G  G  GE G     G+QG  G+ G+ G  G +G  G  G DG  GP+GP G  G+ G  G  G +G  GN GV G PG  G+ G++GDQG        G  G  G  G  G++G  G  GE+G +G  G+TG  G+ GE GP+G        GP G++G  G +G  G+ G+ GPPG  G  G  G  GE+G SGP G  GP G+ G  G+ G  G  G +G  G  GEKG +G  GP G PG+ GL GQ+G IG  G +GP G  G+ G  GP G KG      PQG  G +G  GEIG  GL G  G +G PG+ GE G  G  G +G +GL G +G+PG DGE G                  P GP G +G  G  G++GE G  G +GF G+ G  G  G +G  G  G PG+IGE+G  G++G  G +G  G MG+ G                    GD G IG  G +G  G  G+ G +G+QG PG  G  G QG +G  G PGP G+ G  G  G      + G PG SG+ G  G +G +G   E G  G PGL G QG RG +G  G  G+ G  G PGP+G+KG KG +G   P G       PGP G+PG +G+ G  G   +PG  G  G  G +G PG +G  G +G PGK G QG  G                 GL G  GS G  G RGI G  G  GK GL G +G PGK                     QG++G  G  G  G +G  G  GI G +G PG+ G       KG QG+ G +      G  G +G IGP G  GPQG+   KG KGE+G+ G  G             P +    +   +   ++ F  R   R   +M   TD  ++             + +F  L  L  L+      LG++ENP+R C+D+ +E    +  G +WIDPN+G  SD++   C F+    +TC+        KP+                       T  K+    +  Q+ F+  L S+A Q I + C    V+     K   S+ +  +A++ + +          EAG  +    +KD+C          Q     +D   LPI++I       P          VCF
Sbjct:  577 GVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKG------------------------DKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGP------VGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVG------FVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAG------------------PSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALG------------------EQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGK-----VEGPPGPSGDIGPVGNRGDRG---EPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAP---------------GLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGK---------------------QGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQ------GAIGPVGIIGPSGNPGPQGD---KGNKGEMGVQGPRGPPGPRGPPGPPGLPAVAFSHENEALGAALHVFDSRSALRS--EMYQDTDLPLL----------DQGSEIFKTLHYLSILIHSIKNPLGTQENPARMCRDL-LECEHRLNDGTYWIDPNLGCSSDNIEVTCSFTSGG-QTCL--------KPV-----------------------TASKLEIGVSLIQMNFIHLLSSEAVQIITVHCLNVSVWASEDSKTPSSSMVYFKAWDGQII----------EAGGFIEPDLLKDECWITDGRWHQTQFIFRTQDPNLLPIVEIYNLPSTKPGSHYHLEVGPVCF 1657          

HSP 2 Score: 267.7 bits (683), Expect = 7.318e-71
Identity = 317/783 (40.49%), Postives = 403/783 (51.47%), Query Frame = 3
Query: 1806 GEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP------IGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGE---------LGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS---DGDVGRQ---GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQ---GPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTV------GSQGYYGPRGIPGKIGTQGKPGLVGRIGLPG-KPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGE---AGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQ---------DGEPGL 4025
            G+PG  G  G  G  G  G+ G +G RG  G  G +G  G  GL G  G  GP      IG  GI GL G  G+ G PG     GK+G++G PGF GD G+RG  G  G+ G +G  GP+G  G  G  G  G +G  GLIG +G  G  G PG +G+ GE+GL G+ G  G  G+ G QG  G+ G +G  GP+G  GD G         P GL G +G  G PG IG    PG  G+ G +G  G +G PG  G  G  GD+G +G  G  G  G  G  G+ G+ G EG+KGE         LG  GP+GF+G  G  G  G  G  G  G PG  GEKG  G  G PG +G SG  G+P                     G  G+ GL G +GP+G +G+   DG VG +   GM G +G PG+QG  G  G  G +G+ G +G  G+ G  G  G  G  GE G QG  G  GP+GE+G +G PG  G Q   G  G KG  G  G+ G+ G+ GP+G  G+ GE G  GP+G  G     GD G+ GE G+ G IG+ G  GR G PGL+GV GP GKPGK+G++G  G +G KG +G  G  G +G  G        GS+G  G  G PGK+G QG+PGLVG  G  G +  +        +     +  ++G  G +G  G VG RG  GE    G  G EG+ GE G +G  GV G  G  G PG +G  G+ GP G+  P+GE G +G  G +G+PG          +GEPGL
Sbjct:  499 GQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPG---VPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRG---------PDGLPGPLGPEGFPGDIGP---PGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAP---------------------GPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQ---GDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGL 1242          

HSP 3 Score: 252.292 bits (643), Expect = 3.806e-66
Identity = 309/830 (37.23%), Postives = 400/830 (48.19%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFG---LIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTG---------EQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG-LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP---GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVG 3662
            G IG +G  G  GP G     GDIG            P G  G  GP+GN G+RG  G         +QGP G  G  G  G  G +G++G  G  G  G  G  G  G  G  G  G +GP G  G  G+ G +G  G  G  G+ G  GH GA GE                                                +G  G  G  G  G +G  G  G +G RG +G  GP G  G+ G++G +   GP G +G+ G  G  G+ G  GP G +G +G  GPP      G +G  GE G  G  G++GP+G I   G+ G PG  G QGL G+ GEKGA+G+PG  GE G I               GP+GD G+DG+ GP+GP G +G+ G +GL+GE   SG KG +G +G  G+ G+   PG  G+ G  G PG  GE G  GE+G +G +G LG+ G +G    +G TG  G  G  G  G +G  G +G  G  G+ G++G+ GP G +G PG  GEKG +G  G + G  GPSG +G                   +G+ GD+G  G PG  G  G QG  G  G  G+PG+ G  G  G KG  G  GP GK    G  G  G PG +G+P   G  G  G++GE G  G  G+ G  G PG  G  G  G  G+ G +G+ G  G+PG QG+ G KGE+G  G +G PG  GL G  G  G+ GD G  G PG+ G QG PG++G+ GP G PG  G  G+ GP+G +G          +G+ G +G  G  GP G PG  G +G  G +G
Sbjct:  691 GKIGDRGPDGLPGPLGPEGFPGDIG------------PPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGE------------------------------------------------RGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPE---GPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPP------GAKGILGEPGPQGSPGVLGPLGEI---GAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLI---------------GPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGE---SGEKGVIGFKGTEGRTGD---PGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGE---QGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGP------------------VGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGL---------MGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMG 1397          

HSP 4 Score: 213.386 bits (542), Expect = 3.292e-54
Identity = 246/632 (38.92%), Postives = 307/632 (48.58%), Query Frame = 3
Query: 2256 GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMP---GSQGSPGEQGEKGDHGIPGPSGKTGL---------------------SGIRGITGRPGILGLPGFSGETGYQGEK---------GSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGR---QGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGL------VGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLP---GELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            G+PG +GL GQ G  GR G  G  G  G  GD+G  GP G  G  G  G QG  GP G  G  G+R         GF G  G+ GL G  G++G PG  G++G+ G  G  GDFG  G PGP G  G  G+ GP GI G +G+ GP+G +G  G+      +GP G  G PGE G KG KG+ GLPG  G  G  G                       G +G+ GLPG+QG  G QG  GD G  G+P   G +G PG+ G  G +G+ GP G  G+                     +G  G+ GRPG  G+ G  GE G +GE          G +GPVG VG  G+ GL G +G RG  GQ G  G++G  G PG  G +GL G  G  GP+G  G  G  G KG  G  G  GP+G  G +G    +G PG  G++G +GK G+ G+                  +GP G +G  G  G  G +GI G+ G QG PG+      +G IGLPGK                  +G QG  GE G +G VG  G  GE G+ G  G P   GE G  G  G  G++GD GL G+ G+ G IG  G  G  G+PGL GVKG  G PG+ GE
Sbjct:  490 GDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQGLPGPIGNMGPKGVR---------GFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGL------IGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGD---------------------KGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGE------------------AGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGK------------------AGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGE 1049          

HSP 5 Score: 172.94 bits (437), Expect = 1.007e-41
Identity = 220/555 (39.64%), Postives = 274/555 (49.37%), Query Frame = 3
Query: 2490 GFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL---QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGV---PGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQ------------------------------------RGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G  G  GL GLPG  G+PG  G++G  G  G  GD GI      RGP G   S G +G  G  G  GP+G +G  G+RG         +IG+PG  G  G  G+RGLPG+ G  G MG PG  G+ G +G PG  G  G  G  G +G+PG     GP G  G  G +G +G+PG+ G PG +G+KG+ G+PG  G+ G  G +GI G PG   LPG  G+ G QG+ G +GP G  G LG  G   + G  GP GQ G EG +G  GV   PGP G  GL+G+QG +GP G PG  G PG KGISG   +PG  G  G  G  G PG++G  GP+G  G  G+                     +GL+G  G +G  G  G PG+ G  G PG  G  GL G           G  G  G  G+ G +G  G RG  GP G  GE G+ G   + G  G  G QG++GQ                                    +G PG+ G  G+IG+IG PG+ G QG PG  G KG +G PG  GE GLI
Sbjct:  487 GIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGI------RGPDG---SPGAKGYPGRQGLPGPIGNMGPKGVRG---------FIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPG---LPGVQGKPGPQGKIGDRGPDGLPGPLGPEG---FPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISG---NPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGE---------------------MGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGP---------AGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMG---MKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLI 981          

HSP 6 Score: 169.474 bits (428), Expect = 9.840e-41
Identity = 225/563 (39.96%), Postives = 280/563 (49.73%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP---PGLMGHDGS------PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDV---GEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGK-------EGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAP---GPIGLQGLIGKEGEKGAIGNPGPRGE------PGEIGLQGQVGIIGR---------------DGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLP---GDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGL 2765
              G +G KG +G  G  GL G +GK+GE G+ G   P G+ G +GP G  G +G  GE GP   PG++G  G       PG  G++GL          G  G  G  G PG  G++G IGPRG  G  G+ G  G +G KG  GDV   GE G KG IG  G+ G  G  G +G  G  G  GK                      G++G+PG  G+ G  G  G +G +G++G  G  G KG RG TG  G  G  G+ G  G  G  G  GP+G +G PGP+G  G+       EG  GP G IG  G RG  GE GD G  GL G  G  G +G+ G P   GP G  G  G +G KG  G   PRGE      PG +G+ G  G+IGR               DG  G  GD+G DGD G  G  GPQG+ G  GL       G++GS G +GE G  G SG PG  GL G  G P   GD+G  G  G+ G++G  G+LG FG  G PG  GP G++G  GP+G+ G  G  GP+G IG  G  G QG+ G  G +G+
Sbjct:  875 EKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAG---PTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLP---------GEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGK---------------------IGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGL------PGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMGV 1398          

HSP 7 Score: 165.622 bits (418), Expect = 1.725e-39
Identity = 227/626 (36.26%), Postives = 290/626 (46.33%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXX---XXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGAR---GVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT------GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG 3050
            SG  G KG +G +GP G +G+ G        G+ GP G  G +G  G +G  G TGE GP G  G  G  GP G +G+ G  G  G PG  GP G  G    PG  GD+G  G  G +G +G PG  G  G+ G  GD G  G  G  G DG+                                             +GE G +G  G  G KG IG+ G EG     G+ G KGP G  G  G RG  GE G  G +G     G  G +G  GF GP+G+ G  G +G PG +G +G+ G  G +G  GP G +G  G  G +G  G  G +  +G  G  G+ G +GN G RGEPG+ G  G  G+ G  G  G  G  G  G RG  GPKG +G+      +G  G +  +G  G RG PG +G  G  G  G  G  G PG  G  G DG +G  GD G  GD G+ G PGP+G        G++GS GP+G +G  G+ GP G  G  G  G  G  G  G+ G PG+ GE+G  G  G+ G +GP G                           D G +G+ G +GP+G  G  G +G  G+ G  G+PG QG+KG+ G
Sbjct:  855 SGTRGPKGTRGARGPDGPVGEKG------MMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGA---------------------------------------------KGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKV--EGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGN------KGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPG---------------------------DFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKG 1394          

HSP 8 Score: 108.227 bits (269), Expect = 4.597e-22
Identity = 155/366 (42.35%), Postives = 198/366 (54.10%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHD---------GSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---PGEIGLQ 2282
            G IG +G+ G+KG  G  G +G++G  G++G  G +G  G RG  G +G  G  G+QG PGL+G++         GSPGPKGE+G                   EGPPG  GD G +G RG +GE G PG  GL G++G  G  G  G  G  G  G  GP G +G  G  G     G+ G  G+PG +G PG  GV G +G +GEPG  G  G  G KG  G +G++G  G+ G+ GP+G  G  GL GV G  GP G  GI G  GP G+ G  G  G  GK+G+ G  G  GD G++GF G  G  GP G  G  G +G QG  G  G +G+QG IG  G  G  GNPGP+G+    GE+G+Q
Sbjct: 1045 GKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKG-----------EQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMGVQ 1399          

HSP 9 Score: 76.6406 bits (187), Expect = 1.958e-12
Identity = 90/255 (35.29%), Postives = 113/255 (44.31%), Query Frame = 3
Query: 3306 KGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQ---------GVNGQRGDPGLPGDRGKIGSIGPPGRVGPQ------GEPGLKGVKGELGLPGQDGEPGL 4025
             G+KG+ G +G    PG  G PG K   G+ G PGP G+PG+          G+ GP G P                                 G++GY G +G+PG IG  G  G+ G IG+PG                     I G  G  G RGL    G+ G+ G  G+ G PG+ G +G           G  G  G PG  GD G +G +GPPG +GP+      GEPGLKG KGELGLPG+ GEPG 
Sbjct:  486 SGIKGDPGLVG---LPGQPGQPGRK---GQKGHPGPSGHPGD---------QGIRGPDGSP---------------------------------GAKGYPGRQGLPGPIGNMGPKGVRGFIGIPG---------------------IFGLPGADGERGLP---GVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGF 668          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q17RW2|COOA1_HUMAN (Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2)

HSP 1 Score: 344.739 bits (883), Expect = 4.396e-95
Identity = 409/1194 (34.25%), Postives = 540/1194 (45.23%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQG------------------DIGMDGDRGPAGPK------------------------------GPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLL------------------GDFGIMGFPGPRGPTGLRGSSGPEGI------------KGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGK---RGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQ------GMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGP---HGLPGDKGI----------------SGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGI------------PGKIGTQGK---------PGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGL---PGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEP---GLKGVKGELGLPGQDGEPGL------------------------IKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRI-KDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFD--SVCF 4892
            +QG PG  GN G+       GY G++G  G +G  GP+G  G  G  G  G+ GP G  GI   RG  G KG+ GFPG  G  G  G  G PG +G  G  GF G +G  GPVG IGP G  G  G  G  G  G++G  G++G  G +G PG  G+ G +GL G  G+ G+ G SG  G                  DIG+ G  GP GPK                              GP+G  G+ G  GE GP GLKG +G +G  G+IGE+G  G  G +G+ G  G+KGE G+ G  G +G+KG++                  G  G  G PG +GP G RGS GP+G+            KG+ G  GP G IG  G  G +G  G  G  GLPG  G++G  G+   RGL G  GP G MG  G  G +G  G  G  G  G  G  G++G  G  G RG  G+ G+ G Q      G+PG +G PGE GEKG+ G+PG  G  G SG  G+ G  GI+G+PG  G  G +G+KG  GP GEVG  G PG  G  GP+G +G  G  G  G  G  G  G  G +G QG  GP+G PGP    G PG+                    GE G+PG  GY G++G  G  G  G  GP G+PG  G+QGL G  G +G KG +G  GP G  G  G QG  GP+GI            PGKIG  GK         PG  G  G PG PG+ G  G  G  G++G  G QG  G+ GI+G  G RG  G+ G  G  GL   PGE G++GL G  G  G  G  GD G +G  GP G +G +G     G +G+ G  G  G  GE G                          K +DI   +   +      Q   M+S  + +V +I ++          +F  L  L  L+      LG+++NP+R CKD+ +   + ++ G +WIDPN+G  SD++   C FS    +TC+P                                 ++ K+ F     Q+ FL  L S+A   I + C  +  +  +        I  + +N +    +            LLE ++  DDC  +  +   A      ++   LP+I++  Q   +      YY D  SVCF
Sbjct:  583 EQGIPGFAGNIGS------PGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQMDINAAIQALIESNTALQ---MESYQNTEVTLIDHS--------EEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDL-LNCEQKVSDGKYWIDPNLGCPSDAIEVFCNFSAGG-QTCLPP-------------------------------VSVTKLEFGVGKVQMNFLHLLSSEATHIITIHCLNTPRWTSTQTSGPGLPIGFKGWNGQIFKVN-----------TLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEV--QKLPHLKTERKYYIDSSSVCF 1713          

HSP 2 Score: 258.455 bits (659), Expect = 5.051e-68
Identity = 326/805 (40.50%), Postives = 412/805 (51.18%), Query Frame = 3
Query: 1842 GPKGFIGYVGKEGARGVQGEKGPRGITGLT---------GLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG---------DFGIMGFPGPRGPTGL---------------RGSSGPEGIKGELG------------NDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGT---KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGE------KGSQGPVGEVGILGKPGL---GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---PGPHGLPGDKGISGEVGDP---GPIGYPGNIGRQGAPGLVGVTGPIGKPGK------VGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKP-------XXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            GP+G  G  G  G  G+ G KGP+G  G +         G +G+ G  GP G +G +GL G  G  G PG +G  G  G IG PG+    G++G +G +G+ GP G  G IG+ G  G  G  G  G+ G+ GK+G KG  G PG  G+ G  GL G  G++G  G  G     G+ G  GP GP GP G  G +GL G  G  G+KG  G +G  G++GE G+PG  G +GL G PG +G+ G  G+ G  G +G  G         D GI G  GP GP GL               +G  GP G  GELG              GP G  G VG +G+ G +G  G +GLPGE+G  G+   KG+RG PG  GP G  G  G  G  G+ G  G LGL GH G +G  G  G +G RG++G DG +G QG+ G++G  G+QG++G HG+    GKTG  G RG  G+PG+ GLPG +G+ G  GE      +G  GP GE+G+ G PG     G QG  G KG  G  G  G  G PG +G  G  GE+G  G +G    PG  GLPG+ G  GE+G P   GP+G  G  G  G  G+VG+ G  G+PGK      +G  G +G  G  G+ G  G  G  G  G VG  G  GP G PG  G +G  G  G  GLPG               G  G +G  G  G QG +GE G  G  G  G+ G  G TG++G PGE G +G QG+ G+RG  G  G +G  G  G PG  G QG  G KG++G  G  G  G PG I
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGY---PGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPG---FPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGL---IGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKI 1308          

HSP 3 Score: 233.417 bits (594), Expect = 2.473e-60
Identity = 315/808 (38.99%), Postives = 384/808 (47.52%), Query Frame = 3
Query: 1341 FRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLR---GVDGETGPIGAEGIRGLDGP---KGQIGFPGPEGASGKEGEIGP---------------PGFIGDE---GKRGFSGEKGDSGPVGLIGP---IGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEI---GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL---RGLPGDKGE------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIR---------GHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXX-------HNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---------------------TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP------------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVG 3500
             RG  G +G  G  G  GP GL G+ G PG KG                              D+G+ G  G  GE G PG +G  G+ G  G  G+ G  G  G+ G  GP GP GP G PG  G  G+ G  G  G++G  G  G  G+KG QGE G IG  G LGP+      GK G +G  GE GP G+ G  G +   G  GETGP+G  G  G+ G    KG+ G PGP G  G++G +G                PG +G     G +G  G++G  GP GL+G     GA G +G  G  GP GL G  G  GE+G  G PG +G PG     GL G+ G+ G  G+ GP G++GM+G  G  G  G QG+ G  G  G  G  G  G  GLRGEPG  GE G  G  GL G+   RGLPG+ GE      PG  G  G+ G  GL G  GI+G PG RG  G +G  G  G  GE+G+ GP G IG  G +         GH G +GPDG  G+PG  G +G  G  GLPG KG  G  G                              G KG++G+PGL+G  G QG  G+ G QG  G +G  G +G KG  G PGPSGK G+ G++G+                      G PG  GLPG  G  G  G  G+ GP G  G  G PG  G QGP+G             +G  G +GDQG  G PG +G  G  G QG  G  G+PGP G  GD GI G  G  GPIG+ GN G  G  G++G TG  G  G+ G
Sbjct:  682 LRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKG------------------------------DKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPR------GKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKG 1453          

HSP 4 Score: 203.756 bits (517), Expect = 3.515e-51
Identity = 258/700 (36.86%), Postives = 324/700 (46.29%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI-------GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI---GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD 3269
            +G IG KGE+G  GP G  G+ G +G  G  GV GP+      G+ G RGP G+ G +G  G +GP GL+G  G  G KGE+G                           D+GK GP G  G+ G PG +G  G  GL G  G  G +G  GE G  G                                           QG+ G  G  G  GP G  G  G +G  G +G+ G  G  G TG  G+ GE G  G EG++G DG KG  G  G  G  G++GE+G PG IG  G+   SG+ G  GP G++G  G  G  G  G  G IG  G +G  G  G IG  GP+G  G  G  G +G++G DG  G  G  G  G  GP+G  GP+G+ G  G    +       G  G  G  G RGEPG  G  G  G  GL G  G  G  GEPG  GE+G +G++G  G+ G  G PGP G  G+       G++G LG  G  G+ G+ GI G+ G +GP G  GLPG     G  G  G  G PG+KG SGL GS                              PG+QGP+G QG  G  G QG  G +G+ G+QG  GD G+ G  G+ G+ G+ G  G PG  G  G +G  G  G KG  G  G  G LG+ G+ G  G  GP+G+ GF G+
Sbjct:  866 TGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKG---------------------------DQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGL------------------------------------------QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGR---SGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGI------PGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGS------------------------------PGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          

HSP 5 Score: 182.57 bits (462), Expect = 1.196e-44
Identity = 236/569 (41.48%), Postives = 299/569 (52.55%), Query Frame = 3
Query: 2352 RGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLP---GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGL---PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGK------PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            RGP G  GP G+ G  GL G  GP G  G    +  PG+ G+ G  G  G  G++G  G KG PG  G  G++G  G  G+ G  G+PG +G  G  G+ GP+G +         GFIGS    G  G LGP+G  G+PG  G+KG KG++G P   G +GP+GL GSPG  G  G  G PG+         +G++G  G  GP G  G  G  G +G+PG +G  GEQG  G+ G PG  G  G     G+ G PG+ G  G SG+TG  G +G  GP G  G  G  G+ G  GP GPKG  G  G  G  G+ G QG +G  G  G +GP G PG  G    PG +G+ GEVGD G IG  G  G  G PG VG+TG IG+      PG +G QG  G  G  G  G+ G  GP+GL G VG++G  G +G  G+ G++G  GL+G  G                        IQG KGE G +G  GP G+ G+ G  G+ G  G+ G++GL G  G RG PG PG RG  G +GPPG +G +G PG +G  G  G PG  G+ G
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQ---------GFIGSP---GEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---------RGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAV---GLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQG------------------------IQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVG 1032          

HSP 6 Score: 68.9366 bits (167), Expect = 5.186e-10
Identity = 120/311 (38.59%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM-------------GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE 2108
            + GH G+ G  G  GP G  G  G+                          G  G++G  G  G+RG TG+QGPPG  G  G  G KGERG                          G++GK G  G  G+ G PG+QGL G KG+ G  G  G  G  G+ G  G  G  G  G PG  G  G  G PG  G  G PG  G++G KG+QG PG  G  G  G +G  G  G  G  G++G+ G  G+ GLTG +G  G  GP G  GI G+ GPKG IG  G  G  G+EG IGP G  G  G++GF GE
Sbjct: 1171 YRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERG------------------------SEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|O46392|CO1A2_CANLF (Collagen alpha-2(I) chain OS=Canis lupus familiaris OX=9615 GN=COL1A2 PE=2 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 2.939e-89
Identity = 453/1353 (33.48%), Postives = 584/1353 (43.16%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPK------------GQIGFPGPEGASGKEGEIGPPGFI------------------GDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH---GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLK---GSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT------------GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLP---GEIGEKGTKGKRGLP------------GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMP---------------GSQGSPGEQGEKGDHGIPGPSGKTGLSG------------IRGITGRPGILGLPGFS---------------GETGYQGEKGSQGPVGEVGILGK---------PGLGGYQGPRGPKGQTGFEGDQGKFGVP------------------GPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---------------VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ------------VGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLK-SQNESEWWLSKLKD---QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            PMG  G RGP G  G  G  G QGP       G PG  G+ G  G +G  G PG  G  G  G PG PG+RG +GP+G +G  G PG+ G  G++G  G  G KG  GA G                                                 +GEPG  G  G           G+ GARG+ GE+G  G  G  G RG DG  GP+G  G  G  GP             G +G PGP G +G  GE+G PG                    G  G  G +G  G  GP G+ GP+GA G+ G+    G PGP G +G  G +GE G+ G  GP G  GE G +G  G  G  G SGP G  G  G RG  G  GP G +G  G +G  GP+G++   G  G  GEPG +G  GFPG  G +G  G  G  G PG DG  G  G  G  G+ G +GFPGP+GPT            GL G+ G  G  G  G  GP G  G  G +G QG  GP G+ GLP   G  GE G  G+RGLP            G +GP G  G+ G  G  G +G  G  G  G+ G+ G +G PG  G  G  G  G+ G  G+P               G+ G  G +G  G  G PGP+G TG  G             RG  G  G +G  G +               GE G +G KG  GPVG  G +G          PG  G +G  GP G TGF G  G+ G P                  G +G +G +G  G  G  G  GP G  G+KG SGE               +G PG +G PG+ G +   GL GV G +G+PG +G  G  G  G  G  G  G++G  G +G  G+ G  GP G  G+ G +G+ G  G IG  G  G  G  G  G  G  G  G  G  G  G  G VGPRG SG  GI G +G PGE G +GL G+ G  G  GLPG  G+ G  G PG VGP G  G  G  G  G  G+ G+PG +    I+                   P        D     D      P + PS+      +   L+ L+  +       GS++NP+R+C+D+ + S+   +SG++WIDPN G   D++   C FS  E  TCI AQ  +   P   + + S+ +   WL +  +   Q    ++ +T     +Q+ F++ L + A Q I   C+ S+ Y D    N + A+ ++  ND +L +  + R             + D C ++        I         LPI+DI   D G+ DQ        VCF
Sbjct:   92 PMGLMGPRGPPGASGAPGPQGFQGP------AGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGV------------------------------------------------KGEPGAPGENGT---------PGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGER---GLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRL-SHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGE--TCIRAQPEN--IPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSR--------FTYTVLVDGCSKKTNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCF 1365          

HSP 2 Score: 150.984 bits (380), Expect = 3.550e-35
Identity = 250/681 (36.71%), Postives = 297/681 (43.61%), Query Frame = 3
Query: 2256 GE-------------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAG------------------PKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEE---GQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF---------IGSVGIRGHQGNLGPDGYIGLPG------------EIGEKGTKGKRGLPGIK------GPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGR------------------QGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQ---GAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            G                          PG +GL G  G  G  G  GPQG  G  G+ G  G                    G  G  G+ G +G +GP G +G  G  G PG  G  G  G  GL G  G PG KGEPG  GE    GQ G +GL G+ G +G PGP G  G  GS GP G  G +G+ GP GF         IG VG  G  G  GP G +GLPG              G  G KG  GLPG+       GP G+ G  G  G  G +G  G  G  G  G+ GN G PG  G +G  G  G+ G+                  +G PGS+G PG  G  G  G PGP G TG +G+RG  G  G  G PG  G  G+ G  G+ GP G+ G +G PG+ G  GP GP    G  G+ G  G PGP+G  G  G+ G  G  G  G  G PG  G +G  G PGP G  G  G Q   G PG  G+ GP G  G+VGK                                  G RG+PG+ G  G  G  G  G PG+ G  G  G  G +G  G  G  GNKGE G+       G  G AG +G  GLPGE G  G+ G  G++G+ GL   RG+IG+   PGR G +G PG  G  G  G  G  GE
Sbjct:   63 GPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGIVGEPGPAGSKGESGNKGEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGPAGVMGPPGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPIGP---AGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPAGTAGEVGKP---------------------------------GERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGV------LGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGL---RGEIGN---PGRDGARGAPGAMGAPGPAGATGDRGE 695          

HSP 3 Score: 144.821 bits (364), Expect = 3.382e-33
Identity = 267/804 (33.21%), Postives = 314/804 (39.05%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP---PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIR---GLDGPKGQIGFPGPEGASGKEGEIGP------------PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGP---------------QGDIGKIGLQGEIGPSGLKGSMG---------------LRGEPGQIGESGFPGFYGLL---------------------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG------------------IMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF------------IGSVGIRGHQGNLGPDGYI---GLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQ 3326
            G  G +G  G  GP G++G  G  G           G  G RGP G+ G  G  G  GP   PG  G+ G  G +G  GL G  G                       G IGP G +GE G  G  G  G  G  G  G+KGH G  G                                                 +G PG  GN GA GP G  G    +G +G QG  GP G  GL G  G  GE G  G  G+    GL GP G  G  GP G SG  G  GP             G  G+ G  G  G  G SGP GL G  GA G  G  G  G  GL+G IG  G  GA G PG  G PG  G  G  G  G  G +GP G  G  G+RG  GP GP               +G+ G  G +GE GP G  G +G                RG+ G  G +GFPG  G                       GLRG  GD+G  G  GE G  G  G  G+ G                  ++G PG  G  G RG  G  G+ G +G  GPLG             +G+ G+ G  G  G DG     G PG  G+ G KG+RG PG  GP G +G+P                     G  G +G  G  G RG  G  G VG  G  G +G  G QG +GD G PG  G  GL G++G     G+ GLPG +G+ G QG  GS GP                GPRGP G +G  G  G+ G PG  G  G++G Q
Sbjct:  400 GSPGSRGLPGADGPAGVMGPPGPRGA---------TGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRP---------------------GPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGA------------------------------------------------RGAPGPDGNNGAQGPPGPQGV---QGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGAAGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGETGLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGTPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPPGFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIAGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAVGAP---------------------GPHGPVGPTGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHN---GLQGLPGLAGQHGDQGAPGSVGPA---------------GPRGPAGPSGPAGKDGRTGQPGTVGPAGIRGSQ 1083          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A4E0S121 (Collagen alpha-1(XI) chain OS=Fasciola hepatica OX=6192 GN=D915_005268 PE=4 SV=1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 627/1807 (34.70%), Postives = 860/1807 (47.59%), Query Frame = 3
Query:   12 QNINVNEIMRQKTILGIFLLYLCEFHVSLS----YNQPKITQGSIDILSAVELSKHSFAIQQPGICKTKNSKP--------GYTILSNNKLKINIDQIPMDTNKNSGLPTEFSILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQY---------------KMLGEVKNVIRFISKIDDGKWHNVAFGIERSYIKLYVDCKEVETQTWDYDQKYFSKSGKLIFAEKGLISVIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYETSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPG------------------EIFILPINLGI-SSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK------------------------------------------PGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITG------------LTGLRGVDGETGPIGAEGIRGLDG---------------PKGQIGFPGPEGASGKEGEIG---PPGFIGDEGKRGFSGEKG------------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD---PGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGV---------------NGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGL------KGVKGELGLPGQDGEPG------------------LIKIIDIQVGMYQFV-PRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIY--MESNKTIASGHFWIDPNMGSVSDSVFAECKFSE--QEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKT--LKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            + +   +++     + +FL  L    V  +     +  +   G+ DIL AV L   ++     G C  +  +P        GY++     L I+ D++     K+  + +E SIL TVR++  +  E+F + + + +V   +  G  + + Y               K    +  VI+F + IDD  WH VA  +++   +L +DC++ E  ++D     F   G+L   + G+   I+  +++   EAA K C+ ++ +C     +M+ +E    +                       G     G  G PG++G PG                   +F++P+NLGI +S  A  A FR  L +H+L +KGVRG RG TG  G  G  GE G+KG+ G  G++G  GP G  G  G  G  G  G++G RG+PG  G  G DG PG SGH+G KG KG+ G  G  GD G                 G  GPRG +G  G  GE G PG+ G  G PGP+G RG                             G IGPRG +GEIG+                                          PG  GL G  G  GD G KG  G +G+ G  G                                           QG  G  G+ G +GP G  G  GK G  GV GE GP+G+ G              G +G  G  GP+GA G  G+ G                +G  G  GP G  G +GE+G    PG +G++G+RG  G +G            DSG VG +GP G+ G QG  G  GP+G  G  G  G  G +G PGPRGEPGE G  GQ G +G  G  G  GD G DG+RGP GP+GP GD GK G  G  G  G KG  G +G  G  G  GFPGF G+ G  G  G KGE G +GE G  G KG +GD G MG  G  G TG RG  GP G KG  G DGP G IGS G RG QG  GP G +G  G  GEKG+KG  G PGIKG  G +G                  + G  G  G+ GLPG+QGP G  G  G+ G QG+ G +G+      +G  G PGP G  G  G  G+ G  G  GLPG  G  G  G  G+ G +G+ G +G+ G  G QG +G +G  G  G  G  G PG QG  G  GE G +G  G PG  G+PG KG  GE+G    PGP G  G IG +GAPG +G  G  G  GK+GK G  G  G  G +G  G++GP G  G  G +G  G  G PG  G  G+ G VG IG PG                    G+ G +G  GI G +G  G  G  G+TGK+G  G+ G  G++G+                G++G PGL GDRG  G  G  G VGP G+PG+      +G +G  G PG+ G PG                   IKI+D+  G Y+F  P R KR    +    DPD  + P  VPSIGAVL R++ R+E+L+  +  +++  G++ +P+R C+DI    E  + + SG +WIDPN+GS +D+   EC+F +  +   TCI     ++  PLT+F K++N+ +WWLS+L+ Q  ++   +   + A ++QI  L  LH KAEQ++   CR + VYFDST+KN+ +A++ R F + +++++  +R++  +G  +LE++++D+CMER     S+     A++   LPI+D +  +FGN DQ +GYY DSVCFS
Sbjct:   27 RRLQSRQLLSFSLPIMLFLCVLVLLPVQTAGLFGSSSTESLIGTTDILKAVRLGDQAYVESVAGRCGARLEEPSGSEDNPLGYSVSRGMSLFIDGDRL---ITKD--VLSELSILFTVRVEWGFQGELFTVYNRQGQVELGVTFGRELRVYYVSGSANAKTHPRTQTKDKYSLTEVIQFNTSIDDNMWHRVAISMQKGIARLLIDCQQREYVSYDQSTFTFDDRGRLQLLKDGIQGAIQDLYLIPSGEAAGKQCDIYSTDCAQ--DRMMGDEAVTTSDPMQ-------------------GPTGPMGDMGPPGDKGEPGIPGGDGLVGDPGPPGPAGSLFVIPLNLGIGTSSFARAATFRDLLQKHLLSLKGVRGPRGMTGVPGPDGMQGERGVKGEPGHPGETGFQGPRGAMGLSGRPGPAGPPGRDGARGEPGANGPAGEDGRPGDSGHMGPKGAKGEVGHRGEKGDFG---------------LPGAEGPRGPLGDSGEQGEIGLPGVQGPIGVPGPQGPRGKP---------------------------GGIGPRGRKGEIGEQGIPGIAGPPGPSGAPGPEGIAGPRGPPGPSGQPGRAGAAGVPGSDGLPGFPGQKGDTGAKGDAGDVGQKGETGV------------------------------------------QGPRGYKGDRGRMGPTGPKGDAGKTGPMGVSGEVGPKGVKGDIGMPGPVGPPGPMGEKGNPGPQGPVGARGDPGVKGFMGAIGPPGPPGPDGERGVTGPAGPRGRDGDKGEVGIQGAPGDVGEQGQRGSPGSRGPPGKLGPPGPKGDSGSVGPVGPAGSFGEQGVQGPMGPVGPTGPQGAVGRPGPVGFPGPRGEPGERGPPGQPGALGSTGPPGATGDPGPDGERGPVGPRGPAGDAGKDGQPGRDGAPGAKGVRGPQGLAGSRGARGFPGFDGMPGRPGPTGPKGESGPNGEPGPIGSKGYMGDQGPMGPVGAPGLTGPRGPPGPAGEKGSTGVDGPFGLIGSPGPRGPQGRPGPTGQLGPHGFDGEKGSKGASGPPGIKGDKGGVG------------------IRGPTGPIGSPGLPGIQGPPGIPGQSGEEGPQGLVGPEGN------RGVTGSPGPIGMRGAPGAPGLPGEKGDTGLPGPRGRRGPTGLAGAPGILGQQGDVGQIGAAGAQGDKGDQGIHGIPGSIGFPGTPGVQGVVGAAGEDGPVGLQGPPGDMGIPGVKGPKGELGPAGLPGPAGPKGPIGAKGAPGPMGPDGAAGPRGKMGKSGPRGLPGPAGPEGGPGMTGPQGPEGPRGMKGAKGEVGEPGPTGDPGRRGAVGLIGRPGS------------------LGMPGLRGPVGIPGPMGKVGERGSEGVTGKQGEMGDQGKPGIKGIKGAIGPVGPVGPMGRKGEKGAPGLEGDRGPDGPKGERGAVGPIGDPGIPGPSGAEGPEGPAGYPGRPGLPGNQGPKGASGPMGPPGPPGPIKILDVSEGYYRFEDPPRSKRSVDGVILKLDPDEAIAPTTVPSIGAVLRRVYQRIEILENSLNMFDQPTGTRRHPARHCRDILSSAEYPEQLKSGRYWIDPNLGSPTDTFPVECRFKDRGKTALTCIAPTEETQALPLTQFKKTENDQDWWLSRLRSQQVQSNFTRPQLYYAPHNQIRHLHLLHQKAEQSVTFVCRNTAVYFDSTQKNHNAAVRARLFTEHEINTYEHRRLRDLSGNMMLEVKVRDECMERTTNKASSVFEFTAREPNLLPILDFQLSEFGNTDQEIGYYVDSVCFS 1681          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A183JX05 (Fibrillar collagen NC1 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7250 PE=4 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 1.445e-180
Identity = 639/1798 (35.54%), Postives = 879/1798 (48.89%), Query Frame = 3
Query:  123 QGSIDILSAVELSKHSFAIQQPGICKTKNSKPGYTI-LSNNKLKINIDQ-IPMDTNKNSGLPTEF----SILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQY-------------------KMLGEVKNVIRFISKIDDGKWHNVAFGIERSYIKLYVDCKEVETQTWDYDQKYFSKSGKLIFAEKGLISVIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYETSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPG------------------EIFILPINLGI-SSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGL---------NGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGK---EGARGVQGEKGPRGITGLTGLRGVDGE---TGPIGAEGIRGLDGPKGQIGF------PGPEG---------------------------ASGKEGEIGPPGFIGDEGKRG---------------FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES---GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFI------------------------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR------------IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSG---------------EAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPR-RVKRQARDM------KSTTDP------------------------------DVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESN--KTIASGHFWIDPNMGSVSDSVFAECKFSEQ--EIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD--QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            +G++D+L+A+ +S+ ++    PG C+  ++    ++ ++   +  ++ + + +     S +P  F    SIL T+R++    +E F + D    +I  I +G ++ ++Y                      G+      F ++++DG WH VA  I  + ++L VDCK+ E+  ++         G++   + G+   IE F+++ G E A K C+ ++ NC     +M+ +E + +T                       G     G  G PG++G PG                   +FI+P+NLG+ SS  A  A FR  L +H+L +KGVRG RG TG TG  G  GE G+KG++G  GD+G  GP G  G PG  GS G  G +G RG+PGP G+ G DG PG SG IG KG+KG+ GP G  GD                G  G  GPRG  G  G+ G+ G PG+ G  G PGP+G RG                             G  GPRG +GE+G+PGV GL         +G +G+ G  G  G  G  G  G  G  G  G  G PG  G +G KG                     D G  G  G+TG  GP+G+ G  G+   EGA+G  G+ GP G+ G  G +GV G+   +GP+G+ G+ G+ G  G  G       PG +G                             G +G+IGPPG  G+ G++G                 G KGD+GPVG +G +G IG QG  G  GP G  G  G  G +G +G PGPRGEPGE G  GQ G +G  G  GP GD G +G +GP GP GP GD GK G+ G     G  GS G+RG PG +G     GFPGF G+ G  G  G KGE G DGE G  GDKG  GD GI+G  GP GP G RG  GP G+KG  G DGPLG I                        G  G +G  G  GP G  G  G  G  G  G  GLPGI+GP GL G                          G  G  GL GP G++G  G  G  GM G  G PG  GEKGD G  GP G+ GL G  G+    G+PG +G PG  G+ G +G +G  GP G  G+ G PG+   QGP GPKGQ G  G                        P G PG  G+PG  G  GE+   GP+G PG  G  G PG  GV GP+G+ G  G QG +G +G +G  G  G  GP G++G  G  G  GP+G+ G+ G QG PG  GR            +G PG+ G+ G  G +G+ G +G  G+QG +G+ GI+G  GP+G  G               E G+ G EG+ G +G+KG +G  G  GDPG PG  G +G  GP G  GP G PG+ G KG  G  G  G PG IK++D+  G Y+F    RV+R   D        S  DP                              D  + PN +PS+GAVL R++ R+E L+  +  + + +G+++NP+R C+DIY  ++  +T  SG +WIDPN+GS +D+   EC+F  +    +TCI     ++ +PLT F+K+ N  +WW+S LK   QNG   K   + A  +QI +LQ LHSKAEQ I  TCR + VYFD   +NY++A+ ++ F++  + ++ D+R ++  G  +L+I++KD+CMER     S+    + +    LP++DI+ ++FG  DQ +GYY D+VCFS
Sbjct:    3 KGTLDVLTAIRVSEQAYVQTSPGRCRQDSNDLATSLNVAERNVAYSVPRGLSLFIEGRSLIPDPFPPDLSILFTIRLESNLEKEFFALYDRHGRMILRIIIGSHLQLEYLSKESQSSQLSDVHPRDLKAHSGKTLEKAIFKTRLNDGLWHRVAVSIGTTTVRLLVDCKQRESINYNRSSTSIDNRGRIQVLKDGIHGFIEDFYLLPGEEGAVKQCDVYSPNCFD--DQMMGDEGDKDTDPM-------------------QGPTGSMGDSGPPGDKGEPGLNGSSVPAGEPGPPGPMGSLFIIPLNLGVGSSSFARAATFRDLLQKHLLSLKGVRGARGMTGVTGPEGGPGEPGVKGEVGHPGDTGYQGPRGPMGPPGRQGSSGPPGLDGSRGEPGPSGMKGEDGRPGDSGLIGLKGDKGELGPPGPKGD---------------QGLPGEEGPRGPHGDIGDQGDPGLPGVRGPVGQPGPQGPRGKP---------------------------GNQGPRGRKGELGEPGVPGLPGPAGPVGTSGPEGMAGPRGPTGIAGQRGRSGPSGVPGTDGLPGFPGPKGDVGPKG---------------------DTGPNGSKGDTGIQGPRGYKGERGRSGPEGAKGESGKPGPVGVPGDPGPKGVKGDVGISGPVGSPGVTGMKGDPGPPGPVGQRGDPGTKGLPGAIGIPGPPGPDGERGPPGLTGRRGRGGDKGDIGPPGSPGETGQQGQRGAPGPRGPPGRFGPPGMKGDAGPVGPVGSVGPIGEQGLQGPVGPPGPIGPPGSTGREGPVGFPGPRGEPGERGPAGQPGSLGNTGPPGPIGDPGPEGQQGPVGPTGPTGDPGKDGMPGR---DGHPGSKGVRGSPGVLGNQGVRGFPGFDGMPGRPGPAGVKGEIGPDGEVGPIGDKGYQGDVGIIGPIGPTGPLGARGPPGPAGVKGLTGEDGPLGLIGSPGPRGPPGRLGPIGPLGPPGFDGEKGDKGASGPPGPKGDKGGVGIRGPFGPVGSPGLPGIQGPPGLPGQ------------------------AGEEGPEGLVGPEGSRGLPGAPGASGMVGVTGLPGIAGEKGDQGSQGPIGRRGLPGTVGVPGPAGQPGNVGAPGPVGQQGERGTQGEDGPPGPRGVEGSPGV---QGPLGPKGQEGPRG------------------------PQGVPGDIGIPGPDGPKGEL---GPLGIPGPQGPTGPPGPKGVQGPVGEDGSPGPQGPLGKQGLRGLPGPLGPPGPPGMTGPQGRTGPQGPKGVKGETGEQGVPGEPGRVGPVGSPGPPGSLGSPGQQGVPGVMGKQGKTGERGSEGLQGKQGDPGIQGDRGPKGSKGTYGPVGPLGPPGPKGEQGVPGLEGVRGVVGLKGERGPVGPAGDPGQPGPSGPVGPEGPAGHPGPPGLPGVPGQKGSSGPAGPPGPPGPIKVLDMSEGYYRFEDTPRVRRSISDALYNNQYYSKQDPGTLYCKFKSSNTTLFILLFTTTNNNSAQLIDESITPNTIPSVGAVLRRIYARIESLEASMNSFERPMGTQQNPARHCRDIYEAADFPETSKSGTYWIDPNLGSPTDAFTVECRFQNKGNVAETCIKPSEDTKTQPLTNFVKTNNSEDWWISHLKQQKQNGTMHKTQLYYAPINQIRYLQLLHSKAEQVITFTCRNTPVYFDVRNQNYKNAVIVKLFDENVIDTYEDRRTRTIGGGIMLDIKVKDECMERSKQKASSVFEFVTRKPNLLPLVDIQLKEFGESDQEIGYYMDAVCFS 1659          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A095A335 (Collagen alpha-2(I) chain OS=Schistosoma haematobium OX=6185 GN=MS3_08434 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 1.434e-179
Identity = 614/1761 (34.87%), Postives = 835/1761 (47.42%), Query Frame = 3
Query:  126 GSIDILSAVELSKHSFAIQQPGICKTKNSKPGYTILSNNKLKINID-QIPMDTNKN--------SGLPTEFSILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQY-------------------KMLGEVKNVIRFISKIDDGKWHNVAFGIERSYIKLYVDCKEVETQTWDYDQKYFSKSGKLIFAEKGLISVIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYETSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPGEIFILPINLGI-SSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIG------------AEGIRGLDGPKGQIGF------------------PGPEGASGKEGEIGPPGFIGDEGKRGFSGE------------------------------------------KGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES---GFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFI------------------------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGR------------IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSG---------------EAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPR-RVKRQARDM------KSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESN--KTIASGHFWIDPNMGSVSDSVFAECKFSEQ--EIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD--QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            G++D+L+AV +S+ ++    PG C+  ++       S+N  + N+   +P   +             P + SIL T+R++    +E F + D    +I  I +G ++ ++Y                      G+      F + ++DG WH VA  I  + ++L VDCK+ E+  ++         G++   + G+   IE F+++ G E A K C+ ++ NC     +M+ +E + +T                       G N      G+PG  GP G +FI+P+NLG+ SS  A  A FR       LL K +   +G  G  G  G  G  G  G+ G+         +                 +G RG+PGP G+ G DG PG SG IG KG+KG+ GP G  GD                G  G  GPRG  G  G+ G+ G PG+ G  G PGP+G RG                             G  GPRG +GE+G+PG+ GL G  G VG  G +G  G  G  G  G  G  GP G PGT                               G PG  G  G +GPKG  G  G +G  G+QG +G +G  G +G  G  GE+G  G             +G  G+ GP G  G                   PG +G  G  G +GPPG  G+ G  G +G                                           KGD+GPVG +G +G IG QG  G  GP G  G  G  G +G +G PGPRGEPGE G  GQ G +G  G  GP GD G +G +GP GP GP GD GK G+ G     G  GS G+RG PG +G     GFPGF G+ G  G  G KGE G DGE G  GDKG  GD GI+G  GP GP G RG  GP G+KG  G DGPLG I                        G  G +G  G  GP G  G  G  G  G  G  GLPGI+GP GL G                          G  G  GL GP G++G  G  G  GM G  G PG  GEKGD G  GP G+ GL G  G+    G+PG +G PG  G+ G +G +G  GP G  G+ G PG+   QGP GPKGQ                        +G  GP G PG  G+PG  G  GE+   GP+G PG  G  G PG  GV GP+G+ G  G QG +G +G +G  G  G  GP G++G  G  G  GP+G+ G+ G QG PG  GR            +G PG+ G+ G  G +G+ G +G  G+QG +G+ GI+G  GP+G  G               E G+ G EG+ G +G+KG +G  G  GDPG PG  G +G  GP G  GP G PG+ G KG  G  G  G PG IK++D+  G Y+F    RV+R   D        S  DPD  + PN +PS+GAVL R++ R+E L+  +  + + +G+++NP+R C+DIY  ++  +T  SG +WIDPN+GS +D+   EC+F  +    +TCI     ++ +PLT F+K+ N  +WW+S LK   QNG   K   + A  +QI +LQ LHSKAEQ I  TCR + VYFD   +NY++A+ ++ F++  + ++ D+R ++  G  +L+I++KD+CMER     S+    + +    LP++DI+ ++FG  DQ +GYY D+VCFS
Sbjct:   14 GTLDVLTAVRVSEQAYVQTSPGRCRQDSND---LATSSNVAERNVAYSVPRGLSLYIEGRSLIPDPFPPDLSILFTIRLESNLEKEFFALYDRHGRMILRIIIGSHLQLEYLSKESQSSQLSDVHPRDLKAHSGKTLEKAIFKTHLNDGLWHRVAVSIGTTTVRLLVDCKQRESINYNRSSTSIDNRGRIQVLKDGIHGFIEDFYLLPGEEGAVKQCDVYSPNCFD--DQMMGDEGDKDTDPMQGPTGSMGDSGPPGDKGE-PGLNGSSVPAGEPGPLGPMGSLFIIPLNLGVGSSSFARAATFRD------LLQKHLLSLKGVRGARGMTGVTGPEGGPGEPGVXXXXQGPPGL-----------------DGSRGEPGPSGMKGEDGRPGDSGLIGLKGDKGELGPPGPKGD---------------QGLPGEEGPRGPHGDIGDQGDPGLPGVRGPVGQPGPQGPRGKP---------------------------GNQGPRGRKGELGEPGLPGLPGPAGPVGTSGPEGMAGPRGPTGIAGQRGRSGPSGVPGT------------------------------DGLPGFPGPKGDVGPKGDTGPNGSKGDTGIQGPRGYKGERGRSGPEGAKGESGKPGPGGVPGDPGPKGVKGDVGISGPVGSPGVTGMKGDPGPPGPVGQRGDPGTKGLPGAIGILGPPGPDGERGPPGLTGRRGRGGDKGDIGPPGSPGGTGQQGQRGAPGPRGPPGRFGPPGMKGDAGPVGPVGSVGPIGEQGLQGPVGPPGPIGPPGSTGREGPVGFPGPRGEPGERGPAGQPGSLGNTGPPGPIGDPGPEGQQGPVGPTGPTGDPGKDGMPGR---DGQPGSKGVRGSPGVLGNQGVRGFPGFDGMPGRPGPAGVKGEIGPDGEVGPIGDKGYQGDVGIIGPIGPTGPLGARGPPGPAGVKGLTGEDGPLGLIGSPGPRGPPGRLGPIGPLGPPGFDGEKGDKGASGPPGPKGDKGGVGIRGPFGPVGSPGLPGIQGPPGLPGQ------------------------AGEEGPEGLVGPEGSRGLPGAPGASGMVGVTGLPGIAGEKGDQGSRGPIGRRGLPGTVGVPGPAGQPGNVGAPGPVGQQGERGTQGEDGPPGPRGVEGSPGV---QGPLGPKGQ------------------------EGPRGPQGVPGDIGIPGSDGPKGEL---GPLGIPGPQGPTGPPGPKGVQGPVGEDGSPGPQGPLGKQGLRGLPGPLGPPGPPGMTGPQGRTGPQGPKGVKGETGEQGVPGEPGRVGPVGSPGPPGSLGSPGQQGVPGVMGKQGKTGERGSEGLQGKQGDPGIQGDRGPKGSKGTYGPVGPLGPPGPKGEQGVPGLEGVRGVVGLKGERGPVGPAGDPGQPGPSGPVGPEGPAGHPGPPGLPGVPGQKGSSGPAGPPGPPGPIKVLDMSEGYYRFEDTPRVRRSISDALYNNQYYSKQDPDESITPNTIPSVGAVLRRIYARIESLEASMNSFERPMGTQQNPARHCRDIYEAADFPETSKSGTYWIDPNLGSPTDAFTVECRFQNKGNVAETCIKPSEDTKTQPLTNFVKTNNSEDWWISHLKQQKQNGTMHKTQLYYAPINQIRYLQLLHSKAEQVITFTCRNTPVYFDVKNQNYKNAVIVKLFDENVIDTYEDRRTRTIGGGIMLDIKVKDECMERSKQKASSVFEFVTRKPNLLPLVDIQLKEFGESDQEIGYYMDAVCFS 1616          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A3Q0KUI3 (Fibrillar collagen NC1 domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 2.585e-176
Identity = 655/1798 (36.43%), Postives = 875/1798 (48.67%), Query Frame = 3
Query:   36 MRQKTILGIFLLYLCEF-HVSLSYNQP---------KITQGSIDILSAVELSKHSFAIQQPGICKTKNSKPGYTILSNNKLKINID-QIPMDTNKN--------SGLPTEFSILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQY-------------------KMLGEVKNVIRFISKIDDGKWHNVAFGIERSYIKLYVDCKEVETQTWDYDQKYFSKSGKLIFAEKGLISVIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYETSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPG------------------EIFILPINLGI-SSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLV---GDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGK---EGARGVQGEKGPRGITGLTGLRGVDGE---TGPIGAEGIRGLD---------------GPKG------------------QIGFPGPEGASGKEGEIGPPGFIGDEGKRG---------------FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFI------------------------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAP------------------GLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPR-RVKRQARDM------KSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIY--MESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQ--EIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD--QNGKTLKKIT------FTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            +   T+   F +YL  F  + L  N P            QG++D+L+AV +S+ ++    PG C+  ++       S+N  + N+   +P   N             P + SIL T+R++    +E F + D    +I  I +G ++ ++Y                      G+      F ++++DG WH VA  I  +  +L VDCK+ E   ++         G++   + G+   IE F+++ G E   K C+ ++ NC     +M+ +E + +T                        A +M  I G PG++G PG                   +FI+P+NLG+ SS  A  A FR  L +H+L +KGVRG RG TG TG  G  GE G+KG++G  GD+G  GP G  G PG  GS G  G +G RG+PGP G+ G DG PG SG IG KG+KG+ GP G  GD                G  G  GPRG  G  G+ G+ G PG+ G  G PGP+G RG                             G  GPRG +GE+G+PG+ GL G  G +   G  G  G +G  G  G  G  GP G  G  G  G  G KG  G  G               D G  G  G+TG  GP+G+ G  G+   EGA+G  G+ GP G+ G  G +GV G+   +GP+G+ G+ G+                G KG                    G  G  G  G +G+IGPPG  G+ G++G                 G KGD+GPVG +G +G IG QG  G  GP G  G  G  G +G +G PGPRGEPGE G  GQ G +G  G  GP GD G +G +GP GP GP GD GK G+ G  G  G KG  G  G  G  G  GFPGF G+ G  G  G KGE G DGE G  GDKG  GD GI+G  GP GP G RG  GP G+KG  G DGPLG I                        G  G +G  G  GP G  G  G  G  G  G  GLPGI+GP GL G                          G  G  GL GP G++G  G  G  GM G  G PG  GEKGD G  GP G+ GL G  G+    G+PG +G+PG  G+ G +G +G  GP G  G+ G PG+   QGP GPKGQ G  G QG  G  G  G  G KGE G +G  G  GP G PG KG+ G VG+ GP G  G +G+QG                    G  G  GP G  G+ G+QG+ G  G+ G  G  G  G +G   + G QG  G  G  GK G +G  GL G+ G PG PG  G                +G+KG  G  G +GP G  GE G+ G EG  G +G+KG +G  G  GDPG PG  G IG  GP G  GP G PG+ G KG  G  G  G PG IK++D+  G Y+F    RV+R   D        S  DPD  + PN +PS+GAVL R++ R+E L+  +  + + +G+++NP+R C+DI+   E  +T  SG +WIDPN+GS +D+   EC+F  +    +TCI     ++ +PLT F+K+ N  +WW+S+LK   QNG   K         F      I +LQ LHSKAEQ I  TCR + VYFD   +NY++A+ ++ F++  + ++ D+R ++  G  +L+I++KD+CMER     S+    +A+    LP++DI+ ++FG  DQ +GYY D+VCFS
Sbjct:    3 LYHWTMNNQFQVYLTSFVWIILLSNTPVNGFLERLQTAPQGTLDVLTAVRISEQAYVQTSPGRCRQDSND---LATSSNVAERNVAYSVPRGLNLYIEGRSLIPDSFPPDLSILFTIRLELNLEKEFFTLYDRHGRMILRIIIGSHLQLEYLSRESQSSQLFDVHPRDLKTQSGKTLEKAIFKTRLNDGLWHRVAVSIGTTTARLLVDCKQREFINYNRSSTSIDNRGRIQVLKDGIHGFIEDFYLLPGEEGVIKQCDVYSPNCLD--DQMMGDEGDKDTDPMQGP------------------AGSMGDI-GPPGDKGEPGLNGSSVAAGEPGPPGPMGSLFIIPLNLGVGSSSFARAATFRDLLQKHLLSLKGVRGARGMTGITGPEGGPGEPGVKGEVGHPGDTGYQGPRGPMGPPGRQGSSGPPGLDGSRGEPGPSGMKGEDGRPGDSGLIGLKGDKGELGPPGPKGD---------------QGLPGEEGPRGPHGDIGDQGDPGLPGVRGPVGQPGPQGPRGKP---------------------------GNQGPRGRKGELGEPGLPGLPGPAGPIGTSGPEGMAGPRGPTGVAGQRGRSGPSGVPGTDGLPGFPGPKGDVGPKG---------------DTGPNGSKGDTGIQGPRGYKGERGRSGPEGAKGESGKPGPVGVPGDPGPKGVKGDVGISGPVGSPGVTGMKGDPGPPGPVGQRGDPGTKGLPGAVGTPGPPGPDGERGPSGLTGRRGRGGDKGDIGPPGSPGETGQQGQRGAPGPRGPPGRFGPPGMKGDAGPVGPVGSVGPIGEQGLQGPVGPPGPIGPPGSTGREGPVGFPGPRGEPGERGPAGQPGSLGNTGPPGPIGDPGPEGQQGPVGPTGPTGDPGKDGMPGRDGQPGPKGVRGSPGVLGNQGVRGFPGFDGMPGRPGPAGVKGELGPDGEVGPIGDKGYQGDSGIIGPIGPTGPMGARGPPGPAGVKGLTGEDGPLGLIGSPGPRGPPGRLGPIGPLGPPGFDGEKGDKGASGPPGPKGDKGGVGIRGPFGPVGSPGLPGIQGPPGLPGQ------------------------AGEEGPEGLVGPEGSRGLPGAPGAPGMVGVTGLPGIAGEKGDQGSQGPIGRRGLPGTVGVPGPAGQPGSVGVPGPVGQQGERGTQGEDGPPGPRGVEGSPGV---QGPLGPKGQEGPRGPQGVPGDIGTPGPDGPKGELGPLGIPGPQGPTGPPGPKGVQGSVGEDGPPGPQGPLGKQGLRGLPGPLGPPGPPGMTGPQGRTGPQGPKGMKGETGEQGVPGEPGRTGPVGSPGPPGSLG---SPGQQGVPGVMGKQGKTGERGSEGLQGKQGDPGIPGDRGP---------------KGSKGTYGPVGPLGPPGPKGEQGVPGLEGARGVVGLKGERGPVGPAGDPGQPGPSGPIGPEGPAGHPGPPGLPGVPGQKGSSGPAGPPGPPGPIKVLDMSEGYYRFEDTPRVRRSISDALYHNQYYSKQDPDESITPNTIPSVGAVLRRIYARIESLEASMNSFERPMGTQQNPARHCRDIFEAAEFPETSKSGTYWIDPNLGSPTDAFTVECRFQNKGNVAETCIKPSEDTKTQPLTNFVKTNNSKDWWISQLKQQKQNGTMHKTQVMFHFHWFLQYFGLIRYLQLLHSKAEQIITFTCRNTPVYFDVKNQNYKNAVIVKLFDENVIDTYEDRRTRTIGGGIMLDIKVKDECMERSKQKASSVFEFVARKPNLLPLVDIQLKEFGESDQEIGYYMDAVCFS 1674          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A564Z6L2 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12507 PE=4 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 4.715e-172
Identity = 631/1821 (34.65%), Postives = 802/1821 (44.04%), Query Frame = 3
Query:   51 ILGIFLLYLCEFHVSLSYNQPKITQGSIDILSAVELSKHSFAIQQPGICKTKNS--------------KPGYTILSNNKLKINIDQIPMDTNKNSGLPTEFSILLTVRIQ-QFYTEEIFHIRDLEDEVIFS--IKLGENIIIQYKMLGEVK--------NVIRF--ISKIDDGKWHNVAFGIERSYIKLYVDCKEVETQTWDYDQKYFSKSGKLIFAEKGLISVIESFWIVLGVEAAFKHCEYFTRNC----------DHPLVKMINEEENYETSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPG---------EIFILPINLGISS-PNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRXXXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKG---------------EKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGN------TGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGY------VGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGS---------------QGSHGAPGPIGLQGLIGKEGEKGA------------------IGNPGPRGEPGEIGLQGQVG---------------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL------------QGPRGNQGSDGDVGRQGMPGS---QGSP---GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPK---------------GQTGFEGDQGKF------------GVPGPQGAKGLKGEQGY---------------------MGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKS----------TTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDI--YMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            +  +FL+      VS       +   S+D+L+A +L   +      G C    S              +PGY + S  ++K  + ++  +T   S    E S+  T++++      E F I   +  ++ S  I+ G  ++  ++    V+        N I    IS   D +WH V    +   + L +DCK +E+ T     K+      L     G   V++    V G  +  + C  +T NC          D P+     + E  E                        G     G PGKPG RGP G          +F++P+NLGI    +A  A FRQ L +H+  ++GVRG RG TG TG  G MG  G KG+ G  GD+G  G  G  G  G  G  G +G++G+RGDPGP G  G DG PG SG +G KG                 G++GP G  GD G  G+ G  G  GP+G  G  GPRG  G RG+       GE GP G+ G  G  GP G  G  G                         RG +GP G  G+ G PG  G  G  G  G  GE G KG  G                                               G +GEPG  G  G  G +G IG       +GK GA G QGE GP+G+ G  G +GV G  GP G          KG+ G PG  G  G  G  GPPG IG  G +   G +GD GP G  GP G  G                QG HGAPGP GLQG  G  GEKG                    G PGP G PG  G  G+ G                      IG  G +GP GD G +G  GP GP+GP GD GK G +G  G  G KG  G RG PG  G  G+ G  G+ G  G  G KGE G DGE G  G KG  GD G +G  GP GP G RG+ G  G KG  G DG +G +G  G RG +G  GP G IG PG  GEKG +G  G PG KGPSG  G  G                    G  G+ G+PG+            QGP G  GS+G  G  G+PG    +G+P   G+QG KGD G  GP G  G +G  G  G  G  G PG +G  G  GE G  GP G  G  G  G+ G  GP+G K               G TG  G QG              GVPG +GA G  GE G                       GP G  GP GLPG +G  G  G+ GP G PG  G  GA GL G  G  G PG  G Q                     G  G  G  G  GP G+PG  G +G  G  G                            +G KG  G  G +GP G  GE G+TG  G  G +G KG QG  G  G+ G PGD G  G  GP G  GP G  G +G KG+ G  G  G PG +KI+D+  G ++F P R KR     +S            DPD  + PNNVP+IGAVL RL+ R+E L+  V  Y + +G++  P+R C++I    +S     SG +WIDPN+GS  D++  ECKFS    KTC+ A   S+   L    KS +E  WW S+L + N    +++ F A  +Q+ FLQ LH KAEQ+I   CR SVVY+DS  K+Y SA  +  FN + +++H D+R++ E G   LE+ +KDDCM+R  T ++A   L+A     LP++D+K  DFG  +Q +GYY + VCFS
Sbjct:   23 LFSVFLILSSSLVVSAKTFLLDLPASSVDLLAAFKLGDQANVQITAGKCGQVPSEDEVSSKVPIPDEFRPGYLVPSGLEMKKLLSEVLPETIDWS---HEMSVFFTLKMKPSLEKAEFFTIFSSQGRILLSVGIESGHFVVSYHEAAAGVRAARISTSGNAIHSEKISPALDDQWHRVGLNFKEGRVHLALDCKTLESYTTVLPIKFIDPRNTLSLLPSGFEGVLQDLMFVQGDRSLEQQCLIYTPNCPTDGDDAMMNDGPVPLAPGQGEQGEQGD--------------------PGEQGEKGDPGKPGPRGPDGLQGLPGPVGSLFVVPLNLGIGGGAHARAAHFRQLLQQHLESLRGVRGPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPDGLPGDSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGPRGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGP------------------------RGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGAS---------------------------------------------GQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAVGPQGEAGPKGLKGSRGSQGVMGLMGPQGE---------KGEPGKPGESGPRGDRGVQGPPGLIGPAGPQ---GPQGDPGPAGPAGPQGREGDKGDTGPIGPPGPDGEQGQHGAPGPRGLQGKTGPSGEKGDQGVTGPPGPPGPTGEMGFQGQPGPSGLPGPAGQMGRQGPQGFPGPRGEPGETGPPGPRGPIGMTGPAGPAGDTGPEGAPGPIGPRGPTGDPGKEGKEGVKGDKGPKGERGNRGPPGPRGPRGYIGLDGMPGPAGPDGFKGETGPDGEVGPAGPKGYRGDSGPIGQTGPPGPAGPRGAQGIPGEKGPKGPDGVMGPVGPPGPRGSRGRSGPTGPIGAPGFDGEKGERGSAGPPGKKGPSGPQGPRGIA------------------GPIGSPGMPGIQGPPGAPGQPGEQGPMGLIGSEGLTGPAGLPGPMGMEGAPGPIGKQGPKGDRGRVGPQGSPGPAGPMGAIGLTGPAGNPGPTGPAGAVGEPGDVGPQGPRGSPGYAGIPGNHGPQGRKGPDGPPGQVGPPGEDGPTGPIGPQGAVGPMGPPGAPGARGVPGGRGAPGPVGEDGSPGTTGPPGKPGPRGSPGPQGPQGPAGQTGPQGLPGVRGSKGPKGEVGPQGPPGETGPVGAAGLSGPPGLRGSPGSPGPQ---------------------GPQGVTGPDGEDGPEGLPGPAGPEGARGETG---------------------------PKGEKGAYGPVGPMGPSGPRGERGVTGVVGERGGIGPKGAQGPPGPIGNQGPPGDVGPPGPEGPMGARGPTGLSGPRGPKGKQGPQGPQGPPGPVKILDLNAGYFKFEPTRTKRSVNPDESDIEDDLYDGYMKDPDANLFPNNVPAIGAVLRRLYARIEGLENAVKYYQRPIGTRAYPARHCREIAEATDSPHGPVSGEYWIDPNLGSSRDAIKVECKFSGNVAKTCVHATPESKALRLMNLKKSSSEGSWWFSRLLEDNNNGTQRL-FYAPRNQMNFLQLLHHKAEQSITALCRGSVVYYDSRNKDYNSAANLLLFNGKVINTHLDRRVRGEGGFVELEVNVKDDCMDRSLTGSTASFDLVASHPELLPVMDMKMFDFGEDNQQIGYYVNEVCFS 1672          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052948.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001200.1:50842:55553:-1 gene:ENSAMXG00000040953.1 transcript:ENSAMXT00000052948.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 304.679 bits (779), Expect = 5.655e-85
Identity = 323/940 (34.36%), Postives = 377/940 (40.11%), Query Frame = 3
Query: 1236 KGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGP---RGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            KG KG++G +G  G  G  G  G  G  G  G +G RG    RG  G RG  G +G  G  G  G+ G  G RG  G +G  G  G  G  G  G  G  G RG  G RG  G  G  G +G  G +G  G  G  G +GA G                                               G  G  G  G  GA G +G  G  G  G RG  G +G  G  G  G RG  G  G  G  G  G  G  G  G  G  GA G  G  G  G  G  G  G  G  G  G  G  G  G  G+ G+ GA G  G  G  G  G +GA G  G  G  G  G +G  G  G  G  G  G  G  G RG  G +G  G  G  G +G  G  G  G+ G  G  G  G  G  G  G  G RG  G +G  GT G  G RG  G  G +G  G  G RG  G RG+ G  G  G  G  G  G  G+ G  G +G  G  G  G  G  G +G  G RG  G +G  G  G+ G +G  G +G  G  G  G  G  G  G  G +G  G +G+ G  G  G  G+ G+ G  G +G  G  G  G  G  G RG  G  G  G  G  G  G  G +G+ G  G  G  G  G  G  G RG  G  G  G +G +G  G  G +G  G +G  G  G  G  G  G +G  G  G  G  G  G  G  G  G  G  G  G  G  G +G  G  G  G +G  G  G  G  G  G++G +G RG  G  G  G  G  G  G  G  G  G  G  G +G  G  G  G +G  G RG  G RG  G  G  G  G  G  G  G +G  G RG  G  G  G  G+ G  G  G +G  G +G  G  G  G  G  G       +
Sbjct:   27 KGVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTR---------------------------------------------GAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTR 921          

HSP 2 Score: 255.758 bits (652), Expect = 4.726e-69
Identity = 255/744 (34.27%), Postives = 298/744 (40.05%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGP---RGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQ 3443
            G  G +G  G +G +G  G  G  G  G  G  G  G +G RG    RG  G RG  G +G  G  G  G+ G  G RG  G +G  G  G  G  G  G  G  G RG  G RG  G  G  G +G  G +G  G  G  G +GA G  G                                               G  G  G  GA G +G  G  G  G RG  G +G  G  G  G RG  G  G  G  G  G  G  G  G  G  GA G  G  G  G  G  G  G  G  G  G  G  G  G  G+ G+ GA G  G  G  G  G +GA G  G  G  G  G +G  G  G  G  G  G  G  G RG  G +G  G  G  G +G  G  G  G+ G  G  G  G  G  G  G  G RG  G +G  GT G  G RG  G  G +G  G  G RG  G RG+ G  G  G  G  G  G  G+ G  G +G  G  G  G  G  G +G  G RG  G +G  G  G+ G +G  G +G  G  G  G  G  G  G  G +G  G +G+ G  G  G  G+ G+ G  G +G  G  G  G  G  G RG  G  G  G  G  G  G  G +G+ G  G  G  G  G  G  G RG  G  G  G +G +G  G  G +G  G +G  G  G  G  G  G +G  G  G  G  G  G  GR+
Sbjct:  322 GAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRG---------------------------------------------AWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGRR 1020          

HSP 3 Score: 166.777 bits (421), Expect = 4.503e-41
Identity = 173/494 (35.02%), Postives = 208/494 (42.11%), Query Frame = 3
Query: 2565 QRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            Q+G KG  G +G  G  G RG  G RG+ G  G  G  G  G  G  G+ G  G +G  G  G  G  G  G +G  G RG  G +G  G  G+ G +G  G +G  G  G  G  G  G  G  G +G  G +G+ G  G  G  G+ G+ G  G +G  G  G  G  G  G RG  G  G  G  G  G  G  G +G+ G  G  G  G  G  G  G RG  G  G  G +G +G  G  G +G  G +G  G  G  G  G  G +G  G  G  G  G  G  G  G  G  G  G  G  G  G +G  G  G  G +G  G  G  G  G  G++G +G RG  G  G  G  G  G  G  G  G  G  G  G +G  G  G  G +G  G RG  G RG  G  G  G  G  G  G  G +G  G RG  G  G  G  G+ G  G  G +G  G +G  G  G  G  G  G       +
Sbjct:   26 QKGVKGERGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTRGAWGTR 519          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col5a3b (collagen, type V, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-110728-4])

HSP 1 Score: 295.819 bits (756), Expect = 6.466e-81
Identity = 374/1019 (36.70%), Postives = 488/1019 (47.89%), Query Frame = 3
Query: 1821 IGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ---IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGL---------------IGKEGEKGAIGN---PGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKG--ELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI-GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG---EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVG----EVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYM---------GPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGK---PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEP---GLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAV------------LNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIV---FLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKL---HSHY 4685
            +G  GA G KG  G  G +G++G +GE G  G  G  G++G  G+TGP+G  G  G +GPKGQ   +G PG  G +G++G++G PG  G      + G +G  G  G  G IG  G +G  G PG  G+ G                 GK G+KG+ G+   PGP GE G  G QG+VG IG  G SGP G  G+ G  G  G  G QG  G  G  G +GP G  G  G  GE G  G +G PG  GL G  G  G KG+PG+ G  G+ G  GL G  G  G PG  GP GL+GS GP G  G    G  GP G  G++G  G  G  G  G +G  GE  GEKG  G  G  G +GP GL G+ G  G  G  G  G  G  G  G KG+ G PG  GP G QG +G  G  G+ G  G PG+QG   +KGD G+ G  G TG  G++G+ G PG  G  G SG  G  G+ G +GP G    + G  G+PG+ G  G  G KG+ G  GD G  G+PG  G KG +GE+G           G  G  G  G  G+ G  G  GDPGP G  G  G  GAPG  G  G  GK   PG  G+ G  G  G++G  G  G  G  G+ G  G+ GY G  G  G +G QG PG  G  GLPG PG  G +G  G  G  G  G  G  G  G++G  G +G  G  G+ G  G PGE G         ++GD G+PG++G  G  G PG VG  G     G  G+ G +G  G  G  G     D        V RR      D  S  D ++ V        G              +  +F  L  +   V       G+  +P+R+CK+++M + K      +WIDPN G   D+  A C F+  E +TC+  Q  S+ + +     ++ +   W SK +   G     I     +  +V   FL+ L + A Q+    C+ SV + D    +++ A++ R  ND++L   ++HY
Sbjct:  474 VGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPG------YPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQGNPGKAGPQGLPGIPGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFG---------EKGDRGMPGNQGVQGPKGDPGPVGTSGPNGPPGPPGLSGPIGPRGDQGPAGPPGAPD-------GVRRRRHHSEVDGASLVDGEMDVETEVEEDKGMQGDGAAGGAGEKDMEEVFASLASMRTEVEGLRTPQGTYHSPARTCKELWMWNPKLPDV--YWIDPNHGCHRDAFKAFCNFT-AEGETCL--QPHSKYQSVKLAAWNKEKPGTWFSKFR--KGSQFSYIDADGNDVHVVQLGFLKLLSATARQSFTYLCQNSVGWLDGATFSHKRALRFRGSNDQELTHANAHY 1463          

HSP 2 Score: 244.973 bits (624), Expect = 6.106e-65
Identity = 427/1196 (35.70%), Postives = 540/1196 (45.15%), Query Frame = 3
Query:  132 IDILSAVELSKHSFAIQ-QPGICKTKNSKPGYTILSNNKLKINIDQ-----IPMDTNKNSGLPTEFSILLTVRIQQFYTEEIFHIRDLEDEVIFSIKLGENIIIQYKMLGEVKNVIRF--ISKID--DGKWHNVAFGIERSYIKLYVDCKEVETQTWDY-DQKYFSKSGKLIFA-----EKGLISVIESFWIVLGVEAAFKHCEYFTRNCDHPLVKMINEEENYE-----------TSTQXXXXXXXXXXXXXXXXXXXAGANAMHGIPGKPGNRGPPGEIFILP-INLG-----ISSPNALQARFRQSLMEHILLMKGVRGKRGPTGETGSLGYMGEYXXXXXXXXXXXXXXXXXXXIRX-XXXXXXXXXXXXQNGERXXXXXXXXXXXXXXXXHSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSP-------GPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGE--PGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ-RGDKGLLGDFGIMGFPGP---------------RGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGE---IGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQG-SDGDVGRQGMPGSQGSP---GEQGEKGDHGIPGPSGKTGLSGIRGITGR------PGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG---AKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGK 3485
            ID+L  ++LS     +  + G+C    ++PG   L    L   ID+     +P      S  P  FS+L+TVR ++     +  I + +      ++LG + +  Y+      +  ++    KI+  DG+WH +AF +E   + LY+DCK++ T      ++   S  G  +F      E+     I+   I     AA  +C  +  +CD  L+      +  E               P  E GP+G  G  GD G  G     G+ G  G  GPPG + +LP    G     +   +A +A+ +  L    L MKG  G  G  G  G LG  G  GLKGD G+ G  G  G  G+ G         G  GQ G RG PG  G  G+DG  G  G++G  GE G  G  G  G +               G+ G +G  G  G +G  G++G  GL G DG P       GP GE+GL G                          G  GP G  G  G  G  GL G+KG  G+ GE G  GA GE G  G  G  GPVG  G  G  G KG  G  G  G  GI G KG  G  G PG  G  G  G  GF G +   G  G +G KGP G  G+ G RG +G  G  GA G  G  G KG  G  GP G SG+ G  GP G +G+ G +G SG  G  G  G  G  G  G QG  G PGP G+ G  G  GE G +G    RG PG  G  G+ G+ G  G  G +GD G  G  G  GP G +G  G  G  G +GP GLKGS G  G   PG  GE G PG  G +G  G  G  G PG  GE+G+ +G+KG +G  G  G  GP                G  G  G  G +G KG+ G  GP G  G+ G  G  G  G DG  G PG+    G+KG +G RG  G  GP GL G             PG  G  G +G  G IG PG  GPRG QG S G  G  G PG +G P   GE+GE G+ G PGP G  G +G +G  G        G  G+PG  G +G  G KG+ GP+G  G  G PG  G  G  G  G  G  G+ GK G PG  G     G  G +G++GP G  G  G+ GDKG  G    +G  GP+G  GN G+ G  GL G+ GP G+
Sbjct:    4 IDVLKILDLSDRMEGVSLEAGLC---TNRPG---LDEVDLAYKIDKKIQVSVPTKQLFPSEFPENFSVLVTVRPRRGAQCFLLSIYNPDGVQQLGLELGRSPVFLYEDQNGRPSPDQYPIFKKINLADGRWHRLAFSVEGKKVTLYLDCKKLTTLDLPRGEEPKVSTEGVTVFGTRLLDEEVFEGEIQHLIISPDPAAAADYCVNYIPDCDSALLYSSLLLDPEEGPGGPEKGEKGEPAGPPGEAGPMGPPGPRGDPGDLGPAGRQGLAGADGIPGPPGNMLMLPQFQFGGDGQKVPVVSAQEAQAQAILQHAKLSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPGQQGNPGIM--------------QGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLA------------------------GVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAI---GVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGE---RGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQG------------MPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQGNPGKAGPQGLPGIPGPAGE 1137          

HSP 3 Score: 244.973 bits (624), Expect = 6.320e-65
Identity = 316/839 (37.66%), Postives = 386/839 (46.01%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGL-------RGVDGETGP------IGAEGIRGLDGPKGQIGFPGPEGASGKEGE-------------IGPPGFIGDEGKRGFSGEKGDSGPV----GLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGY-----QGEKGSQGPVGEVGILGKPGLGGY----------------QGPRGPKGQTGF------------------EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP---IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRG------------LVGPRGMSGEAGITGKEG---LPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGP------------QGEPGLK---GVKGELGLPGQDG 4013
            +G PG +G  G  GP G  G  G +G  G+ G  G RG  GL GL       +G DG+ GP       G  G+ G+ G KG +G PG  GA G++G              +G PG  G +GK+G  G  G  GP     G  GP G  G  G  G  GP+G  G  G +G  G  G  G +GE GE G  G  G +G  G+ G  G +GM G+ GP GPKG  G +G  G  G  G  G  G  GL G PG+ G  G  GF G +G+ G  G KG PG  G  GQRG  G  G  G  G  G  G  G  G  GP G  GE G  GP G +G +G +G  G  G DG  G PG+ GE G +GK G PG   PSG++G                         +GN G  G  G RG+ GS G  G QG+PG+ G  G +G+ G  G+ G +G TGL G RG  G PG +G PG  G  G       G  G +GP G  G +G+PG  G                 +GP GP GQ G                   +GD+G+ G PG +G+KG KGE G  GP G  GP G PG  G+ GE G PG  G  G  G +G  G  G TGP    G PG  G++G                    G SG +G  G +GPRG  G  G Q  P   GR G+ G+PG  G +G+ GE G  G  GI G+ GE G +G            + G RG SGE G  G  G   L G+ G  G  G +G  G PG  GD G+ G  GPPG  G              G PG +   G+KG+ G PG +G
Sbjct:  315 KGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPGQQGNPGIMQGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPG---PSGVVGP------------------------QGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGES------------------GHSGLIGPPGQFGPRGPQGPSGGQQGP--PGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEG 1106          

HSP 4 Score: 230.335 bits (586), Expect = 2.136e-60
Identity = 311/772 (40.28%), Postives = 382/772 (49.48%), Query Frame = 3
Query: 1896 GEKGPRGITGLTGLRGV-----------------DGETGPI--------------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKG----PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGI------KGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD---------QGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGY---PGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGL---VGPRGMSGEAGITGKEGLPGELGIKGLQGVN-GQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            G+ GP G  GL G  G+                 DG+  P+                    G  G  GL+G  G +G PGP G  G  G  GPPG  G +G  G  G KG           G+ G  G  G PG  G +G+ G +G KG +G+P   GEPG  G QG  GI+   G  GPQG +G+ GD+GP G KG    P  D    G  G  GP G KG  GL G  G +G  G  G  G  GLRG+ G KGE G DG  G +G+ G+ GD G        GP G+RG  GPEG KG+    GPLG  GS GI G +G LG  G  G PG  G KGT G  G  G+      KGP G  G  G +G  G +G  G  G  G +GDKG+ G  G  GP G +G  G  GR G  G +G  G  G+ G  G PG  G+ G  G  G  G  G++G  G +GETG  GE+G  G  G  G  G PG  G +G +G  G TG  G          +G  G PG  G  GLKG  G +G +G PG  G  G  G++G +G PG  G    PG +G +G P   G  GPIG  G+ G+QG +G  G  G  G  G  G  G +G  G +G  G +G PG  G  G  G  G+ G+PG  G  G  G +G  G KG+ G++G KG TG RGL    GP G  GE+G +G  G PG+ G +G QG + GQ+G PG PG RG+      PG VG +GE G  G  G +G+PG +GE G
Sbjct:  255 GDLGPAGRQGLAGADGIPGPPGNMLMLPQFQFGGDGQKVPVVSAQEAQAQAILQHAKLSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHR--------QGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSP---GEPGAPGQQGNPGIM--QGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDT------GPVGMRGEDGPEGPKGQ---SGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSG-PGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP--QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQ------PGGVGEKGEDGESGDPGPVGIPGSNGEKG 995          

HSP 5 Score: 217.624 bits (553), Expect = 1.594e-56
Identity = 275/706 (38.95%), Postives = 332/706 (47.03%), Query Frame = 3
Query: 1968 GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKG----PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPR------------GNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGK--PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKP-GLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            G  G  GL+G  G +G PGP G  G  G  GPPG  G +G  G  G KG           G+ G  G  G PG  G +G+ G +G KG +G+PG   EPG  G QG  GI+   G  GPQG +G+ GD+GP G KG    P  D    G  G  GP G KG  GL G  G +G  G  G  G  GLRG+ G KGE G DG  G +G+ G+ GD G  G      P G+RG  GPEG KG+    GPLG  GS GI G +G LG     GLPG  G +G KG  G PG  G +G  G                       G  G  G+ G +GP             G  G  G  G  G PG  G  G QG +G  G  GP G +G +G  G+ G PG  G PGF G+TG         P G  G++G  G  G  GP G +G  G  G  G+ G+PG  G +G KG+ G  G +G  GP GL   KG  G  G PG +G          PGL G  GP+G   PG  G++G                  P GL+G +G  G  G  G PG +G +G+P G  G IG  G+ G  G  G  G  G  G  G  G+KGETG  G  G +G  GE G  G  G  G  G  G+ GV+G+ G PG  G  G+ G  G  G  G  G  GL+G+ G  G  G+ G  GLI
Sbjct:  316 GPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHR--------QGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPG---EPGAPGQQGNPGIM--QGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTG------PVGMRGEDGPEGPKGQ---SGPLGDPGSSGIAGEKGKLG---VPGLPGYPGRQGPKGTDGFPGAIGVAGEKG---------------------RKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTG---------PPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGL---KGFRGSRGAPGTMG---------PPGLKGSWGPVGSSGPGATGERG------------------PPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLI 936          

HSP 6 Score: 200.675 bits (509), Expect = 2.730e-51
Identity = 321/792 (40.53%), Postives = 388/792 (48.99%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKG---FIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGK---------RGFSGEKGDSGPVGLIGPIGAIGSQG--SHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQG----NLGPDGYIGL---PGEIGEKGTKGKRG------LPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGN---IGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIP------------GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGP------------------KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI 3416
            G +G  G +G KG  GL G  G  GE          G  GF G +G +G++G+ G+ GP G+ G DG  GPKG+ G  G  G  G  G               ++GK+G  G  G  G+ G +G +G  G +G  GEKG KG  G+ G  G  GP G  G  G  G  GK G  G+ G  G PG  G +G +G QG  G IG  G  GP G     G+ G+ G  G QG+ GP G +G+ G +G  GETGP+G  G  G  GP G+ G PG   A+GKEG  G PG  G  GK         RG  G  G  GP GL G  G +GS G  + G  GP GL G IG+ G  G  G PGP GE GE   QG+ G IG  G  G QG +G+ G  GP GP G  GD      +GE G  G KGS G +GEPG  G +G  G  G  G+ G+ G+ G PG  G  GQ+GD+GL       GF G  GP GL+G  GP G KGE G+ G +G  G  G RG QG      GP G  G+   PG +GEKG  G+ G      +PG  G  G  G  G+ G  G  G PG  G  G +G KGN   IGL G  GP G  G+DG  G  G  G  G PG+ G  G  G P            GP GK G  G++G  G PG  GL G +G  G QG  G  GP G  GI   PG  G QG  GP                  KG  G +GD+G  G+ G  G  G  GE+G           G+PG++G+ G  GDPGP+
Sbjct:  472 GPVGYPGARGVKGADGLRGIKGSKGE---------KGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAG---------------EKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPG---AAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEP--QGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGD------KGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGL------RGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQGNPGKAGPQGLPGI---PGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFGEKGD---------RGMPGNQGVQGPKGDPGPV 1210          

HSP 7 Score: 187.193 bits (474), Expect = 3.538e-47
Identity = 298/804 (37.06%), Postives = 369/804 (45.90%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPM------GYFGFRGPRGN------IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFS--GEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL------------QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR---------GLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLK---------GEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKV 3497
            +G +G +GE G +GP G  G +G  G  G  G  G +      GY G +GP+G       IG+ G  G +GPPG  G  G  GP G RG  G +G  G  G  G  G +GPPG  G+RG  GP+G  GEIG  G  G  G  GL G  G++G  G                                                    QG+ G  G +G +GP+G  G  G  G RG  G  GP G  GL G  G +G  G  G+ G+ G +GP G  GF    G+ G  G +GPPG  G  G  G S  G  G+ GP GL G IG  G  G+ G PGP+G +G    +GEKG IG  G  GE G +GL             G  G  G  G  G +GD G  G  GP G +GP+G  G  G+ GE GP G +G        GQ G+ G  GF G  G RGL   +G PG  GE+G+ G  GL+G  G  G  GP+GP+G        G +G  G  G  G  G VG +G  G  G  G +G+PG  GEKG +G++         G+PG +G SG  G+                      G+ G IGL G  GP G  G+D         G  G+PG +G+ G+ G  GP G +G  G  G  GR G LG PG  G+ G +G+KG+    G  G+LGK       GP G +G  G  G QG  G+PGP G +GL          G  G  G  G  G HG  GDKG  G +G  GP G  G  G +G PG  GV GP G PG V
Sbjct:  519 TGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGF---------------------------------------------------QGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGF---RGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGE--PQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMY------GQKGDEGLRGFKGATGPRGL---QGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSG--------GQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGA---------------------KGNSGPIGLTGDPGPPGEAGTD---------GIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGA---PGYEGLLGK------TGPVGGQGNPGKAGPQGLPGIPGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFGEKGDRGMPGNQGVQGPKGDPGPV 1210          

HSP 8 Score: 132.494 bits (332), Expect = 1.992e-30
Identity = 234/674 (34.72%), Postives = 287/674 (42.58%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGL------DGPKGQIGFPGPEGASGKEGEIGPPGFIGD---EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS---VGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSD---------------------GDVGRQG------MPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGIL 3119
            H G  G  G +G+ GP                            GP G +G +GN GE GP G  GH GS GP GE+GL                            G  G  G +G+ G  GV G NG  GL G  G +G  G +G  G  G  GP G  G                                   GE G  G  GA+G  G  G  G  G  G +GE  P+G  G  G  G DGE GP+G  G  G       DG KG+ G PG +G+ G +GE GP G  G    EG+ G  G  G+SGP          G QG +G  G  GL+G  G  G +G  G PGP GE GE G  G +G  G+ G  GPQG  G  G +GP G  G +G  G +G +GE G SG  G +G+ G  G+ G+ G  G  G  G  G+PG +G   T GE+G +G+ G +G  G  G PG  G  G+ G+ G +G  GE G  GP G  G     G  G +G+LGP G  G PG  G+KG  G  GL G  GP G  G                     + G  G  GLPG+ GP G QG +                     GD GR+G      + G  G PGE GEKGD G+P      G  G++G  G PG +
Sbjct:  665 HPGQRGEPGFQGKTGP---------------------------PGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLP---------------------------GAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGA-------------------------------TGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGE--PQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPP---------GQQGMYGQKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSG--GQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARG---TSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQG---------------------NPGKAGPQGLPGIPGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFGEKGDRGMP------GNQGVQGPKGDPGPV 1210          

HSP 9 Score: 57.3806 bits (137), Expect = 1.629e-7
Identity = 106/337 (31.45%), Postives = 134/337 (39.76%), Query Frame = 3
Query: 3231 PRGPK------------------GQTGFEGDQGKFGVPGPQG---------------------------------AK-GLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLV----------GVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLV-------GRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKI 4034
            P GP                   G  G +G  G  G+PGP G                                 AK  +KG  G +G NG PGP G PG  G+ G+ G PGP   PG+ G  G PGL           G  GP G+PG+ G +                     G+ G  GS+G  G  G PG  G QG PG++       G +GLPG                      +G +G+ G+RGL G  G     G  G+EG PGE G+ GL GV G  G PG  G +G  G  G  G  G +GE G  G KGE+G+ G  G+ G + +
Sbjct:  235 PAGPPGEAGPMGPPGPRGDPGDLGPAGRQGLAGADGIPGPPGNMLMLPQFQFGGDGQKVPVVSAQEAQAQAILQHAKLSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGP---PGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGR---------------------GVDGVQGSKGNLGSPGEPGAPGQQGNPGIMQGFPGPQGLVGLPGD---------------------KGPQGKKGMRGLPGTDGPP--QGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGM 524          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col27a1b (collagen, type XXVII, alpha 1b [Source:NCBI gene;Acc:560145])

HSP 1 Score: 261.536 bits (667), Expect = 1.709e-72
Identity = 309/919 (33.62%), Postives = 421/919 (45.81%), Query Frame = 3
Query: 2265 GEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGL---------LGDFGIMGFPGPRGPTGLRGSSGPEG--IKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPG---IKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPG----------------------EQGEKGDHG-IPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY---PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRK--NYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            GE+GL G+ G  G  G+ G QG  GM G RG  GP+G  GDIG     G+ GP G KG  G+ G  G +GE G  GF G +G  GL G+KG PGT GE G+ G +G+          G+ G  GFPG +GP+G  G+ G  G  I+GE G+DG  G  G  G +G +G+LG +G  G  GEIG KG +G  G PG   ++GP G  G  G +G  G +G  G  G +G  G+ G++G  G  GP+GN+G+ G V   G  G QG PG                      +QGE+GD G I GP+G  G  G  G  G  G  G PG+ G+ G  G++G     G  G+ G PG  G QGP+G KG    +G +GK GVPG  G++G  G  G  GP G     GP GLPG  G+SG+ G  G  G  GN G  G PG  G  G  G PG  G QG  G               P G  G  G  G  G RG+PG +G QGK G  G  G PG P                     G +G  GI G+ GP+G             PG+ G  G+QG  G +G  G  G  G +G IGP G  GPQG+   KG +GE G PG  G  G  K  ++    +Q +         DM      D+ ++             +F  L  L  L+      LG++ENP+R C+D+ ++  + +  G +WIDPN+G  SD++   C F+    +TC+        +PL                       T+ K+       Q+ F+  L S+A Q I + C    V+  +  +  +  ++++ + +N + +          +AG  +    +KD+C          Q   + +D   LPI+D+       P          VCFS
Sbjct:   24 GEVGLPGEPGEPGFQGDKGIQGLPGMPGIRGRPGPQGFPGDIGP---PGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGK---AGAPGLPGNPGPRGTQGPKGSKGD---QGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFG---------------PKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDP---------------------GEQGFPGILGIFGPKGP------------PGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGD---KGNRGETGPPGPRGPQGPPKNGELGA-AFQVIFDSYSALRSDM------DLPMLDQGT--------EIFKTLHYLSNLIYSIKNPLGTQENPARMCRDL-LDCEQRMNDGTYWIDPNLGCSSDTIEVTCNFTGGG-QTCL--------RPL-----------------------TVSKLEMGVGLIQMNFIHLLSSEAVQLITIHCLNVPVWATAASRPPSASNSVRFKTWNGQMI----------QAGGLIQPDLVKDECWMTDGRWHQTQFQFVTQDPNLLPIVDVLNLPITKPGSNYHLEVGPVCFS 824          

HSP 2 Score: 181.03 bits (458), Expect = 4.766e-46
Identity = 226/597 (37.86%), Postives = 277/597 (46.40%), Query Frame = 3
Query: 1848 KGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETG---PIGAEGIRGLDGPKGQ------IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS----------VGIRGHQGNLGPDGYI----GLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP---------------------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            +G +G  G+ G  G QG+KG +G+ G+ G+RG  G  G    IG  G  G +GPKG+      +G  G  G  G  G +G  G +G++G  G  GE+G+ GP G+      IG  G  GA G  G+QG  G  G KG  G P          +QG+ G  G  G SGP G  G  GD G  G  G +G+IG  G +G  G  GL G  G  G+PG+IGE G P               GE G+ G +G  G  G +GD G +GFPGP+G  G  G   P G  G  G+ G  G+ G                 QG  G DG I    G PG+IG  G +G RG  G  G  G +G                    G  G  G  GLPG  GPRG QG  G  G QG  G +G P                     G +G +G  G+ G SGK G  GI G  G  G +GLPG SG  G  G  G +G  G  G  G+ GL G  GP G +G  G  G+QGK G  G +G  G  GEQG+ G  G  GP G PGD G SG  G  GP G    +GR+G  G VG+ GP G PG  G +
Sbjct:   23 EGEVGLPGEPGEPGFQGDKGIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEP----------IQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKP---------------GEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGV------------------DGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQGL---MGREGTIGPVGIIGPSGYPGPQGDK 573          

HSP 3 Score: 178.333 bits (451), Expect = 3.651e-45
Identity = 223/604 (36.92%), Postives = 277/604 (45.86%), Query Frame = 3
Query: 2028 EGASGKEGEIGPPGFIGDEGKRGFSGE---KGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQ---------GDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPG--------------------------IKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGI---------------RGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPG 3680
            EG  G  GE G PGF GD+G +G  G    +G  GP G  G IG  G  G  G  G  G+ G +G  GE+G +G  GP GE G +G +G  G  G  G  GPQ         G+ G  G RG  G +GP G  G  G+ GE     ++G  G  GE G+ G  G  G  G LG  G  G+KGE G  G+EG  GD GL+G  G  G PG  G  G  G  G +G +G LG  G +G +G VG  G +GN G  G++  PG++G +G  G  G  G                          I+GP+G  G                +G +GH GD+G  G PG  G  G  G  G  G  G+PG+ G  G QG KG  G  GP GK G+ G                +G+ GR G  GLPG  G +G  G KG     GE G  G+ GL G  GP G  G  G  G QG F   GP+G +GL GE G +      G  G+PG  G  G+ GD G  G PG+ G QG PG++G+ GP G PG  G                             G QG  GP+G+ G+ GT G  G++G  G PG
Sbjct:   23 EGEVGLPGEPGEPGFQGDKGIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEP----IQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGD---------------IGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGI---AGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSF---GPKGERGLAGETGPI------GKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPS---------------------------GIQGPKGPQGLMGREGTIGPVGIIGPSGYPG 568          

HSP 4 Score: 170.629 bits (431), Expect = 9.707e-43
Identity = 211/557 (37.88%), Postives = 272/557 (48.83%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGL---RGVDGETGPIGAEGI------------RGLDGPK---------GQIGFPGPEGASGKEGEIGPPGFIG-----DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPA---GPKGPQGDI------GKIGLQGEIGPSGLKG----------------SMGLRGEPGQI-GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELG---------------NDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGI---TGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQT 3254
            QG PG  G  G  GP+GF G +G  G  G +G KG  GI G  G+   RG+ G  GP+G  G+            RG  GP+         G+ G PG  G  G +G  GPPG  G      +G+ G  GE G SGP G  G  G +G++G HG  G IGL+G  G  G+ G +G  GP G+PG+IG +G+ G  G  G+ G  G  G  GD GP    GPKG +G I      GK+G+QG+ G SG +G                  G +G+ G+I G +G PG  G +G RG  G+ G+PG  G+ G  G +G  G  G+ G PGPRG  G +GS G +G KG+ G                 GP G +G  G  G  G  G  G  G  G  GE+G  G+ GLPG  GP G  G P                     G +G+ G  G +G RG  G  G +G++G+PG  G+ G+QG+ G  G PG  G+ G  GI GI    G PG  G  G  G  G QG  G +G +G VGI+G  G  G QG +G +G+T
Sbjct:   44 QGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPP---------------------GLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRGET 579          

HSP 5 Score: 142.895 bits (359), Expect = 5.294e-34
Identity = 227/665 (34.14%), Postives = 282/665 (42.41%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMG---HDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPG--GIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRG--VDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------PGEIGLQGQVGIIGRDGNS-------------GPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRG------------------DKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEV 3191
            G +G  G  G+RG  G QG PG +G    +G  GPKGE G+                                  G  G +G+ G+ G  G  G  G +GEKGH G  GE                                                +GEPG  GI  + A+     IG  G+ GARG  G +GP G  G  G+ G  + GE G  G  G  G DG KG+ G  G EG  G++GEI   G  G EG  G  G  G  GP G  G IG  G  G  G+ G  G  G+ G+ G+ G +G PGP+G          PG++G+QG  G+ G +G+                QG+ G DG     GP GP GDIG +G +G+ G SG  G  G  G  GQ G++G PG  G  G RG  G KG  G  G +G++G                   KG++G  G  G P   G  GL G  GP+GI GE GND      G VG+ G+ G  G  G  GL G  G  G KG+RGL G  GP G                          G  G +G  G QG  G +G  GD G QG PG  G  G +G  GD    GPSG  G  G +G+ GR G +G  G  G +GY G +G +G  GE 
Sbjct:   42 GIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIM---------------------------------GNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGE------------------------------------------------RGEPGPQGIPVSSAV-----IGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEI---GLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKI--EGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLP---GMDGLSGKDGPKGIAGEQGND------GEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIG------------------------KRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDF---GPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRGET 579          

HSP 6 Score: 139.813 bits (351), Expect = 5.013e-33
Identity = 222/636 (34.91%), Postives = 278/636 (43.71%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRG---GQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIG--------------------------LQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG 3050
            G  G +G+ GP G  GDIG            P G  G  GP+G  G+ GN G  G  GL+G  G   P GE GL G +G  G PG               +RG+ GP+G       IG+ G  G  G  G+ G  G  G KG  GE                                                QGEPG  G  G  GP G  G  G  GA G  GEKG     GL G  G  G+ G +G  G  G  G  G+ G PG +G+ G +G +G  G +GD G  GF G KG+ G +G + P G +G QG  G  G  G                          ++G  G  G+ G +G+ G RGE G+ G  GQ+G+ G+ G +G  G  G  G RG  GPKG +GD G  G +G  G SG +GS G  G  G  G  G  G  GL G+ GL G  G  G  GE+G  G+ GL G+ G  G  GP G  G +GS GP+G +G  G  GP+G  G  G  G+QG  G  G  G PG+ GE+G  G  G+ G KGP                            GD G  G+ G +GP+G  G +G +G  G+ G  G PG QG+KG+ G
Sbjct:   48 GMPGIRGRPGPQGFPGDIG------------PPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIG---PVGETGLLGEKGHPGTPG---------------ERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPI----------------------------------------------QGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKG---EIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPP---------------------------GDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRG 577          

HSP 7 Score: 117.472 bits (293), Expect = 4.569e-26
Identity = 182/546 (33.33%), Postives = 230/546 (42.12%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGL------IGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGE--QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGF---------IGYVGKEGARGVQGEKGPRGITGLTG-----------------------LRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSG---EKGDSGPVGLIG------------------PIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQR---GDKGLLGDFGIM---GFPGPRGPTGLRGSS 2651
              GH G  GE+G+ GP G+      IG+ G+ G           G+ G +GP G  G +G  GE  QG PG  G  G  GP G +G                 G  G  G  G++G+IG +G +G  G PG+ G+ G +G  G +GE+G  G  G  G                                              QG  G  G  G LGP GF         IG+V   G  G+QG+ G  G  G  G                       + G  G  G IG  G RG  G  G  G+PG  G  G+ G+ G PG  G+ G RG  G    KGD GP G  G                  P G +G +G  G PG   + GL GK+G KG  G  G  GE G  G  G  G  G  G  G QG  G  G+RG AG  GP   IGK G+ G +G  G +G  G++G+PG  GE GFPG  G+ G +G PGD G  G  G +G +   G +G +G  GI+   G+PGP+G  G RG +
Sbjct:  109 EKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGA---------RGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKG---------------EKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKG---------------------------------------------HQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPG---MDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGP---IGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGYPGPQGDKGNRGET 579          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 249.21 bits (635), Expect = 2.399e-66
Identity = 332/1041 (31.89%), Postives = 447/1041 (42.94%), Query Frame = 3
Query: 1821 IGNTGALGPKGFIGYVGKEGARGVQGEKG-----------PRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIG---PIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFP----------GFYGLLGLRGLPGD---------KGEPGTDGEEGQRG-------DKGLLGDFGIMGFPGPRGPTGLRGS---------SGPEGIKGELGNDGPLGFIGSVGIRGHQGNL----GPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLP---GLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG--ILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPK------------GQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLV---GRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNES---------EWWL--------SKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKL 4673
             GN G  G +G  G  GK G  G  G KG           P G  GL G +G  G  G  G  G  G++G  G IG  G  G SG +GE+G PG  G  G  G  G+ G+ GP G  G   P G  G QG+ G+PGP+G++G+ G+ G    +G  GPRG+PG  G  G++G+ G  G  G QG  G  G  G  GP+G  G+ G+IG  G  G  G+KG  G +G+ G IG  G P             G+ G  G PGD         KG PG  G+EG  G       DKGL G  G  G PG +G  G  GS          GP G KG  G  GP G  GS G++G +G++    GP G  G  G+ G  G KG  G PG +G SG  G               I G+ G+ GD G  GLP   GLQG  GNQG+ G  G  G PG+ G PG  G++G  G+ G  G  GL G +G+ G PG  + G PG  G  G +GE G   P  EVG+ G  GL G  G  G +            G  G  G QG  G PGP+G KGL G  G  G  G+P P G  G++G+ GE G  GP G+PG+IG +G PG  G++G  G  G  G                      +GL G  G QG  GP G  G  G  G PG     G++ +P K                    + G +G  G  G+ GP G+ GE+G  G  G  G LG +G +G+ G  G PG PG RG +G++G PG +G +G  G  G  G  G+PG+    G + +   Q       P  + +   D  S    +     +N              L +    + ++N       NP   C   Y   N       +W+       + +        E+EIK  I   +      +   + SQ+ +           W+        +   +  G++L        + +     E +  A+ T      K+  +  S  + +++  +       +L
Sbjct:  428 FGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDG---------------IEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGV--PSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGM---------------------MGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVK--------------------VPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYLLVKHSQSDQTPMCPVGMSK-LWDGYSLLYFEGQEKAHN------------QDLGLAGSCLPRFNTMPFLYCNPGDLC--YYASRNDK----SYWLS------TTAPIPMMPVEEEEIKPYISRCSVCEAPSVAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRTTPFIECNG-AKGTCHYFANKNSFWLTSINQPFQTTPESETLKAGQL 1384          

HSP 2 Score: 228.024 bits (580), Expect = 9.608e-60
Identity = 313/794 (39.42%), Postives = 384/794 (48.36%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGK-----EGARGVQGEKGPRGITGLTGLRGVDGETGPI--GAEGIRGLDGPKGQIGFPGPEGASGKEGEI------------GPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQ---------GNLGPDGYIGLPGEIGEKGTKGKRGLPGI---KGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPG----------LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGP--RGIPGKIGTQG----------KPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDG 4013
            D G PG  G TG  GP G  G  G      EG  G  GEKG  G  GL GL G  G TG +    +GIRG  G  G  G+ G +G  G  G              GP G+ G  G++G  GE+GD G  G  GP G  G +G  G PG  G +G+ G  G+ G  G+PG +G  GE  L    G +G  G  G QGD G  GDRG +G  G +G  G IG +GE GPSGL+G +   G+PG  G  G+PG  G  G  G PG  GE G  GE G +G+ G  G  G+ G  G  G     G +GP G  G  G  G +G  G  G+RG Q         GNLGP+G+ G  GEIG  G +G++G+ G    KG SGL+G PG      +      +  I   GD GN G PG  GPRG +G  G  G++G  G  G P       D G+ G +G  GL G +G+ G  G  G+PGF G  G +GEKGS G  G  G  G  G          L G  GPRG  G +G  G +G  G PG +G  G  G +G  G  G PG  GLPG +G+          G+PGN G +G  G+ G  G  G+PG  G++G  G +G  G           GL G  G QG  GP   G PG  G +G          + G+ G  GL G  G  G +G  G+ G+ G  G  G  G  G  G  GPRG  G  G  G  GLPG     G KG QGV+G+ G  G  G  G IG  G PG+ G  G  G KG +G +GLPG+ G
Sbjct:  285 DSGRPGEPGETGRTGPSGTDGAPGLHGPPGEGPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEA-LGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGEL---GKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGI--KGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPST-----DKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQ---------GFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLD---------GLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPG 1049          

HSP 3 Score: 224.172 bits (570), Expect = 1.577e-58
Identity = 329/837 (39.31%), Postives = 405/837 (48.39%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFG---FRGPRGNIGMRGNTGEQGPPGLMGHDG-----SPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXX---DRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGP-------------------------------IGAIGSQGSHGAPGPIGLQGLIGK-------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI-------GLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLP----GIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQT------GFEGDQGKF----------GVPGPQGAKGLKGEQGYMGPNGYPGPHGL---PGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGK 3503
            G  G  GQ+G  G  GD G+ G+ G  G  GP G FG    +G RG  G+ G  G+ G PGL G DG     SPGP G+ GL G QG  G  G  G  G  G  GMPG    +G+ GP G QGE+GKPG  G+ G  GL G  G  G  G  GE+                                             G +GE G  GNTG+ GP G  G  G+ G+    G+ GPRG  G  G  G  G  G  G  G +G+ G +G  G  GPEG SG++GEIG  G  G++G +G  GEKGDS   GLIGP                                G  G++G  G PG  G  GL G+       EG  GA G PG +G PG  G QG  G  G DG  G +G  G  G  G  G KG +GD G +       G +GE G SG  G  G  GEPG  G SGF G  G+ G  G PG +G PG +G +G  G++G  G  GI G PG  G  G  G  G  G+KG  G D      G  G +G QG  GPD + G PG+ G KG KG+ G+P    G+ G  GL GS G+ G+QG  GQPG+ G  G +G  G  G  G  GPRG +G  G  G  G+PG     G +GE+G H      G+TG +G +G    PG +G  G  G+ G  G KGS+G  G +G+ GKPG  G +GP GPKG +      G  G QGK           G+PGP G +G +G +G  GP G PG  G     G KG+ G  G PG  G+ G++G  G PGL+G+ GP G+PG  G+
Sbjct:  393 GYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEE---------------------------------------------GPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDS---GLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLD------GLKGQKGLQGLPGPDVW-GTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVH------GETGFTGPKGF---PGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGR 1165          

HSP 4 Score: 184.496 bits (467), Expect = 2.668e-46
Identity = 292/849 (34.39%), Postives = 378/849 (44.52%), Query Frame = 3
Query: 1875 EGARGVQ-----------------GEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQI---GFPGPEGASGKEGE----------IGPPGFIGDEGKRGFSGEKGDSG------------------------PVGLIGPIGAIGS--QGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------------------------PGEIGLQGQVGIIGRDGNSGPQGDIGMDG-----DRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSM-----GLRGEPGQIGESGFPGFYGLLGL------------RGLPGDKGEPGTDGEEGQRGDKG---LLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQ--GNLGPDGYIGLPGEIGE---KGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSP------GEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLP----------GDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGET-GIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            +GA G +                 G+ GPRG  G  G  G  G+    G  G RG DGP+G        GP+G  G +GE           GPPGF G  G  G  GEKG                            +G  G    I S   G  G PGP G  G+ G+ G++G  G+PGPRGE                           PG+ G  G+ G  G  G +GP G  G  G       GP G  G +G  G+ GL G  GPSG+ G +     G+RG PG  G SG+ G  GL G+             G+PG KG  G  G++G +G++G     G  G  GF GPRG  G  G  G  G+ G  G  G  G  G  G  G     + GP G  GLPG+ G+    G +GK G PG++G  G++G+                        KG  G  GLQG  G  G  G  G  G+PG  G+P      GE+G +G+ G  G +G  G  G++G+TG PG    LG  G  G+ G+ G  G  G  G  G+ G  G+ G+QG  G  G  GF G++G+ G  G +G KG+KG QG  G +G  GP G P            KGI G+ G+PG  G+ G  G +G PG+ G  G  G PG+                         GL G+ G++G  G +G+PG  G+QG PG  G  G  G+    G  G  G  G  G  G++G+KG+   + G  GPRG SG++G +G +G  GE G +G  G +G  G  G PGD G+ G    PG  G QG PG +G KG  G+PG  G PG
Sbjct:   71 QGAAGEKGDRGRGGTTGPKGSGHPGQAGPRGKPGADGCNGTHGDA---GTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGEGPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGT------------------------KGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDK--------------------GLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGE---KGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGL---PGGEGLQGFPGNQGTKGWAGIPGTPGTPG 866          

HSP 5 Score: 169.859 bits (429), Expect = 7.252e-42
Identity = 283/749 (37.78%), Postives = 337/749 (44.99%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXX---------XXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPG---------PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGE-------KGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD----EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQ--IGESGFPGFYGLLGLRGLPGDK-GEPGTDGEEGQRGD------------------KGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPG---LQGPRGNQGSDGDVGRQG----------MPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK 3278
            G  G  G KG+ GP GL G++GK G  G         Q G  GP G+ G  GPRG  G +GNTG  GP G+ G  G PG         P+G+ G  GF G +G PG  G  G +G  G  G  G +GP G  GE G+ G  G+ G KG+ G  GEKG  G IG  G    +                KK + G  G               D G PG  G TG  G KG+ G  G+EG  G+ GE       +G  G  GL G +G+ G TG  G  G  G+DGP+G+ G PG  G SG  G  G  G  GD     G  G  GE GDSGP G          +G  G PG  G  G  G EG KG  G+PG +G PG  GLQG        GN G +G  G+ G  G  G  G  G  G  GL+G  G  GLKG  GL+G PG    G  G PG  G  G  G+P  + G PG+DG +G  GD                   G+ G  G  G PGPRG  GL G  GP G+ G      P G  G  G+ G  G  GP G+   PG+IGEKG  G+ G+ G KG                             GD+G +GLPG    QG RG  G  GD G  G          +P     PGE+G  G +GI GP G  G SG  G  G  G LG  G  G  G  G  G+ G  G+VG +G PGL G +GP G  G +G  G  G+
Sbjct:  497 GMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHM-----------KKTMKGIKG---------------DHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSG---------HKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQG------FPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPG---FPSPFGSKGEQGVHGETGFTGPKGF---PGDIGEKGLPGQPGISGRKG---------------------------SKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGR 1171          

HSP 6 Score: 167.162 bits (422), Expect = 4.705e-41
Identity = 264/698 (37.82%), Postives = 318/698 (45.56%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGE-------KGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD----EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS--GLKGSMGLRGEPGQIG----ESGFPGFYGLLGLRGLPGDK------------GEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGD-------KGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGIL 3200
            H+G  G +GE G +G  G  G +G  G  G+ G    +G     GPRG+ G  G TG  G PGL G  GS G  G +G+                            G +GP G  GE G+ G  G+ G KG+ G  GEKG  G IG                P       KK                +KGIKGD G PG  G TG  G KG+ G  G+EG  G+ GE       +G  G  GL G +G+ G TG  G  G  G+DGP+G+ G PG  G SG  G  G  G  GD     G  G  GE GDSGP G  G  G  G +G  G  G  G++G  G  G++G  G  G +G PG  G +G  GI G  G  G  G  G  G  G  G  G  G  G+ GLQG  GP   G  G  G++G  G+IG    E G PG  GL G  G  GD+            G  G  G +G  GD G  G  G+ GFP   GPTGL G   P G KGE G  G  GF G    +G  G++G  G  G PG  G KG+KG +G+ G+ G  G  G  G  G +G  G PG+ G  G  G         G  GLPG  G RG +G  G+ G  G PG+QG  G +G+KG  G+PG  G  G  G  G  G PG+LGL G +G  G  G  G  G    VG L
Sbjct:  543 HTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQ---TGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMP---------------------------GNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPP-----------GEPPVIKMDHMKK---------------TMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFP---GPTGLPGFPSPFGSKGEQGVHGETGFTGP---KGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYL 1178          

HSP 7 Score: 144.05 bits (362), Expect = 6.283e-34
Identity = 235/694 (33.86%), Postives = 295/694 (42.51%), Query Frame = 3
Query: 2226 KGAIGNPGPRGEPGEIGL---QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI-GPSGLKGSMGLRGEPGQIGESG-------FPGFYGLLGLR-------------------------GLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFP------------------GPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---LGLPGFSGETGYQGEKGSQGPVGEV-----GILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQ---GYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGL---VGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGD----------------RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGM 4055
             G  G  GPRG+PG  G     G  G  G+ G  GP+G+   +   GP G KG +G+ G  G      GP G  G  G  G PG+ G          +  ++  L                            GLPG  G+PG  GE GQ+GD+G  G  G  G P                     GP G +G SG  G  GE G  GP G  G+ G+ G  G        G  GE GEKG  G+ GLPG+ GPSG+ G                     ++G++G  G+PG         S G  G +G  G  G  G +GE+GD G  G  G  G +G RG  G PG+    G+PG  G+ G  G+ G +G  GE      G LG  GL G QG  GP G  G  G  G  G+PG  G KG  G  G  G  G PGP G+ G  G+ G+ G+PGP   PG+ G +G  G  G  G  G PG +G +                     G++G  GS    G  GPRG PG       PG  GRIGLPG                    G++G++G TG +G+   +GP G SGE G  G  G+ GE GIKG QG  G  G  G PG+                +G  G+ G PG  GP+G  G  GV G+ G  G  GEP   K ++   G 
Sbjct:   91 SGHPGQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGE-------GPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSG-YDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGP---PGHTGEEGPRGESGDQGNTGSPGPMGVK---------------------GVTGEPGSDAGLGQTGPRGDPGH------PGFTGRIGLPG------------------LKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGA 728          

HSP 8 Score: 134.42 bits (337), Expect = 5.721e-31
Identity = 252/762 (33.07%), Postives = 291/762 (38.19%), Query Frame = 3
Query: 2271 IGLQGQVGI--------------IGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQG------EIGPSGLKGSMGLRGEPGQIGES------------------------GFPGFYGLLGLRGLPGD---------------------KGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGL---------------------------RGSSGPEGIKGELGNDGPLGFIGSVGIR--------GHQGNLGPDGYIGLPGEIGEKGT--------KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSD---------------GDVGRQGMPGSQGSPGEQGEKGDH-----------------------------GIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFE------GDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKE---GLPGE----------------LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELG----LPGQDG 4013
             GLQG  G                G  G +GP+G  G DG  G  G  G  G  G  G +G      + GP G KGS G RG PG    S                         F  F  L     L  D                      G+PG  G  G  G  G  G  G  G PGPRG +GL                           +G SG  G  GE G  GP G  G+ G+         G  G  G  G  GLPG  G  G         KG RG PG  GPSG  G+ G  G  G          +G  G KG  GL G QG +G QG                 G+ G  G+ G +G PG  G+ G H                             G PGP+G  G SG  G+ G PG++G  G +G +G QGE G  GP    GI G PGL G  G  GP G TG E      GDQG  G PGP G KG+ GE G     G  GP G PG  G +G +G P         G +G  G  G+TG  G PG +G                     P G SG  G  G+ G RG  G  G QG+ G  G IG PG+P        K +   K   GI+G+ G  G  G  GPRG  G  G+ G+E   GLPGE                 G KG+ G  G +G PG PG  G  G  G PG  GP G  G KGVKG+ G    LPG  G
Sbjct:   68 PGLQGAAGEKGDRGRGGTTGPKGSGHPGQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGEGPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGP---AGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLP---------GLKGVRGSQGMTGFQGMPGNLG---------------------PEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEP-----PVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTG 791          

HSP 9 Score: 97.4413 bits (241), Expect = 1.012e-19
Identity = 187/549 (34.06%), Postives = 228/549 (41.53%), Query Frame = 3
Query: 2541 PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPG---EQGEKGDHGIPGPSGKTGLSGI---------RGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPG---------LVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGK-----------------PGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPR 4073
            P   G  GQ G +G  G  G  G  G  G  G RG  GP G       DGP GF GS G RG     GP      PG  G  G  G  G PG KG   +        +   Q    I   +   GD G            +  S    G+ G+PG  G PG   E G++GD G PGP G++GL  +           +T      G PG  G++G  GE G  G  G  G  G PGL G  G  GP G+ G +G  G+ G+PG  G  G+ G+             G P  KGI G  GDPGP GY GN G  G PG          +GV GP G  G  G+QG  G +G +G  G  G  G  G  G  G+ G  G RG+PG  G  G+                 PG +G  GLPG+                     QG+ G  G RG  G  GM G  G+ G +G  G  G++G  G  G  G  G PG  G+ G+ GPPG  G +G  G  G +G  G PG  G  G+        G+ Q  PR
Sbjct:   88 PKGSGHPGQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERG-----GPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQC----------DCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPG-EGPVGEPGEKGYPGRPGLPGLAGPSGVTGQV-----------FGAP--KGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQ---------------------QGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPR 586          

HSP 10 Score: 97.0561 bits (240), Expect = 1.419e-19
Identity = 196/615 (31.87%), Postives = 251/615 (40.81%), Query Frame = 3
Query: 2640 RGS-----SGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGI----------------------KGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNI--------GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQ---------------------------GEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP-----GFSGETGYQGEKGSQGPVGEVGILGK-----PGLGGYQGPRGPKGQTGFEGDQG---------------KFGVPGPQGAKGLKGEQGYMGPNG------------YPGP------------------------HGLPGDKGISGEV--GDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGL---------------VGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK---GVKGELGLPGQDGEPGLIKIIDIQVGM 4055
            +GS     +GP G  G  G +G  G  G+ G RG+ G  G        G  G KG+KG+RG PG                       KG   +        +   Q    I   +   GD G          G PGL GP G+ G  G+ G+QG  G  G  GE                            G++GD G PG  G+TG +G  G  G PG+ G P     G  GE GY G  G  G  G  G+ G+      G+ G+ G  GP   +G++G+QG                 GVPGP+G  GL G+QG  G  G            + GP                        HG PG KG  GE     PGP+G  G  G+QG PG  G  G  G PG                          G+ G +G++G  GP G+ G++G  G  G+ G  GLPG+ G  G  G  GE+G +GESG QGN G  G  G+                GPRG  G  G TG+ GLPG  G++G QG+ G +G PG  G  G  G  G  G  G +GE G+K   G KG+ GL G  GEP +IK+  ++  M
Sbjct:   89 KGSGHPGQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGEGPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGP---SGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGME------------------------GMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTM 676          

HSP 11 Score: 64.6994 bits (156), Expect = 1.048e-9
Identity = 98/252 (38.89%), Postives = 117/252 (46.43%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGS-------QGSHGAPGPIGLQGLIGKEGEKGAIGNPG------PRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG 2519
             G PG  G +G  GP+G  G  G  G  G+ G   P G  G  G+ G  G TGP G  G  G  G  GQ G  G +G+ G +G +G PG  G +G RG +G KGDSGP GL G  GA G         G  G PGP G++G  G  GE G IG PG      P G+ G  GL G  G  G  G+ G  G  G+ G  GPAG  G  G  G  G    +G   +K S   +     +G S     Y LL   G
Sbjct:  958 HGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYLLVKHSQSDQTPMCPVGMSKLWDGYSLLYFEG 1209          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 248.054 bits (632), Expect = 6.708e-66
Identity = 357/1098 (32.51%), Postives = 458/1098 (41.71%), Query Frame = 3
Query: 1950 GETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLK------GSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGE------------EGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIG------LPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGL---PGFSGETGYQGEKGS---------------------QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG------------AKGLKGEQGYMGPNGYPG------------PHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIG---------SIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQ-----------------------------FVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCI-PAQASSRGKPLTRFLKSQNESE----WWLSKLKD--QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            G TG  GA G +G  G KG+ G PG +G         PPG  G+EGKRG  GE G +G           G  G  GAPG  G  G  G  G KGA   PG RG PG +G +G  G  GR+G  G  G  GM G  G  GP G  G  G  G  G  GP G        G MG  G  G  GE+G PG  G++G  G+    G PG DG+             G+RG++G  G  G  G PGP+G TG  G  G +G+ GE G  GP G  G  G  G +G  GP G +G        G  G KG  G  G PG +GP GL G                       G++G  GLPGL+G RG+QG+ G  G  G PG  G+ G++GE G  G  GP+G  G  G RG +G PG  G    PG  G+ G +GE G                      QGPVG  G        G +G  GP G TGF G  G+ G PGP G             +G KG +G  GP G PG              G PG +G  G  G PGP G     G++G  GL G  G  G PG  G  G  G +G  G  G RG  GP+G  G  G  G  G  G PG  G+ G+ G  G  G  G+ G  G  G  G  G  G  G  G  G+ G  G  GP G  G AG  G  G  G  G KG  G  G+R   G+ G RG  G           G  G  G  G  G +G  G  G PG+DG  GL   I       +                             F+ +  ++     +     D  V+ +    +   L  L  ++E +           G+K+NP+R+C+D+ M  +    SG +WIDP+ G   D++   C     E  TC+ P+Q+     P   +  S+N  E    W+   + D  Q     ++      N Q+ FL+ + ++A Q I   C+ S+ Y D    N + A+ ++  N+ +        I++E  +       +D C           I         LPIIDI   D G P+Q  G     VCF
Sbjct:  415 GNTGEAGAPGAKGEAGVKGESGAPGVQG---------PPGPAGEEGKRGARGEPGAAG---------GRGPPGERGAPGARGFPGADGASGPKGA---PGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGV---AGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQG---------------------MPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPK------GARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGI---AGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGER---GMKGHRGFTGMQGPPGPPGPSGESGPAGSSGPAGPRGPSGSAGTPGKDGMSGLPGPIGPPGPRGRSGEIGPAGPPGPPGPPGPPGPSGGGFDIGFIAQPQEKAPDPFRHFRADDANVMRDRDLEVDTTLKSLSQQIESI-------RSPDGTKKNPARTCRDLKM-CHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGE--TCVYPSQSDI---PQKNWYTSKNIKEKKHVWFGEAMTDGFQFEYGGEESKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSNEIE--------IRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1434          

HSP 2 Score: 145.206 bits (365), Expect = 3.072e-34
Identity = 227/640 (35.47%), Postives = 272/640 (42.50%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPK------GQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLP------------------GEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPG---------------LQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKG------------------------------------SQGPVGEVGILGKPGLGGYQGPRGPKGQTGF------------------EGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQ 3443
            +G PG  G  GA+GPKG  G  G+ G  G+ G KG  G  G  G  G  G TGP G +G  G  GP       G +GFPGP+GA+G+ G+ G  G +G  G  G  G+ GD G  G  G  G  G +G  G  GP G QGL G +G  G  G PG +G PGE G  G          SG +GD G  G+RG  GP GP G  G  G  G  G  G  G+ G  G  G  G  G PG  G  GL GL GD+G+ G  G +G  G  G  G  G  G PG  GP G  G+ GP G +GE G  GP GF G  G  G  G  G  G  G                    G +G  G KG RG  G  G +G  G+                         G +G PG                +GP+GN+G  G  GR G  G+ G PG  GEKG  G  G  G +G+ G +GI G+ GI+GLPG  GE G+ G  G                                     +G  G  G  G+ G  G +G RG  G  G                    GD+G+ G  GP GA       G  GP G  GP G  GDKG +GE G+ G  G+ G  G Q
Sbjct:  489 KGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGP---------SGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGA------------------------AGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGA------MGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQ 1089          

HSP 3 Score: 137.117 bits (344), Expect = 7.322e-32
Identity = 251/715 (35.10%), Postives = 298/715 (41.68%), Query Frame = 3
Query: 2226 KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG---------------------------DFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSV------------GIRGHQGNLGPDGYIGLP---GEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYP------------------------GPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLV---------------------GVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXX---------------------IQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            KG  G  G  G  GE G++G+ G  G  G  GP G+ G  G RG  G  G +G  G+ G  G  G  G  G+ G +G PG   E G PG  G  G  G PG  GEPG  G +G  G  G  G                             G+MGFPGP+G  G  G  G  G+ G +G  G  G  G V            G RG QG  GP G+ GLP   G  GE G  G++GLPG  G +G  GS                        +G+ G PG    RG  G  G VG +G PG+ G+ G +GE G  G PG  G  GL G+ G  G  G+ GL G  G+ G +G  G+ GP G  G  G  G  G  GP GP G  G  G++G+ G PGP G  G  G  G  G  G P                        GP G  G KG  G  G PG  G+PG  GR G PG                       G TGP G+PG++G  G  G  G+KG           G  G  GS G  GP+GI G+ G  G PG  G  G PG PG  G  G +G  G  GE G                       GN+G  G  G  G +G  GE G  G  G PG  G  G  G  G+ GD G  G  G  G++GP G  GP G  G +G KGE G  G+ G  G      +Q
Sbjct:  414 KGNTGEAGAPGAKGEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPG---ERGGPGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGS------------------------RGDRGFPGE---RGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTP---------GAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQ 1089          

HSP 4 Score: 128.257 bits (321), Expect = 4.605e-29
Identity = 266/774 (34.37%), Postives = 324/774 (41.86%), Query Frame = 3
Query: 1371 RGNTGEQGPPGLMGH------------DGSPGPKGE---RGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPK------------------GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDS---GPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF---PGFYGLLGLRGLPGDKGEP------------------GTDGEEGQRGDKGLLGDFGIMGFPGP------------------------RGPTGLRGSSGPEGIKGEL------------GNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE------------------------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVG------EVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGV 3287
            +GNTGE G PG  G              G PGP GE   RG  G  G  G  GP G  G  G  G PG  G  GP+G  GE G PG  G  G  G  G  GE G  G+ G                                             + G  G PG  G TGA GP                   G +G+ G +GA G  G+ G RG+ G  G+ G  G+ G +            G  G +G  GP G  G PGP+GA+G+ G+ G  G  G+ G  G SG +GD    G  G  GP G +GS+GS GA G  G +G  G  G  GA G PG +G PGE   +G  G+ G  G+ G QG  G DG  GP GP G QGD G+ G  G +GP+G +G  G RGE G  G +GF   PG  G  G +G PGD G                    G  G  G +G +G  G  G  GFPG                          GP G RG +GP G  GE+            G  G  G  GS GI G QG  G  G +GLPG+ GE      RG PG+ GPSG  G  G  G  G +G PG +G  G  G  G  G        G  G++G  GR G  G++G  GE                         G++G+ G  GP+G  G +G RG +G  G  G  G +GE G +G KG +G  G        G  G+ G  G  GP GP+G +G  G  GK G+
Sbjct:  414 KGNTGEAGAPGAKGEAGVKGESGAPGVQGPPGPAGEEGKRGARGEPGAAGGRGPPGERGAPGARGFPGADGASGPKGAPGERGGPGAVGPKGATGEPGRNGEPGMPGSKG---------------------------------------------MTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGE---RGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGE------RGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGR------EGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQGPPGPPGPSGESGPAGSSGPAGPRGPSGSAGTPGKDGM 1127          

HSP 5 Score: 103.219 bits (256), Expect = 1.912e-21
Identity = 225/600 (37.50%), Postives = 263/600 (43.83%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEG------IRGLDGPKGQIGFPGPEG---------------------ASGKEGEIGPPGFIGDEGKRGFSGEKGDSG---PVGLIGPIGAIGSQGSHGAPGPIGL------------------QGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGP---------QGDIGMDGDRGPAG---------------PKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYG---------------------------------LLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIK 2822
            G  GP+G  G  G  GE G PG  G  GSPG  G  G TG  G  G  G  GPPGP G  G PG  G  GP+G  GE GKPG +G+         +G  G  GA G+DG  G  G  G  G  G  G  G  G PG  G+ G  G  G  G  G+QG PG  G TG  G +G  G+ G+ GA G  G  G RG  G  G  G  GE+G  GA G      ++G+ G +G  G PG +G                     A G +GE G  G +G  G RG  GE+G+SG   P G  GP GA G  G+ G PG  G                   QG +G  G KGA G  GP G  G  G  G+VG  G  GNSGP         +G  G  G+ GPAG                KG  G  G  G  G  GP G+ G  G+ G PGQ GE GFPG  G                                   G  G PG++G  G DG  G +GD+G  G  G  G PGP G  G  G +G  G +GE G  GP G +G  G RG  G  G  G  G  GE GE+G KG RG  G++
Sbjct:  499 GAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGV---------MGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQ 1089          

HSP 6 Score: 88.5817 bits (218), Expect = 5.129e-17
Identity = 185/586 (31.57%), Postives = 233/586 (39.76%), Query Frame = 3
Query: 1236 KGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGET---------------------GPIGA---EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEG---------KRGFSGEKGDSGPVGLIGPIGAI---------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQG------------------------------------------QVGIIGRDGNSGPQGDIG------------------------MDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK 2669
             GE+G++GP G                  P G+ G  GP+G  G  G  GEQG PG  G  G  G +G+RG  G +G  G  GP G  G  G  G  G +G+ G  G  G  G PG+QG+ G +G  G  G KG                               +G  G  G  G  G  G  G +GD+GEPG  G  G  G +G  G  G+ GA G  G  GP G  G  G +G  G+T                     GP+GA   +G RG  GP G  GFPG        G +GPPG  G+ G         K G  G +G++GP G  G IGA          G+ G+ GAPG  G+ G  G  G++G +G PG RGE G  GL G                                            G  GRDG +G +GD G                          GDRG +GP GP G +G  G +G  GP+G +G    +GE G+ GE G  G  G  G++G              G  G  G  G  G  G  GPRGP+G  G+ G +G+ 
Sbjct:  612 SGERGEQGPAG------------------PPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGD------------------------------RGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPG------AAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGD---KGETGEAGERGMKGHRGFTGMQGP------------PGPPGPSGESGPAGSSGPAGPRGPSGSAGTPGKDGMS 1128          

HSP 7 Score: 72.7886 bits (177), Expect = 3.574e-12
Identity = 203/607 (33.44%), Postives = 237/607 (39.04%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPI---------------GAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG---DEGKRGFSGEKGDS---------------------GPVGLIGPIGAIGSQGSHGAPGPIGLQGLIG------------------KEGEKGAIGNPGPRGEPGEI------------------GLQGQVGIIGRDGNSGPQGDIGMDGDRGPAG------------------PKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG------------LPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT---GLRGSSGPEGIKGELGNDGPLGFIG---------------SVGIRGHQGNLGPDGYIGLPGEIG 2780
            G  GF GP+G  G  G  GE+G  G +G  G+PG  G+    G  G  G  GP G  G +GP G PG +G  GP+G  GE GKPG QGL G  G  G  G +G +G  GE                                     G  G  G  G +G PG  GN GA G  G  G  G +G  G+QG  G RG  GL GL+G  G+ G                 G +G  G  GP G  G  GP G  G+ G  GP GF G    +G+ G  GE GD+                     GPVG  GP GA G+ G  GA G  G  G +G                  KEG KG  G  GP G PGEI                  G  G  GI G  G +G +G +G+ G RG  G                  P G +G  G +G  G    +G  G  G  G PG  G +G  G  G  G RG             PG  G  G  G+ G RG+ G  G  G MG  GPRGP+   G RG  G  G  GE G  G  GF G                 G  G  G  GP G  G PG+ G
Sbjct:  562 GVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGD---VGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGE------------------------------------RGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQGMPGERGAAGLPGLKGDRGDQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPPGERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFPGAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGL---AGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGMQGPPGPPGPSGESGPAGSSGPAGPRGPSGSAGTPGKDG 1126          

HSP 8 Score: 72.7886 bits (177), Expect = 3.574e-12
Identity = 170/544 (31.25%), Postives = 208/544 (38.24%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGP------PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGET---------------------GPIGA---EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD---------EGKRGFSGEKGDSGPVGLIGPIGAI---------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL------------------------------------------QGQVGIIGRDGNSGPQGDIG------------------------MDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGL 2504
              G  G  G +G  GP G  G+ GK GEQG  G  G  G  G RG RG  G RG  G  GP      PG  G+DG+   KGE G +                                 G  G  G PG+QG+ G +G  G  G KG +G                            +G  G  G  G PG  G +G KG+ G  G +G TGA GP    G  G+ GA G  G  GP G  G  G +G  G+T                     GP+GA   +G RG  GP G  GFP      G  G +GPPG  G+          GK G  G +G++GP G  G IGA          G+ G+ GAPG  G+ G  G  G++G +G PG RGE G  GL                                           G  G  GRDG +G +GD G                          GDRG +GP GP G +G  G +G  GP+G +G  G  GE G+ G  G  GF G+
Sbjct:  617 EQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGA---KGESGAS---------------------------------GAPGAQGPPGLQGMPGERGAAGLPGLKGDRG---------------------------DQGAKGADGAAGPPGPAGAQGDKGEPGAAGPVGPTGARGPP---GERGESGAPGPAGFAGPPGADGQAGAKGEPGDTGAKGDAGAPGAAGATGAPGPQGPVGATGPKGARGAAGPPGATGFP------GAAGRVGPPGPAGNSGPPGAPGPSGKEGPKGNRGETGPAGRPGEIGAAGPPGAPGEKGTPGAEGAPGSSGIPGPQGIAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGPGGPGGERGPPGPMGPPGLAGPPGEPGREGTPGNEGSAGRDGAAGAKGDRGETGAAGAPGAPGPPGAPGPIGPAGKTGDRGESGPAGPAGAMGPAGPRGPSGPAGARGDKGETGEAGERGMKGHRGFTGM 1088          

HSP 9 Score: 55.0694 bits (131), Expect = 7.914e-7
Identity = 46/102 (45.10%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1821 IGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGP 2126
            +G  GA GP G  G  G+ G  G  GE+GP G  G  G  G  G  G  G  G  GLDG KG  G  GP+G  G  GE G PG +   G RG  GE+G +GP
Sbjct:  201 MGPRGAAGPPGKNGEDGESGKPGRPGERGPSGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEPGAPGENGTPGAM---GPRGLPGERGRAGP 299          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.95 bits (585), Expect = 3.526e-61
Identity = 364/1126 (32.33%), Postives = 463/1126 (41.12%), Query Frame = 3
Query: 1830 TGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGET------------------------------GPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKG---------------EPGTDGEEGQRGDKG---LLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK------------TGLSGIRGITGRPGILGLPGFSG---------------------ETGYQGEKGSQGPVGEVGIL------------GKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYM-ESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQN----GKTL---KKITF----TATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
             G++GP G  G  G+ G  G +GE G +G  G +G  G  G T                              G  G +G  G  GP G+ G  GP GA G  G+ G PG  G  G RG +G  G +G  G  GP G  G+ GS G+PG  G +G  G  G  GA G  G  G+PGE G  G VG IG  G  G  G  G  G  GP G +G  G +G  G QG  G  G  G  G  GEPG  GE+G PG  G  G RG PG++G                PG DG  G  G  G    +G  G+ G PG RG +GL       G KGE G  GP+G  G           GP             G  G RGL G  GP+G  GS G +G  G  G  G  G  G  G++G  G PG  G  G  G+DG      MPG++G  GE G +G+ G  GP G             TG  G RG  G PG  G PG +G                     + G +G +G  GP G+ G +            G  G  G  GP+G  G  G  G +G  G+PG +G +G  G  G  G  G  GP G  G++G SG  G PG  G  G  GR G PG  G+ G  G  G  G +G  G  G  G  G  G  G  G +G  G++G  GP G  G  GT G  G  G  G  G                      +G+ G  G  G+ G RG SG  G+ G  G PG+ GI G+ G  G RG PG  G  GK G  G PG  GP G  G  G  G  G PG  G PG          M  +     +R+  D  +   P  +V              L   ++ L+  V       GS+++P+RSC+D+ +        +G +WIDPN G  +D++   C     E  +C+         P    L  +N   WW S+  D+     G+T+    + T+         Q+ FL+ L + A Q I   C+ SV Y DS   N + A+         L    D  I++E  +      ++D C           I    +    LP +DI   D G  DQ  G     VCF
Sbjct:  241 AGSVGPPGPRGASGEPGLNGNKGEPGAKGDPGPSGSAGPSGPTGAAGKRGGRGEPGSGGPPGPVGERGAPGSRGAPGGDGSPGAKGPPGERGATGPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGL------PGAKGERGEAGPVGIAG-----------GP-------------GKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADG------MPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGD---------------------KGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGRTGETGPPGPPGSPGPPGPPGSSGAGYDMGAYAGLMARRKMGDQATDMLPYGLV--------------LDASIKALNAQVESITSPDGSRKHPARSCRDLMLCHPEYKSDTGEYWIDPNEGCRADAIKVWCNMETGE--SCV--------NPGMPSLPRKN---WWRSQAADKKHVWLGETMSPGSQFTYGDGSPNMEVQLTFLRLLSTDASQKITYHCKNSVAYLDSRAGNLKKALM--------LQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGSDQEFGVDVGPVCF 1274          

HSP 2 Score: 122.094 bits (305), Expect = 6.196e-28
Identity = 228/685 (33.28%), Postives = 271/685 (39.56%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGP---PGFIGDEGKRGFSGEKGDSGPVGLIG---------------------------PIGAIGSQGSHGAPGPIGLQGLIGKEG---EKGAIGNPGPRGE------------------------PGEIGLQ------------GQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIG---LQGEIGPSGLKGSMGL---------------------RGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ---------------------RGDKGLLGDFGIMGFPGPRG------------------------PTGLRGSSGPEGIKGEL---------------GNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKG---KRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS------------------------DGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFS---------------------GETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQT 3254
            +G PGG G+ GA GP G  G  G  GA+G  G+ G  G  GL G RG  G  G  G++G  G  GP G  G PG  GA+G  G  G    PG  G  G+ G  GEKG  GPVG IG                           P+GA G QG  GAPG  G  G  G+ G   E G  G  GPRGE                        PG+ G +            G  G+ G  G  G  G  G  G+RG AGP G  G  GK G   L G +GP+G  GS G                      RGEPG  G +GFPG  G  G+ G  G+ GE G  GE GQ                     +GD+G  G  G  GFPG  G                          G+RG +GP G  GE+               G+DGP G  G+ G  G  G+ G    +G+PG+ GE+G  G     G PG +GP G  G  G  G  G  G PG  G  G +G+ G+ GLPG  G +GN+G                          G+ G +G PG  G  G  G  G  G  GP+G  G  G  G  G  GI G  GFS                     G  G +G  G  GP G+ GI G PG  G  GPRG  G+T
Sbjct:  313 RGAPGGDGSPGAKGPPGERGATGPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRG---LVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGRTGET 994          

HSP 3 Score: 111.694 bits (278), Expect = 9.354e-25
Identity = 296/815 (36.32%), Postives = 350/815 (42.94%), Query Frame = 3
Query: 1410 GHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIG---------------SQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGD------------------IGMDGDRGPAGPKGPQGDIGKIGLQ---GEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTD------------------GEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLG---------FIGSVGIRGHQGNLGPDGYIGLPGEIGE------------------KGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGI------------RGITGRPGILGLPGFSGETGYQGEKGSQGPV------------------------GEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGK 3503
            G DG           G +G  G PG  G PG  G  G PG  G +GP G +G  G+PG+ G  G  G  GD G  G  G  G                    G+ GK+G  G PG  G PG +G +G  G +G PGG G+ GA GP G  G  G  GA+G  G+ G  G  GL G RG  G  G  G++G  G  GP G  G PG  GA+G  G  G  GF G +G  G SG+ G+ G VG +GPIG  G                 G  G  GP+G  G  G  G  GA G  G  GEPG  G  G  G  G  G  G  G+                   G DG RG AGP GP G +G  GLQ   GE G SGL G+ G RGE G +G +G PG  G  GL G  G  G  G++                  G  G+RG+ G  G  G  G PG  G  G RG +G  G +GE G  GP G           G+ G +G +G  GP G  G PG  G                    G  G RG+ G  GP G  G  G  G  G  G+ G  G  G  G +G  G  GL G RG  G  G  G +G  G  G+PGE G +   G PGP+G+ G SG              G  G PG  GLPG  G  G +G++G  G                          GE G  G  G  G  G RGP G  G  GD+G  G     G  G+KG +G+ G  G PGP G PGD+GI+G  G  G  G PG  G  G  G+ G  GP G  G  G+
Sbjct:  209 GSDGG---------VGAKGAAGAPGMAGAPGSPGSVGGPGAAGSVGPPGPRGASGEPGLNGNKGEPGAKGDPGPSGSAGPSGP------------------TGAAGKRGGRGEPGSGGPPGPVGERGAPGSRGAPGGDGSPGAKGPPGERGATGPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQ---GPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGS---AGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGR 990          

HSP 4 Score: 110.538 bits (275), Expect = 1.988e-24
Identity = 252/769 (32.77%), Postives = 308/769 (40.05%), Query Frame = 3
Query: 1383 GEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI------------------RGLDGPKGQIGF---PGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVG------------------LIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQ---------------------RGDKGLLGDFGIMGFPGPR------------------------GPTGLRGSSGPEGIKGEL---------------GNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTK---GKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGS------------------------DGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKG 3311
            G +G PG  G  G+ GP GERG T                              GP G +G  G PG  G  G+ G  G  G  GH G+ G+                                                 G PG  GN G+ G  G  G  G  GA G  G KGP G +G  G +G  G  GPIG  G                   RG  GP G  GF   PG  GA G+ G+ G PG  G+ G  G +G +G+ G  G                    G  G+ G+ G  G  G +G  GL G  GE+GA G PG +GE GE    G VGI G  G  GP+   G+ G  GPAGP G  G+ G+ G  G  GP+G +G+ G RGEPG  G +GFPG  G  G+ G  G+ GE G  GE GQ                     +GD+G  G  G  GFPG                          G  G+RG +GP G  GE+               G+DGP G  G+ G  G  G+    G +G+PG+ GE+G     G  G PG +GP G  G  G  G  G  G PG  G  G +G+ G+ GLPG  G +GN+G                          G+ G +G PG  G  G  G  G  G  GP+G  G  G  G  G  GI G  GFSG  G  G  G+ G  G  G+ G  G  G  GP GP G+ G  G+ G  G  GP+G  G
Sbjct:  311 GSRGAPGGDGSPGAKGPPGERGAT------------------------------GPAGAKGNSGDPGRPGEAGLPGPRGSTGSPGHAGSDGK------------------------------------------------TGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGPSGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEA---GPVGIAGGPGKDGPR---GLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSR---GLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGRTG 992          

HSP 5 Score: 90.8929 bits (224), Expect = 1.815e-18
Identity = 220/611 (36.01%), Postives = 252/611 (41.24%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXX------------XXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPG---PKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGL---NGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGP---------------IGAEGIRGLDGPKGQIGFPGP------------------------EGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGI------------------IGRDGNSGPQGDIGMD------GDR---------------------------------GPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF------------------PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSG 2654
            SG  G+ GEKG  GP G IG  GK G+ G  G              GP+G  GF+G  G  G  G +G+ G PGL G +G PG   P+GERG  G +G  G  GP GP G  G PG  G RG  GP G  G +G  G+QG+    G  GL G  GE+G  G +G  G  G  GPRG  G  G  G  G  G  G  G  G  G  G +G  G++GEPG         P G  G+ G  GA G+ G    RG  G TG RG  G+ GP                GA+G RG  GP G  GFPG                         +G+ G  GE GPPG  G+ G  G +G  G+ G  G  GP G  G+ GS G  G  GL G+ G+ GE+G  G PG  GEPG  G  G  G                    GRDGN G  G  G D      GDR                                 GPAGP G  G  G  G  G  GP G KG  G  GE G  G  GF                   G +G  G RGLPG  G  G D               GI G PGP GP G RG +G
Sbjct:  409 SGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPG---------PPGSAGFPGAPGADGMPGA---RGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKD---------------GISGNPGPAGPAGPRGRTG 992          

HSP 6 Score: 73.559 bits (179), Expect = 3.846e-13
Identity = 236/666 (35.44%), Postives = 277/666 (41.59%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGN---------------TGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGP------------RGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYV---GKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI------RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVG---------LIGPIGAIGSQGSHGAPGPIGLQGLIGK------------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGL---------------------PGDKGEPGTDGEEGQRGDK---------------------GLLGDFGIMGFPGPRGPTGLRGSS---GPEGIKGELGNDGPLGFIGSVGIRGHQ---------------------GNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMG 2843
            +SG  GR GE G  GP G  G  G  G           G  G  GP GN G  G+                G +GP    G  G PG KG  G  G  G  G  G  GP GP GP G  G+RG+ GP             G  GE GK G  GL G  G+ G  G +G +GA GE G  G  GP GP G  G  G  G +G  G PG  G  G  G++G+ G++G  G  G  G  G  G +G     GK+G RG+ G  GP G TG  G RG  G  GP G  G       RG  GP G  GFPG  GA G       PG  G+ G+ G  GE G +GP G           G  GA G +G  G PG  G  G  G+             G  G  G  G RG  GE G  G+ G +G  G +GP G+ G  G  GPAGP+G  G  G  G +G +G  G +G  G  G PG  GE G  G  G  G RG                      PG  G PG DG +G +GD+                     G  G+ G  G PGP GP+G  G++   GP G  G  G+ G  G  G  GI+GH+                     G  G  G  GLPG  G  G  G  G PG  GP+G  G
Sbjct:  342 NSGDPGRPGEAGLPGPRGSTGSPGHAGSD---------GKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGAKGP---SGESGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGM------PGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRG 989          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006045.1 (pep scaffold:Pmarinus_7.0:GL476470:188001:338073:-1 gene:ENSPMAG00000005423.1 transcript:ENSPMAT00000006045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 1.871e-55
Identity = 367/1148 (31.97%), Postives = 470/1148 (40.94%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIR------------GLDGPKGQIGF---PGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHG---APGPIGLQGLIGKEGEKGAIGN---------PGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIG---LQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFG---------------------------IMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD---QGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGN---------IGRQGAPGLVGVTGP-IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGL---------------------QGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGL--------KGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTR------FLKSQNES--EWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMR---AFND-RKLHSH-YDKRIKSEAGT-----NLLEIRIKDD-CMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            QG PG IG  G   PKG  G++G  G  G QG +GPRG+ G  G RG  G  G  G  G R            G++GPKG +G    PGP+G  G  G +GP GF+G  G+ G  G+KGD G  G+ G IG  G +G+ G    PGPIG  G+ GK GE G  G          PG  G PG  GL G  G  G  G  GP G  G+DG+ GP GP G  G  G  G     G+ GP GLKG  G  G PG+IG++G  G  G +G  G  GDKGE G  G  G  G+KG +G  G                             G  GPRG  GL G  G EG KG +G+ G +G  G +G  G  G+ GP G+ GL G  G  G KG  G PG +G  G MG+                         G+IG  GL GP G  G  G+ G +G  G  G  GE G +G  G+PGP G  G  G  GI G  G LGL G  GE G  G+KG +G +G+ GI+G  G+ G  G  G +G+ G +GD    G  G PG  G  G KG QG +G  G  GP G PG  G  GE G P   GYPG+          G +G  G  G  G   G PG  G           G  G         LS T G  G +GPRG+PG  G  G+ GL G  G  GKPG  G              G Q  +G+ G  G  G  G++G  G  GK G PG  G+ G                      QG  G  G PG+PG RG +GS GP G  G  GE G         +G  G    P   G      ++ ++          V                  P  VP  G  +++  T+            +   ++         I + SN  IAS        +  ++D+ F        E+   +     +  KP  R      FL     S   +W+      +  ++          Q   L+ L        V   + + ++  S+       +  R   A+ D    H H +  R ++ +G       LLE R+  D C          +     +DV +LPI+D+ F     PD         VCF
Sbjct:  574 QGLPGPIGKPG---PKGIRGFIGPAGIVGAQGAEGPRGVPGAPGKRGTMGRPGFPGDYGERGPPGPDGKPGEVGIEGPKGVLGLTGDPGPQGNIGPPGFVGPKGFMGSLGEPGVKGDKGDEGAAGIAGEIGFPGDKGNLGFPGLPGPIGNPGIAGKTGESGPPGPPGSSGPEGFPGAIGSPGINGLDGPKGKPGSRGPPGPTGQKGLDGEEGPLGPPGIPGPPGNPGSQGFPGKPGPDGLKGETGDPGMPGKIGDTGLIGLTGPIGEMGKAGDKGERGGVGLPGPPGEKGAMGYPGPPGEQGPVGPEGPPGRPGLPGRRGPLGPKGKRGPRGEDGLPGEPGAEGNKGPVGDAGEVGIEGFIGKSGDPGDRGPLGFPGLQGTPGGVGIKGPIGPPGPRGAKGEMGTV------------------------GDIGTQGLPGPTGESGLQGEKGEKGDIGPLGGEGEPGLEGPRGLPGPVGDDGPQGKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGDPGIVGMRGMEGKLGKLGERGKPGKKGDKGAMGHIGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLP---GYPGHQGPIGPSGPPGIKGEKGQAGEPGTQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQGPVGPHGPRGLPGWPGPDGERGLEGAPGKDGKPGPPGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTGLAGAQGKLGKPGQPGAAGLVGAKDPRWLPFQSGKMTEPIPGVPQGDRGMDGQPGIPGQRGILGSDGPQGNKGETGEKGQLRRGTVRDRGGSGVSEFPPPRGHKSNAMLVGVEHPGGYIGRGGVWGGLGRAACCLLALCATAPKWVP--GGHVHKSPTKPPTHPATHPPTLRQHPARYRQHLFRTHIRLMSN--IASKCPTHSATVYPLNDAEFFLSLVERSELLAQVSGPMLT--KPCNRLHYYRGFLTCNFHSAGNYWIDPNLGCSSDSIDVFCNFTVGGQTC-LKPLAMSKLDFGVGKIQMNFLHLLSSEAVQPVTVHCRGGPAWEDPSSPHPHRHAARFRAWSGRLYEPGGLLEPRVLHDGCRMDDGKWHKTEFLFTTQDVNHLPIVDVHFT-HQKPDSQYHLEVGPVCF 1683          

HSP 2 Score: 204.527 bits (519), Expect = 4.911e-53
Identity = 323/858 (37.65%), Postives = 407/858 (47.44%), Query Frame = 3
Query: 1860 GYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGP------IGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAG---------PKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESG---------------------FPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGD---------------FGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK---------------TGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIR-GLVGPRGMS------------------------------GEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGD------------------RGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQ 4061
            G  G  G  G +GEKG  GI+    L G  G++G IG  G+ G  G KG  G+   +G +G  GE G PG  G+ G +G+ G +G  GP+G  GP      IG  G  G+ GA GP G+ G  GK G  G  G PG  GE         PGE+G++G  G++G  G+ GPQG+IG  G  GP G          KG +GD G  G+ GEIG  G KG++G  G PG IG  G                     FPG  G  G+ GL G KG+PG+ G  G  G KGL G+                G  GFPG  GP GL+G +G  G+ G++G+ G +G  G +G  G  G+ G  G +GLPG  GEKG  G    PG  G  G +G  G  G  G+ G+ G LG  G  G +G  GLPG  G  GN+G  GD G  G+ G  G  G+ G++G  G PG  G                 G  G  G  G  G  GLPG +GE+G QGEKG +G +G +G  G+PGL G +G  GP G  G            PQG  G+KGE+G +G NG  G  G  GDKG  G +GDPG               +VG+ G  GK GK+G++G  G +G KG  G  G  G  G SG+ G+QG  G RG  G +G  G  G  G  GLPG PG  G  G  G  G+KGE   +G  GE G + G  GP+G+                               G  G  G  G PG  G +GL+G  G+ G PG PGD                  +G  GS+G PGR G      L G +G+LG PGQ G  GL+   D +   +Q
Sbjct:  494 GNPGLPGFPGSRGEKGDPGISPPMQLPGEKGDSGSIGPPGLHGPLGSKGSKGY---QGQTGHPGEPGSPGLEGNPGVKGYPGRQGLPGPIGKPGPKGIRGFIGPAGIVGAQGAEGPRGVPGAPGKRGTMGRPGFPGDYGERGPPGPDGKPGEVGIEGPKGVLGLTGDPGPQGNIGPPGFVGPKGFMGSLGEPGVKGDKGDEGAAGIAGEIGFPGDKGNLGFPGLPGPIGNPGIAGKTGESGPPGPPGSSGPEGFPGAIGSPGINGLDGPKGKPGSRGPPGPTGQKGLDGEEGPLGPPGIPGPPGNPGSQGFPGKPGPDGLKGETGDPGMPGKIGDTGLIGLTGPIGEMGKAGDKGERGGVGLPGPPGEKGAMG---YPGPPGEQGPVGPEGPPGRPGLPGRRGPLGPKGKRGPRGEDGLPGEPGAEGNKGPVGDAGEVGIEGFIGKSGDPGDRGPLGFPGLQGTPGGVGIKGPIGPPGPRGAKGEMGTVGDIGTQGLPGPTGESGLQGEKGEKGDIGPLGGEGEPGLEGPRGLPGPVGDDG------------PQGKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGDPG---------------IVGMRGMEGKLGKLGERGKPGKKGDKGAMGHIGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLPGYPGHQGPIGPSGPPGIKGE---KGQAGEPGTQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQGPVGPHGPRGLPGWPGPDGERGLEGAPGKDGKPGPPGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTG------LAGAQGKLGKPGQPGAAGLVGAKDPRWLPFQ 1309          

HSP 3 Score: 158.303 bits (399), Expect = 6.083e-39
Identity = 315/890 (35.39%), Postives = 399/890 (44.83%), Query Frame = 3
Query: 1347 GPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGL------------------RGVDGET------------------GPIGAEGIRGLDGPKGQIGFPGPEGASGKE---------------------------GEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGE---------PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPG---DKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPE------------------GIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKT---------GLSGIRGITGRPGI-LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDK------------GISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIG 3671
            GP G  G  G+ G +G  G  GH G PG  G  G  G                         +G  G +G  G IGKPG +G+ G  G  G VG +G +G  G  G+ G  G  G  G PG  G  G  G  G PG +G  G  GV G+ GD G  G IG  G +GPKGF+G +G+ G +G +G++G  GI G  G                    G+ G+T                  G IG+ GI GLDGPKG+ G  GP G +G++                           G+ GP G  G+ G  G  G+ GD+G +GL GPIG +G  G  G     G  GL G  GEKGA+G PGP GE         PG  GL G+ G +G  G  GP+G+ G+ G+ G  G KGP GD G++G++G IG S         G+PG  G  GFP      GL+G PG    KG  G  G  G +G+ G +GD G  G PGP G +GL+G  G +                  G+ G +G+DGP    G  GI+G +G+LG +G  G  G+IG+KG +G  G PGI G  G+ G  G  G +G  G+ G  G +GH      IG PG  G  G++G+ G VG +G  G  G+PG  G +G+ G+PG  G           G+ G +G  G PG   G PG  G      E    G +GE        L   QGP GP G  G        G PGP G +GL+G  G    +G PGP   PGD             G     GD G +G PG  G  GA G +G  G  G  G VG +       + G+        P G  G  G  G  G RGI G  G QG  G  G  G
Sbjct:  530 GPPGLHGPLGSKGSKGYQGQTGHPGEPGSPGLEGNPGV------------------------KGYPGRQGLPGPIGKPGPKGIRGFIGPAGIVGAQGAEGPRGVPGAPGKRGTMGRPGFPGDYGERGPPGPDGKPGEVGIEGPKGVLGLTGDPGPQGNIGPPGFVGPKGFMGSLGEPGVKGDKGDEGAAGIAGEIGFPGDKGNLGFPGLPGPIGNPGIAGKTGESGPPGPPGSSGPEGFPGAIGSPGINGLDGPKGKPGSRGPPGPTGQKGLDGEEGPLGPPGIPGPPGNPGSQGFPGKPGPDGLKGETGDPGMPGKIGDTGLIGLTGPIGEMGKAGDKGE---RGGVGLPGPPGEKGAMGYPGPPGEQGPVGPEGPPGRPGLPGRRGPLGPKGKRGPRGEDGLPGEPGAEGNKGPVGDAGEVGIEGFIGKS---------GDPGDRGPLGFP------GLQGTPGGVGIKGPIGPPGPRGAKGEMGTVGDIGTQGLPGPTGESGLQGEKGEKGDIGPLGGEGEPGLEGPRGLPGPVGDDGPQ---GKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGDPGIVGMRGMEGKLGKLGERGKPGKKGDKGAMGH------IGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLPGYPGHQGPIGPSGPPGIKGEKGQAGEPGTQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQGPVGPHGPRGLP------GWPGPDGERGLEGAPGK---DGKPGP---PGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTGLAGAQGKLGKPGQPGAAGLVGAKDPRWLPFQSGKMTEPIPGVPQGDRGMDGQPGIPGQRGILGSDGPQGNKGETGEKG 1356          

HSP 4 Score: 107.071 bits (266), Expect = 2.804e-23
Identity = 230/626 (36.74%), Postives = 287/626 (45.85%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPR------GEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGF-YGLLGLRGLPGDKGE---PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLG-----FIGSVG----IRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKG 3041
            G  G  G KG+ G  G+ G IG  G  G  G +G MG  G +G RG +G+ G  GE+   G MG+   PGP GE+G  G +G  G PG  G  GP GP      +GK GPR   GE G PG  G  G KG VGD GE G +G IG+                                                 G+PG  G  G  G +G  G VG +G  G  G +G +G  G  G  G  G  GP G  G++G  G KG IG  G EG  G EG  G PG +GD+G +G  G KG+ G +GL G  G  G  G  G  G IG  G++G  G +G +G  G R      G+ G +G  G+ G  G+ G+ G QG +G  G RGP G  G  G  G+ GL G  G  G  G  G  G  G+ G++G PG  +G  G +GL     E   PG+ GEE       L    G +G  GPRG  G  G  G  G++G  G DG  G     +I S+G      G Q   G  G +G PG  G  G +GK G PG  G +GL+G+   +      G+          GD+G  G PG+ G RG  GSD         G QG+ GE GEKG
Sbjct:  803 GKPGPDGLKGETGDPGMPGKIGDTGLIGLTGPIGEMGKAGDKGERGGVGLPGPPGEK---GAMGY---PGPPGEQGPVGPEGPPGRPGLPGRRGPLGP------KGKRGPR---GEDGLPGEPGAEGNKGPVGDAGEVGIEGFIGK------------------------------------------------SGDPGDRGPLGFPGLQGTPGGVGIKGPIGPPGPRGAKGEMGTVGDIGTQGLPGPTGESGLQGEKGEKGDIGPLGGEGEPGLEGPRGLPGPVGDDGPQGKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGDPGIVGMRGMEGKLGKLGERGKPGKKGDKGAMGHIGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLPGYPGHQGPIGPSGPPGIKGEKGQAGEPGTQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQGPVGPHGPRGLPGWPGPDGERGLEGAPGKDGKPGPPGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTGLAGAQGKLGKPGQPGAAGLVGAKDPRWLPFQSGKMTEPIPGVPQGDRGMDGQPGIPGQRGILGSD---------GPQGNKGETGEKG 1356          

HSP 5 Score: 78.9518 bits (193), Expect = 9.249e-15
Identity = 180/502 (35.86%), Postives = 226/502 (45.02%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIG------------MRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQ------GLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDG-PKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFP------GFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDF-----------GIMGFPGPRG 2627
            G  G +G KGP G  G++G  G  G+ G  G  G  GF G +G  G             RG  GE G  G +G  G PGP GE GL G +G  G  GP G  G  G  G    RG  GP G  G  GK G++      GLNG  G  GD+G+KG +GAIG+             G  G  G  GK G  G  G  G+ G  G  G  G+ G+ G  G+ G  GP G  G  G  GA G  G +G  G+ G  G +G  G +GP G +G +G  G P  Q G PGP+G   +  E+  PG +G+E            GPVG  GP      +G  G PGP G +GL   EG  G  G PGP G+     L       G     G  G +G  G  G AG +      GK+G  G+ G +GL G+   R  P Q G+   P      G  G+ G  G+PG +G  G+DG +G +G+ G  G             G+  FP PRG
Sbjct:  908 GEPGAEGNKGPVGDAGEVGIEGFIGKSGDPGDRGPLGFPGLQGTPGGVGIKGPIGPPGPRGAKGEMGTVGDIGTQGLPGPTGESGLQGEKGEKGDIGPLGGEGEPGLEGP---RGLPGPVGDDGPQGKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGD------------PGIVGMRGMEGKLGKLGERGKPGKKGDKGAMGHIGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLPGYPGHQGPIGPSGPPGIKGEKGQAGEPGTQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQGPVGPHGP------RGLPGWPGPDGERGL---EGAPGKDGKPGPPGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTGLAGAQ------GKLGKPGQPGAAGLVGAKDPRWLPFQSGKMTEPIPGVPQGDRGMDGQPGIPGQRGILGSDGPQGNKGETGEKGQLRRGTVRDRGGSGVSEFPPPRG 1379          

HSP 6 Score: 61.6178 bits (148), Expect = 1.601e-9
Identity = 145/416 (34.86%), Postives = 186/416 (44.71%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPF---------------GLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPG--FIGDEGK----RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEG------EKGAIGNPGP------RGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRG 2357
            +G  G +GEKG+KG                 GL G +G           GP G  G +G +G++G+ G  GE+G  G  G +G+   PG  G RG+ G  G LG  G  G  G +G        G IG  G  G+ G  G QG  G +G  G VG  G  GA GEDG  G  G +GP+G  G  G  G+K                     G  GEPG     G  GPKG +    +    G  GE+       L+  +G      P+G  G RGL G  G  G  G EGA GK+G+ GPPG  +I   G      GF   +GD+G VG  G  G  G+QG  G PG  G  GL+G +       + G +  P P      RG  G+ G+ GQ GI+G D   GPQG+ G  G++G
Sbjct:  988 TGESGLQGEKGEKGDIGPLGGEGEPGLEGPRGLPGPVGD---------DGPQGKDGIKGEKGDLGLNGEDGERGDIGDKGKEGAIGDPGIVGMRGMEGKLGKLGERGKPGKKGDKGAM------GHIGEPGKAGQSGSKGNQGPVGARGSRGPVGAPGAMGAEGEDGLPGYPGHQGPIGPSGPPGIKGEK---------------------GQAGEPG--TQFGPPGPKGLMVQTIEVPDPGSLGEESSEKHFSLSFTQG------PVGPHGPRGLPGWPGPDGERGLEGAPGKDGKPGPPGDNYINSLGCFAAFCGFQNRQGDAGSVGQPGRTGLAGAQGKLGKPGQPGAAGLVGAKDPRWLPFQSGKMTEPIPGVPQGDRGMDGQPGIPGQRGILGSD---GPQGNKGETGEKG 1356          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 2.256e-51
Identity = 299/918 (32.57%), Postives = 383/918 (41.72%), Query Frame = 3
Query: 2427 GLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGE------------------------------------------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVG---------IRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQG---PRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEV------GILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXX---XXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAV-----------LNRLFTRLEMLDELVTKYNKSL-----------GSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQN----GKTLK----------KITFTATNSQIVFLQELHSK-----AEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLG 4868
            G  G  G  GEPG+ GE G PG     GLRGLPG  GE                                          PG  G  G+ G  G+ G  G  GFPG RG  G +G  G  G+ G  G DGP G  G  G         ++G  G  G  G  G  G+ G+ G KG  G PG  G  G+ G  G  G  G  G  G  G  G  G  G  G PG +G   P G  G  G  G  G PG++G  GE G+KGD G PGP G +G  G +G  G  G  G  G  G     G +   GP  +V      G  G PG  G  G  GPKG  G  G  G+ G PG QG  G  GE+G  G +G PGP G PG +G+SG+ G    +G PG  G +G PGL G  G  GK G  G  G  GP G  G  GL G  G  G  G  GS G  G  G  G  G +G+ G  G+ G PG PG  G     G  G +G +G  G  G  G +G RGL GP+G  G+ G TG+ G   E GIKG +G  G +G PG PG  G  G  G    VGP G  GL G  G  G  G +G+ G I     +    +  P      A        P   +  + +  IG              ++    L   D  V    KSL           G+++NP+R+C+D+ +  +    SG++WIDPN G   D++   C     E  TC+ A       P T   K+     WW SK  D+     G+ +            +       Q+ FL+ L  +     A   I   C+ S+ Y D    N + A+ ++  ND ++ +  + R       N+LE    D C +         +    +    LP +D+   D G PDQ  G
Sbjct:    2 GFPGPKGAGGEPGKPGEKGIPG---APGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPP--PGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGI---VGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAG---ERGIKGHRGFTGLQGLPGPPGSSGDQGLAG---SVGPSGPRGLSGPTGPPGKDGNNGQSGPIGPPGPRGRTGETGPAGPSGPAGLPGPPGPPGPGIDLSAIAGIGQTDKAPDPLRYYRSDQALPELRQHDAEVDASIKSLSGQIEGLRSPEGTRKNPARTCRDLKL-CHPEWESGNYWIDPNQGCTLDALKVFCNMETGE--TCVYAN------PQTISRKN-----WWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTFLRLLSMEAYDLPAAANITYHCKNSIAYMDEETGNLKKALLLQGSNDMEIRAEGNSRFT----YNVLE----DSCTKHTGEWGRTVVEYRTQKTSRLPFVDVAPMDVGGPDQEFG 883          

HSP 2 Score: 163.31 bits (412), Expect = 5.683e-41
Identity = 231/620 (37.26%), Postives = 279/620 (45.00%), Query Frame = 3
Query: 1851 GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKG---------------------QIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDV------------GRQGMPGSQ---GSPGEQGEKGDHGIPGPSGKTGLSGIRGIT---------------------GRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQ------------GKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGK 3503
            GF G  G  G  G  GEKG  G  GL GL G DGETG  G  G  G  G +G                     + G PG +G  G+ G++G     G  G+RGF GE+G  GP GL G  G  G+ G+ G  G  G  G  G +G  G  G PG RG     G+ G  G  G  G  GP+G  G DG RG  GP GP G  G  G +G+ GP+G  G  G RG PG+ GE+G PG  G  G  G  G  G  G  GE GQ+GD G  G  G  G PGP+GP G+   SGP+G +G  G        G+  + G   ++ P  + G PG  G  G  GK G  GI+G SG +                           G  G PGLQGP G  G  GD             G QG+ G +   G PG++GE+G  G+PGP+G+ G  G  G +                     GR G  G  G  G  G  G KG +G  G  G  G PG  G  GP GP G+ G  GDQ            G  G+PGPQG +G KGE G  G  G  G  G  G +G+ G  G  G  G  G++G  G  GL G TGP GK G  G+
Sbjct:    2 GFPGPKGAGGEPGKPGEKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVG---VSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGA---TGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGV---SGPKGARGAQGPP-----PGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPV---------------------------GRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNGQ 580          

HSP 3 Score: 156.377 bits (394), Expect = 7.896e-39
Identity = 203/525 (38.67%), Postives = 247/525 (47.05%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTG---------------------LRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGS---QGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPK-------GPQGDIGKIGLQGE------IGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGI------------RGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQG 3230
            QG PG  G  G  G +G  G+ G+ GA G QG +G RG+ G  G                     L+G+ GE G   A GI G  G +G  G  GPEGA GK+G  G  G IG  G  G  G+KGD+GP G  GP GA G+   +G  G PGP G  G  G +G+ GA G  G  G+ G+ G  G  G  G  G  GP G  G  G RG  GP        GP  D+  +  QG        GP+G  G  G+RG+ G +G +G PG  G +G  G  GD GE G  G +G  G +GL G  GI+G PG RG  G  G  GP G  G+ G+ G  G  G  G             +G +GN G D   G PG  G  G KG+RG  G  G  G  GSP                     G  G +G  G  G RG+QG  G +G  G  G++G PG QG +GD G  G +G+ G+ G RG TG  G+ G PG SG+ G  G  G  GP G  G  G PG  G  G
Sbjct:   82 QGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERG---ATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSD---GAPGRDGAAGAKGERGEAGAAGQPGAPGSP---------------------GAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNG 579          

HSP 4 Score: 122.479 bits (306), Expect = 2.811e-28
Identity = 174/453 (38.41%), Postives = 208/453 (45.92%), Query Frame = 3
Query: 1560 QGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGK-------------EGEIGPPGFIGDEGKRGFSGEKGDSGPVG------LIGPIGAIGSQG---------------SHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGL------------------------QGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLG 2744
            QG  G+ G  G++G KG  GD GEKG +GA G+DG  G  GP GP G  G  G  G  G  G  G  G             +G PG  G TG  GP GF G  G +G  G +GE+G  G  G  G  G  G +G  G +G  G+ GPKG  G  GP   +               +G  G PG  G  GK G  G +GDSGPVG      L GPIGA G +G               + G  G  G+ GL G+ GE+G  G PGP GEPG+ G                         QG+ G  G DG  G  G  G  G+RG AG  G  G  G  G  G +GP+G  G+ G +G  G +G  G  G  GL G +G  GDKGE    GE G+RG KG  G  G+ G PGP       GSSG +G+ G +G  GP G  G  G  G  GN G
Sbjct:  148 QGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGA------------RGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGE---TGEAGERGIKGHRGFTGLQGLPGP------PGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNG 579          

HSP 5 Score: 120.168 bits (300), Expect = 1.480e-27
Identity = 241/614 (39.25%), Postives = 275/614 (44.79%), Query Frame = 3
Query: 2175 GAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIG------LQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGI------------RGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG-MPGSQGSPGE---------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKG---------------SQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLK------------------GEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEG 3833
            G PGP G  G  GK GEKG  G PG RG PG+ G        G  G  G  G  GP G  G  G  GP+GP G  G  G  G+ GE G  G+ G+ G RG P   GE G PG  GL G RGLPG  G  G  G  G  G  G  G  G+ G PG RG TG+ G+ G  G  GE G +G  G  G  G+             G +G+ GP G  G  G  G  G +G+ G PG  G +G  GS G  G +G QG+ G  G  G  G +G  G PG QGP G  G  G  G QG  PG++   G          QG  G  G  GP+GK G  GIRG +G  G  G PG  G  G  GEKG               +QG  G+ GI+G PG          +G+ GF G  G  G PG QG+ G                    GEQG  G  G  G  G  G  G  GE G+ G  G PG  G  GAPG V   GP GK G  G QG  GP G  G  G RGL GP G  G  G  G  G RGI      +G  G  G  GLPG PG                    G++G  G  G  GPRG+SG  G  GK+G
Sbjct:    2 GFPGPKGAGGEPGKPGEKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFP---GERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQ---------RGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPV---GPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGI------KGHRGFTGLQGLPGPPGS------------------SGDQGLAGSVGPSGPRGLSGPTGPPGKDG 576          

HSP 6 Score: 103.605 bits (257), Expect = 1.881e-22
Identity = 168/483 (34.78%), Postives = 199/483 (41.20%), Query Frame = 3
Query: 1338 GFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQG-------------------------EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEG---------------ASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAI------------------------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGD------RGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL---GLRGLPGDKGEPGTDGEEGQ 2567
            G  G RG  G+ G  G++G  G  G +G+PG  G RG+TG  G  G  G  G  G  GP G  G  G  G  G +GE G PG  G  G  G  G  G KG +G  G+                                             KGD G PG  G +GA GP+G  G  G +GARG QG                           GP G  G  G +G+ G++GP+G  G  GL GP   IG PG +G               A G  G+ G  G  G  G+RGF G  G +G  G  G  GA                         G+ GS GAPG  G  G  G+ GE GA G PG    PG  G  G VG  G++G  G QG  G  G       RG  GP+GP+GD G+ G  GE G  G +G  GL+G PG  G SG  G  G +   G RGL G  G PG DG  GQ
Sbjct:  149 GMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQ---------------------------------------------KGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGP---IGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPG---APGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNGQ 580          

HSP 7 Score: 95.9005 bits (237), Expect = 5.206e-20
Identity = 200/599 (33.39%), Postives = 239/599 (39.90%), Query Frame = 3
Query: 2604 MGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIG---------------------------------------EKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGR------------------QGMPGSQGS---PGEQGEKGDHGIPGPSGKTGLSGIRGIT---------------GRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGD------QGKFGVPGPQGAKGLKGEQGYMGPNGYP-------GP---------HGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGI---RGLVGPRGMSGEAGITGKEGLPGELGIK---GLQGVNGQRGD------------------PGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            MGFPGP+G              GE G  G  G  G+ G+RG            LPG+ G                                       E G  G +G+PG  G  G+ G+                G  G  G++G  G  GLQG RG  G+ G  G                   QGMPG +G+    G +G++GD G  GP G  G  G RG+T               G  G  G  G SG  G  GE+G  GP G  G  G PG  G  G +G +G+TG +GD      QG  G PGPQG  G+ G +G  G  G P       GP          G PG  G +G  G  GP G  G+ G  G  G  G+ GPIG PG+ G  G  GP G  G  G +GLS   G  G VG  G  G RG PG  G  G+PG  G  G  G+ G  G  G  G  G  GE G +GN G  G     G  G +G  GEAG  G+ G PG  G     G  G NG RGD                  PG  G RG  G  G  G  G +G  G  G++G  G PG  G+ GL   +
Sbjct:    1 MGFPGPKG------------AGGEPGKPGEKGIPGAPGLRG------------LPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGA---------------RGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLS---GQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSV 557          

HSP 8 Score: 61.2326 bits (147), Expect = 1.960e-9
Identity = 133/388 (34.28%), Postives = 167/388 (43.04%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPP----------------GLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPG------------------VQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQI------------GFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGN 2243
            +G  G  G  GQ G  G  G+ G+ G+ G  G  GP G  G +GP G  G +G  G QGPP                   G+ GSPGP G  G  G +G  G  GP                G+ G  G QG IG PG                   QGL+G +G+VG  G++G +G  G                PG  G  GK+G  G  G  G PG +G  G+ G  GE G  GN G+ G        G++GA G +GE+G  G  G  G  G  G  GP+G  G  G  G +G              G PGP+G  G +GE       G+ G+RG  G +G +G  GL GP G+ G QG  G+ GP G +GL G  G  G  GN
Sbjct:  232 AGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPV---------------GRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPG---------------LPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDG------APGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGE------TGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGN 577          

HSP 9 Score: 58.151 bits (139), Expect = 1.821e-8
Identity = 113/329 (34.35%), Postives = 132/329 (40.12%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQ---------GEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHG 2177
            SG +GR GE G +GP G  G+ G  GE G  G  GP G  G  G RG +G+ G  GE+G PGL G  G PG +G  G +G +G  G  GP G  GP G         + G  G  G  G PG  G  G KG  G+ G  G  GA G                                                  G PG +G T            GK GARG Q         G  G RG+ G  G RG  GETG  G  GI+G  G  G  G PGP G+SG +               G +G  G SGP GL GP G  G  G++G
Sbjct:  335 SGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPG---------EQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGS------------------------------------------------PGAPGPVGPT------------GKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQ---------------GLAGSVGPSGPRGLSGPTGPPGKDGNNG 579          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003566.1 (pep scaffold:Pmarinus_7.0:GL476944:532:45496:-1 gene:ENSPMAG00000003220.1 transcript:ENSPMAT00000003566.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 2.919e-47
Identity = 260/686 (37.90%), Postives = 317/686 (46.21%), Query Frame = 3
Query: 2277 LQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRG---LPGDKGEPGTDGEEGQRG------------DKGLLGDFGIMGFPGPRGPTGLRGSS-----GPEGIKGELGNDGPLGF--IGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPR-----GNQGSDGDVGRQGMPGSQGSPGE--QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAK------GLKGEQGYMGPNGYPGPHGLPGDKGIS-----GEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGI--PGKIGTQGKPGLVGRIGLPGK----PXXXXXXXXXXXXXXXXXXXIQG-NKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEM 4193
            L  ++ ++  +G + P       G+RGPAG +G  G  G+ G+ G     G KG  GL G PG  G  G PG+ G  G RG    PGDKG+ G +G  G RG            ++G+ G  G  G  GP GP GL+G +     GP+G  G  G  GP G   +G  G+ G QG  GP G  GLPGE G  G KG RG  G +G  GL GS                      GDKG+IGL GL GP      G QG  G+ G +GM G +G PGE   G KGD G+ G SG  G SGI G  G  G +G PG SG  G  GE GS G  GE+         G  GPRGP+G  G  G QG+ G PGP+G +      G+ G  G  G  G PG  GLPG  G S     GE G PGP G+ G  G  G PG  G  G  G PG VG +               G  GP G  G  G QG  GP G+  PG  G  G  GL G  GL G+    P                  GIQG  KGE G +G+VGPRG +GE                   G+ G +GD GLPG+RG+ G  G  G  GP G+PG  G KGE GL  +D    +IK+I    G      R+ K +  ++    D    V P+N   I   +N L  +L +
Sbjct:  186 LLKEMSLLASEGCAAPAKCACEKGERGPAGLQGKPGAAGEDGIPGV---KGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETGIGLHGPKGDLGPPGRAGPAGPPGVGEPGLPGPQGPSGPSGERGLPGE-GLPGPKGDRGFDGPRGARGLQGSGV-------------------KGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGEGLVGPKGDRGLTGDSGPQGPSGI-GEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEI---------GSPGPRGPEGSAGI-GVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRSIVGPKGEHGPPGPAGFVGEPG-MGLPGPKGDRGLPGAPGPVGSK-------------GEGYPGPAGQPGLPGPQGELGPEGVGLPGPKGDLGSRGLPGPPGLTGEGLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTGE-------------------GLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAGLTRED----VIKLIKEVCGCG----RKCKERPMELVFVIDSSESVGPDNFEIIKEFVNALVDKLTV 796          

HSP 2 Score: 170.629 bits (431), Expect = 3.253e-43
Identity = 237/592 (40.03%), Postives = 284/592 (47.97%), Query Frame = 3
Query: 1899 EKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGE--PGQIGESGFPGFYGLLGLR--GLPGDKGE--------------PGTDGEEGQRGDKGLLGDFGI--MGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGE-----KGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPK--GQTGFEGDQGKFGVPGPQGAKG-----------------------------LKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            EKG RG  GL G  G  GE      +GI G+ G KG  G  G  GASG EG  G  G  GD G+ G  G+KGD GP G  GP G  G QG  G  G  G++G+ G +G++G      P G P   GLQG+ GI    G  GP+GD+G  G  GPAGP G    +G+ GL G  GPSG  G  GL GE  PG  G+ GF G  G  GL+  G+ GDKG+               G  GE+G+ G +G+ G  G    G  GP+G  GL G SGP+G  G +G  GP G IGS G+ G  G LG DG  G  GEIG  G +G  G  GI    G+ G                       GD G  G  G+ GP G  G  G  G  G+PG  G PG  G      KG+HG PGP+G  G  G+ G+ G  G  GLPG  G  G +GE G  GP G+      PGL G QG  GP+  G  G +GD G  G+PGP G  G                              KGEQG+ G  G  GP G    +G++G  GD    G PG  GR+G  G  G TGP G PG+ G +
Sbjct:  207 EKGERGPAGLQGKPGAAGE------DGIPGVKGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRG------PVGPP---GLQGETGI----GLHGPKGDLGPPGRAGPAGPPG----VGEPGLPGPQGPSGPSGERGLPGEGLPGPKGDRGFDGPRGARGLQGSGVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGEGLVGPKGDRGLTGDSGPQGPSG-IGEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAGI----GVQG---------------------EKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRSIVGPKGEHGPPGPAGFVGEPGM-GLPGPKGDRGLPGAPGPVGSKGE-GYPGPAGQ------PGLPGPQGELGPEGVGLPGPKGDLGSRGLPGPPGLTGEGLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTG----EGLTGPKGD---RGLPGERGRKGDRGDQGDTGPSGDPGRAGSK 734          

HSP 3 Score: 159.073 bits (401), Expect = 1.445e-39
Identity = 248/627 (39.55%), Postives = 296/627 (47.21%), Query Frame = 3
Query: 2106 EKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM---------DGDRGPAGPKGPQGDIGKI---GLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGN-----DGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGE--KGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE--------QGEKGD------HGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYP---GNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNG 3878
            EKG+ GP GL G  GA G  G  G  G  G  GL G  G  G  G PG +G+ G+ G  G  G  G  G  GP G  GM          G++G  G +GP+GD G +   GLQGE G  GL G  G  G PG+ G +G PG    +G  GLPG +G  G  GE G  G+ GL G  G  GF GPRG  GL+GS    G+KG+ G+           +  VGI+G +G  GP G  G  G  GE   G KG RGL G  GP G  G                   IG  G KG IG PGL G  G  G DG  G++G  GS G  G         QGEKGD       G+PGP G +GL G +G  G PG LGLPG  G +   G KG  GP G  G +G+PG+ G  GP+         GD+G  G PGP G+KG           GYPGP G PG  G  GE+G  G +G P   G++G +G PG  G+TG  G PG  G  G  GP G  G +G           G  G QG  GPRG  G    +G  G  G  GLPG+                     +G KG+ G +G  GP G  G AG  G+ GL  E  IK ++ V G
Sbjct:  207 EKGERGPAGLQGKPGAAGEDGIPGVKGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETG-IGLHGPKGDLGPPGRAGPAGPPG----VGEPGLPGPQGPSGPSGERGLPGE-GLPGPKGDRGFDGPRGARGLQGS----GVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGEGLVGPKGDRGLTGDSGPQGPSG-------------------IGEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAGIGVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRS-IVGPKGEHGPPGPAGFVGEPGM-GLPGPK---------GDRGLPGAPGPVGSKG----------EGYPGPAGQPGLPGPQGELGPEG-VGLPGPKGDLGSRGLPGPPGLTGE-GLPGPKGSIGRQGPSGPPGPQGEGIQGP---KKGEQGFQGMVGPRGPTG----EGLTGPKGDRGLPGE---------------------RGRKGDRGDQGDTGPSGDPGRAGSKGEAGLTREDVIKLIKEVCG 753          

HSP 4 Score: 156.762 bits (395), Expect = 6.851e-39
Identity = 239/607 (39.37%), Postives = 296/607 (48.76%), Query Frame = 3
Query: 1365 GMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGL--TGLRGVDGETGPIGAEGI--RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGK--------------RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGA--IGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI------GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRG--NQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGIT 3101
            G RG  G QG PG  G DG PG KG +G                           D G  G  G  G  G+PG +G  G +G  G  G+KG +G  G                       G +G+ G  G  G  G  G++GI+G +G+ G +G  G  G  G IG  G +G  G  G  GP G  G+   GL G  G +GP G  G+   GL GPKG  GF GP GA G +G     G  GD+G                G  GEKG+ GP G+ GP G  G     G  GP G +GL G  G +G   IG PGP+GE G  GL G  GI+G DG+ G +G+IG  G RGP G  G       IG+QGE       GP G+ G +G+ G PG  GE G P   G LGL G PG +   G  GE G  G  G +G+ G MG PGP+G  GL G+ GP G KGE G  GP    G  G+ G QG LGP+G +GLPG  G+ G++G  G PG+ G  GL G  G+ G QG  G PG  G       KG  G  G+ GPRG   +G  G  G +G+PG +G  G++G++GD G  G  G+ G  G  G+T
Sbjct:  209 GERGPAGLQGKPGAAGEDGIPGVKGSKG---------------------------DAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGP---------------------AGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETG-IGLHGPKGDLGPPGRAGPAGPPGVGEPGLPGPQGPSGPSGERGLPGEGLPGPKGDRGFDGPRGARGLQGS----GVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPG----EGLVGPKGDRGLTGDSGPQGPSGIGEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAG-------IGVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVP---GRLGLPGSPG-RSIVGPKGEHGPPGPAGFVGEPG-MGLPGPKGDRGLPGAPGPVGSKGE-GYPGP---AGQPGLPGPQGELGPEG-VGLPGPKGDLGSRGLPGPPGLTG-EGLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTGEGLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAGLT 740          

HSP 5 Score: 156.762 bits (395), Expect = 8.004e-39
Identity = 220/580 (37.93%), Postives = 272/580 (46.90%), Query Frame = 3
Query: 1842 GPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGF---------IGDEGKRGFSGEKGDSGPV-----------GLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGP-----AGPKGPQGDI-----------GKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS--VGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGE--QGEKGDHGIPGPSGK-----TGLSGIRGITGRPGILGLPGFSGETGYQGEKGS-----------------QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE 3395
            G +G  G  GK GA G  G  G +G  G  GL G  G +G  G  G +G  G +G+ G PG +G  G EG  GP G           G++G  G  G KGD GPV           GL GP G +G  G  G  GP G+       GE G  G  GP G  GE GL G+       G  GP+GD G DG RG      +G KG +GDI             +G+QGE G  G +G  G RG PG+       G  G  G RGL GD G  G  G  G+ G KG +G  G+ G P      G+ G  G  G KGE+G+ GP G  GS  +G++G +G+ GP G  G+PG +G  G  G +G PG+ G  GL GSPG                    G  G +G PG+    G  G  GD G  G PG  GS GE   G  G  G+PGP G+      GL G +G  G  G+ G PG +GE G  G KGS                 QGP       G+ G  G  GPRGP G+ G  G +G  G+PG +G KG +G+QG  GP+G PG  G  G+ G++ E
Sbjct:  209 GERGPAGLQGKPGAAGEDGIPGVKGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETGIGLHGPKGDLGPPGRAGPAGPPGV-------GEPGLPGPQGPSGPSGERGLPGE-------GLPGPKGDRGFDGPRGARGLQGSGVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGE-------GLVGPKGDRGLTGDSGPQGPSG-IGEPGPKGEIGSPGLSGIP------GILGEDGSPGQKGEIGSPGPRGPEGSAGIGVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRSIVGPKGEHGPP-------GPAGFVGEPGM----GLPGPKGDRGLPGAPGPVGSKGEGYPGPAGQPGLPGPQGELGPEGVGLPGPKGDLGSRGLPGPPGLTGE-GLPGPKGSIGRQGPSGPPGPQGEGIQGPK-----KGEQGFQGMVGPRGPTGE-GLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAGLTRE 742          

HSP 6 Score: 86.6557 bits (213), Expect = 3.623e-17
Identity = 181/494 (36.64%), Postives = 218/494 (44.13%), Query Frame = 3
Query: 1227 IGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGL----TXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKP--GVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGN--PGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLR-----GLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK 2669
            IG  G KG  GP G  G  G  G           G  G +GP G  G RG  GE G PG  G  G  GP+G RGL                   P      G+ G++G+ GPRG  G  G P  G+ G  G +GL GD G +G  G IGE                                                 G  G IG+ G  G  G +G  G  G +G  G  GPRG  G  G+ GV GE G  G  G RG+ GP G  G PG +G  G  G +G PG  G    R   G KG+ GP    GP G +G  G  G PGP G +GL G  G  G+ G   PGP G+PG  G QG++G  G  G  GP+GD+   G RG  GP G  G+ G  G +G IG  G  G  G +GE  Q  + G  GF G++G R     GL G KG+ G  GE G++GD+G  GD G  G PG  G  G  G +  + IK
Sbjct:  324 IGLHGPKGDLGPPGRAGPAGPPGVGEP-------GLPGPQGPSGPSGERGLPGE-GLPGPKGDRGFDGPRGARGLQGSGVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGEGLVGPKGDRGLTGDSGPQGPSG-IGE------------------------------------------------PGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAGI-GVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPG----RSIVGPKGEHGPP---GPAGFVGEPG-MGLPGPKGDRGLPGAPGPVGSKGEGYPGPAGQPGLPGPQGELGPEGV-GLPGPKGDL---GSRGLPGPPGLTGE-GLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTGEGLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAGLTREDVIK 746          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 1.093e-45
Identity = 207/666 (31.08%), Postives = 278/666 (41.74%), Query Frame = 3
Query: 2949 GPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG---IPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTL---------------KKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            GP+G  G  G +G  G PG+ G  G  G  G  G     G  GK G  G RG TG PG  G PG +G  G QGE+G +GP G  G  G PG  G+ G  G +G +G  G++G  G+ GP G+ G  G  G  G  G PG  G PG  G  GE G  G  G  G  GR G  G+ G  G  G PG+ G  G MG                 GLSG  G  G+ G  G  G  G  G+PG  G +G  G                   +G  G +G++G RG+ G RG SG  G+ G  G  G  G  G+ G +G RG  G  G RGK G  G  G +GP G  G  G  G  G  G  G PG           Y  +P     +  D           +  +   +   L  L  +LE +           G+K +P+RSC+D+ M  +    SG +WIDPN GSV D++   C     E  TC+         P  + + S+N   WW +K   ++                     ++      Q+ FL+ + ++A Q I   CR SV Y D+   + R A+++    + +L +    R       ++LE    D C +         +         LPI+DI   D G P+Q  G     VCF
Sbjct:    8 GPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNP---------------GLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGP------------------NGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSAGPAGSPGIPGPPGPPGPAANGYGQLPLIGMEKGPDPYPYRYRADEALKEHDAEVDVTLKSLTNQLENI-------MSPEGTKTDPARSCRDL-MLCHSDWKSGEYWIDPNEGSVLDAMKVWCNMETGE--TCV--------YPKPKNVPSKN---WWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAA-GSLRKAVRLMGSGELELRADGKNRFT----YSMLE----DGCAKHTGEWGKTVLQYKTNKPSRLPIVDIAPLDIGGPEQEFGVEIGPVCF 610          

HSP 2 Score: 129.028 bits (323), Expect = 8.763e-31
Identity = 139/373 (37.27%), Postives = 171/373 (45.84%), Query Frame = 3
Query: 2418 GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYP------------------GPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPG 3455
            GPSG  G  G  GE G +G +GFPG  G  G  G PG  G  G  G +G+ G  G  GD G  G PG  GPTGL G+      +GE G  GP G  G+ G  G  G LG  G  GL G+      +G+RG+PG+ GP+G +G                                   GP G QG  G  G  G PG  G+PGE G +G  G  G SG+ GL+G+RG  G PG          +G PG SG  G  G +G  GP G+ GI+G+PG  G  GP+GP G  G  GD G+ G+      KG +G  G+ G  G P                  GP G  G +G  G  G  GP+G  G+ GR G  G
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGN------QGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQ------RGERGVPGLNGPTGSLGK---------------------------------SGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGI------KGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          

HSP 3 Score: 115.161 bits (287), Expect = 2.221e-26
Identity = 127/301 (42.19%), Postives = 150/301 (49.83%), Query Frame = 3
Query: 1878 GARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIG 2780
            GA+G  G  GPRG TG  G  G  G TG +G +G RG  GP G  G  G  G+SG         F+G  G +G SG++G+ G  GL GP G++G  G      P G QG   + G  G +G+PG  G PGE G +G  G    DG SG  G  G+ GDRG  G  G  G+ G +   G  G SG  G  G RGE G  G+SG  G  G  G  G  G  G  G  G+ G+RG KG  G  G  G PG  GP G +G  G  G  G  G  GP G  G  G  G  G LGP G+ G PGE G
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSG---------FLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSG------PTGEQG---ERGAPGNVGSPGLNGAPGESGREGSSGT---DGASGRDGLAGVRGDRGEPGTPGRPGNPGNM---GNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          

HSP 4 Score: 114.005 bits (284), Expect = 4.863e-26
Identity = 135/344 (39.24%), Postives = 158/344 (45.93%), Query Frame = 3
Query: 2346 GDRGPAGPKGPQGDIGKIGLQG---------------------EIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGP------RGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS------QGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK 3278
            G  G  GPKG  G++G +G+ G                       G  G  GSMG RG+ G  GE G PG  GLLG +G  G++G  GT G  G  G  G LG  GI G  G RG  G+ G +GP    G LG  GP    G  G RG  GN+G  G  G PGE G +G+ G  G  G  G +G+ G  G  G  G              G+ GN+G PGL G       RG  G  GD G  G PGS G  G QG  G HG  G SG+ G+ G RG +   G  GLPG  G  G+QG  G       +GP G  G  GK G  G  GP GP G  G  G+ G 
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGP---TGSLGKSGP---TGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPG------------RPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWS---GFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGS 324          

HSP 5 Score: 101.679 bits (252), Expect = 4.754e-22
Identity = 119/292 (40.75%), Postives = 136/292 (46.58%), Query Frame = 3
Query: 1806 GEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP------RGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG 2663
            GEPG  G TG LG +G  G  G  G RG  G  G        GI GL+G R         G  G+ GL+GP G +G  GP   +G++GE G PG +G  G  G  GE G              GS G+ GA G  GL G+ G  GE G  G PG  G  G  GL G  G  G  G +GPQGD G+ G  G AGP GPQG  G  G +G+ G  G+KG  G          SGF G  GL G  G  G  G  G  G  G  G  G  G  G  G  GP GP+G RG  G  G
Sbjct:   65 GEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQR---------GERGVPGLNGPTGSLGKSGP---TGEQGERGAPGNVGSPGLNGAPGESGRE------------GSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGW---------SGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          

HSP 6 Score: 98.5969 bits (244), Expect = 4.118e-21
Identity = 96/248 (38.71%), Postives = 122/248 (49.19%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGP---------PGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM------------DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGES 2480
            ++GE G  G  G  G  G  G++G  G +G+ G++G RG+ GL G  G  G++GP G +G RG  G  G  G  G  G SG+EG  G           G  GD G+ G  G  G+ G +G  G  GA G  G  G  GP G  G++G+ G  G +G  GP G  GE G  G+ GI G  G SG QG  G+            +G  GP GP GP G  GK G  G+ GP G  G    RG PG+ G +
Sbjct:   81 ERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGH---RGRPGEAGSA 325          

HSP 7 Score: 91.6633 bits (226), Expect = 6.700e-19
Identity = 118/293 (40.27%), Postives = 146/293 (49.83%), Query Frame = 3
Query: 2292 GIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGS 3170
            G  G+DG+ GP+GD G  G+    G  GP G +G  G +GE GPSG +G+ G        G SGF G +G+ GL G  G++G PG +G  G  G  G  G+ G  G PG  G  GL G+ G  G +G  G DG  G  G  G+RG +G  G  G  G PG +G  G  G  G  G +G +G  G  G  G  G  G  G  G  G +G++G+ G  G++G RG  G  G  G  G  G QG PG  G        GP G TG +G RG  G  G  G  G SG  G  GE GS
Sbjct:   47 GAQGKDGSMGPRGDTGTPGE---PGEPGPTGLLGNQGERGERGPSGTRGTAGA------PGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGS------GPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGS 324          

HSP 8 Score: 86.6557 bits (213), Expect = 2.018e-17
Identity = 119/335 (35.52%), Postives = 144/335 (42.99%), Query Frame = 3
Query: 3057 GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQ---RGDPGLPGDRGKIGSIGPPGRVGPQG---------EPGLKGVKGELGLPGQDGEPGL 4025
            GPSG+ G  G  G  G  G+ G PG  GE+G  G  G  GP G  G  GK       G  GP+G TG  G+ G+   PGP G  G +GE+G  GP+G  G  G PG  G    +G  G  G  G  G +G PGL G TG +GK G  G+Q                                 G RG PG +G+ G  G  G  G  G                       G  G +G  GL G RG  GE G  G+ G PG +G  GL G NG+   RG+ G  GD G +G  G  G +GPQG         + G +G+KG  G  G  G PGL
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGK------DGSMGPRGDTGTPGEPGE---PGPTGLLGNQGERGERGPSGTRGTAGAPGSSGF---LGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQ---------------------------------GERGAPGNVGSPGLNGAPGESGREGS---------------------SGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGL 270          

HSP 9 Score: 67.3958 bits (163), Expect = 1.748e-11
Identity = 117/342 (34.21%), Postives = 138/342 (40.35%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPG---VQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAI 2237
            G  G  GE G+ GP GL+G+ G+                  RG RG  G RG  G  G  G +G  G  G  G+RG                 G  G  G  G  GK GP G QGE G PG     GLNG  G  G  G  G  GA G D                                       G+ G++GD+GEPG  G  G  G  G  G  G  G  G +GE GP+G +G+ G  G  G  GP G  G  G  G  G+ G  G  G SG +G    PG  G  G +G  G  G SGP G  GP G  G  G +G  GP+G  G  G+ GE G+ 
Sbjct:   59 GDTGTPGEPGEPGPTGLLGNQGE------------------RGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRG---------------ERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRD---------------------------------------GLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGL---PGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSA 325          

HSP 10 Score: 64.3142 bits (155), Expect = 1.987e-10
Identity = 80/243 (32.92%), Postives = 102/243 (41.98%), Query Frame = 3
Query: 3354 GPHGLPGDKGISGEVGDPGPIGYPGNI------------------GRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            GP G  G KG  GEVG  G  G+PG                    G QG  G +G  G  G PG+ G+ G                  P GL G  G +G  GP G  G  G  G  G +G  G+ G                     + G +GE G+ GL GP G  G++G TG++G  G  G  G  G+N      G PG+ G+ GS G  G  G  G  G++G +GE G PG+ G PG +
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPG------------------PTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQG---------------------LSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLN------GAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNM 199          

HSP 11 Score: 57.7658 bits (138), Expect = 1.735e-8
Identity = 99/302 (32.78%), Postives = 120/302 (39.74%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFR---------GPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGET------------GPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIG 2060
            +G +G +GE+G++GP G  G  G  G  G  G  G  G  G R         GP G++G  G TGEQG  G  G+ GSPG  G  G +G +G  G  G  G  G  G  G  G+ G  G  G  G +G PG+ G NG  G  G+ G +G  G +G                                                    PG  G  G  GP G  G  G  G RG++G +G  G  GL GL G  G              GP G  G RG DG  GQ G  GP G  G+ GE G
Sbjct:   73 TGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVG---------------------------------------------------RPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          

HSP 12 Score: 53.1434 bits (126), Expect = 4.923e-7
Identity = 106/298 (35.57%), Postives = 129/298 (43.29%), Query Frame = 3
Query: 1326 MGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG------LDGPKGQIGF---------------------------PGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDS 2120
             G  G  GPRG+ G  G  GE GP GL+G+ G  G +G  G  G  G  G  G  G  G +G  G  G+RG  G  G  G +GK G  G  G +G  G+VG  G  GA GE G                     ++G  G  G  GR G+ GV+G +G+ G PG  GN G +G  G  G  GK+G RG  G +G  GI G  G  G  G  GP GA G RG      + G +G  GF                            GP G  GK+G  G  G +G  G RG  GE G +
Sbjct:   49 QGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESG---------------------REGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSA 325          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 335.495 bits (859), Expect = 2.901e-94
Identity = 469/1444 (32.48%), Postives = 610/1444 (42.24%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPP--------------------GLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGE---KGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGP------------KGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGE------TGPIGAEGIRGLDGPKGQIGFP------------------GPEGASGKEGEIGPPGFIGDE------GKRGFSGEKGDSGP------------------VGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSG------------PQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEI---GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGT---DGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGL----------------PGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDG------------DVGRQGMPGSQGSPGEQGEKGDHGIPGPSGK------------------------TGLSGIRGITGRPGI---LGLPGFSGETGYQGEKGSQG---------------------------PVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAK---------GLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIID-------------------------IQVGMYQFVP-RRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLT-RFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            G IG +G  G+ G  G +G  G+                G +G RG+ G +G+ G QGPP                    G+ G +G+PGP+G  GL G                         RG  GPRG +GE+G PG  G  G +G  G  G     G  GA GE G  G  GP GP G PG  G  G++G  G  G++GRPG  G  G  G  G PG  G  G  G             +G  G  G EGARG+ G  G +G  G TG RG  G       +GP G++G  G+DG  G+ G P                  GP GA G  G  G  G  GD       GK G  GEKG  GP                  +G +GP+G IG  GS GA GP G  G  G  G KG  G+PG  G PG  G +G  G  G  G  G             +G  G+ GD G  G  G  G   ++ LQG     GPSG+ G+ G  GEPG+ G++G  G  G  G  GL G +G PG    +G  G+ G++G +G  G  G PG +GP GL G +G  G +GE G D   G  G++G RG QG  GP G  G  G+ G++G+ G  G                 PG +GPSG  G+PG QG  G  G+ G  G  G  G++G +G PG+ G  G  GSDG            + G  G PG+ G  G+ G++G  G+PG  G                          G  G+ G +GRPGI   LG  G  G  G +G  GSQG                             G  G+ G  G GG  G  G  G+ G  G  G+ G+PGP G           G KGE+G  GP G  G  G PG  GI GE       GYPG  GR G PG VG+ GP G+PG+ G                       G  G  G  G  G  GIPG  G +G PG  G+ G               ++G  G SG  G  GE G++G  G R   G+ G  GK+G  G  G  G QG  G RG  G  GD+G  GS G PG  G QGE G  GV G  G PG  G  G +  +                          + VG  +  P  R+   ++D K   +P V                  T LE ++  V    K  G K NP+++CKD+ M+    + SG++WIDPN GS  D++   C FS     +CI   + ++ K L  R   + N+ + WLS+  ++      +I ++A  SQI FL+    +A Q +   C+    +      N + +I++R  ND   H+   K+ +      L E   KDD   +        + +  K    LPI+D+   DFG P Q +     SVCF+
Sbjct:   82 GDIGDQGPSGEAGKPGPLGYNGQP---------------GNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGP------------------------RGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTD---GKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGER------GYPGKDGRAGEPGAVGLRGPTGQPGENGL---------------------PGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAG---------------KQGPPGPSGPLGANGEPGVQGAKGAR---GDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPGPRGNVGPMGPMGDPGLPGPPGPPGPPGYTGLSPVGGYLSVGTVEKGPGYRLYAGSKDAKKPDNPSVS---------------FMTALEKMEIDVNTIRKPTGMKNNPAKTCKDLRMDHPDYV-SGYYWIDPNEGSKKDAIRVYCDFSNDF--SCI---SPTKAKLLNLRVQANVNKKDKWLSEAFEEE----SQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQNYKAWT-----NRKHSIKLRGDNDLIFHAKSPKKFQPT--VILNECTTKDDQWHKTI------LAIDTKQKHRLPIVDMALFDFGKPHQKVTVEVGSVCFA 1400          

HSP 2 Score: 207.994 bits (528), Expect = 4.652e-54
Identity = 294/816 (36.03%), Postives = 349/816 (42.77%), Query Frame = 3
Query: 1974 EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVG-----------LIGPIG---AIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDG---------DRGPA------------GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPG---------FYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDG---------------------PLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKG------------------KRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPG------------PSGKTGLSGIRGITGRPGILGLP---GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPN------GYPGPHGLPGDKGISGEVGDPGPIGYPGNIGR---QGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGL------------PGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEP---------GLKGVKGELGLPGQDGEPGLIKII 4037
            +G RG DGP G IG  GP G +GK G +G  G  G++G RG  G +GD GP G           + GP     A G +GS+GAPGP G  GL G  G  G      PRG+ GE+GL G+ G  GR G SGP G  G+DG         ++G A            G KG +G++G+ G+ G  G  G  G+ G  G PG  G+ G  G           GL G+RG PG++G  G  G  G +G +G  G  G  G  GP+GP+G +GS G  GI G  G  G                     P G  G  G  G  G  G  G  G PG+IG KG KG                  KRG  G  GP G +G                    G  G  G  G PG  GP G +G  G  G  G PGS+G  G  G+ G+ G  G              GKTGL G  G  G+PG  G P      G TG  G  G  G  G  G  GK G  G QGP G KG++G  G +G  GV G  G  G  GE+G +GP       G  GP GLPG  G SG  G+ G  G PG +G    QG  G  G+TGP GKPG  G  G  G    K E         I     +G  G  GP G PG  G QG PG  GR G PG                         KG  G RG VGP G+ G+ G  G +GL             GE G  G  G NG+ GD G    RG  G+ G PGR G QG           G  G+KG  G+ G  G PG+   +
Sbjct:   72 KGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDG------PRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGD------------------PGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEF--------IRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGA------------------------KGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGP---RGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTL 828          

HSP 3 Score: 187.193 bits (474), Expect = 1.297e-47
Identity = 261/643 (40.59%), Postives = 312/643 (48.52%), Query Frame = 3
Query: 2196 LQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKG--PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSG---------------IRGITGRPGILGLPGFS------------GETGYQGEKGSQGP------VGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGY------PGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLP 4001
            ++G  G +G  G IG+ GP    GE G  G +G  G+ GN G +GD G  GD+GP GP G   Q   G  G       +G+KGS G    PG  G  G PG  G  G RG  G+ G PG  G  G+RG  G  G  GI GF          G+ G +G KGE G  GP GF G  G +G +GNLG  G +G PG  G  G  G  G PG +G  GL G  G +G  G  G  G+ G  G+ G +G  G PGL+G RG  GS G  G Q   G QG  G QG KG  GI G  G+ GL G               IRG +G PGI G PG +            G+ G +GEKGS+GP       G  G  GK G  G  GP GP G  G  G  G  G PG  G  G KGEQG  G  G+PG     GDKG SG+ G+PG +G       PG+ GR+G  GL G  G  GKPG  GK   +  +G  G  G  G++G  G +G  G  G  GP+   G  G +G+ GL G  G+PG                   +G  GN GE G RG VGP+G  G  G  G  GLPG+ G  G +G  G  G PG  G+RG  G  GP G  GP G+PG +G  G  G P
Sbjct:   71 VKGQRGPDGPPGDIGDQGPS---GEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGA---PGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGF---------SGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQ---GPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSK---GDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQ---GPAGAKGESGLAGSRGMPG------------------VAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTP 671          

HSP 4 Score: 150.599 bits (379), Expect = 2.075e-36
Identity = 288/765 (37.65%), Postives = 343/765 (44.84%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGP------------------FGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQG------LNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRG------ITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ-------------------IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL------------------------------GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGI------------------MGFPGPRGPTGLRGSSGP---EGIKGEL---GNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGIL 3200
              G IG KGEKG +GP                   G +G +G +G+ G  G  GP G+ G  GP G  G +G+ G  G PG  G  GS G  GE G  G +G  G PG  G              GK G  G  G+ GKPG  G      L GM G+ G  G  G KGA GE G  G  GP+GP G  G  G  G +G+PG  G  G            + GEPG  G  G  GP+G  G  G  G  G  GE GPRG        G  G RG  GETGP G  G  G  G +G                    IG PG +G SG  G  G  G  G  G+RG  G KG  G  G +GP G  G  G+ G+ G  G  G  G  GEKG  G PG  G  G+ G QG  G+ G  G  G  G+ G  G  GP GP+GP G  G  G+ G  G  G+ G++G RG  G  G  G PG  G+                               G++G  G+ G PG DGE G+ G  G  G+ GI                   G  GP GP G+ G+ GP    GIKGE    G DG  G  G+VG+RG  G  G +G  G PG+ G  GT G+ G+PG+K   G  GSPG  G  G QG PG  G +G NG+      PG+QG +G +G DG  G+QG  G QG  G QG+KG+    GP G+ G  G  G  G PG  G  G  G  G  G  G  GP G VG +
Sbjct:  394 RPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGR------------EGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNG------------NAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLK---GERGSPGEPGKAGKQGPPGPSGPLGANGE------PGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNR---GPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGPPGPRGNVGPM 1122          

HSP 5 Score: 135.191 bits (339), Expect = 1.044e-31
Identity = 211/557 (37.88%), Postives = 260/557 (46.68%), Query Frame = 3
Query: 2637 LRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRG-----LPGIKGP------SGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDH---------GIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEV---------------GILGKPGLGGYQG-PRGP--KGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDP------GPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXX------------PIGLSGTVGSQGYYGPRGIP------GKIGTQGKPGLV------------------GRIGL---------------PGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPG 4022
            ++G  GP+G  G++G+ GP G  G  G  G+ G  G  G  G PG  G++G +G  G       GIKGP      +G+ GS G  G +G  G PG  G  G  G +G +GLPG  G  G +G+ G  G  G+ G  G+PGEQGEKG+          G+ G  G+ G  G RG+ GRP   G PGF G  G  G  G++G VG                 G+ G PG  G +G P  P  KG+ G  G +G  G  GPQG  G +G +G  G +G PG  GLPGDKG  G  G        GP G PG  G  GA G+ G  G  G+PGK+G +G  G EG  G  G RG  G            P+G  G  GS+G  GPRG P      G+ G QG PG                    GR+GL                G PG DG +G  G  G      +QG  G  G  G+ G +G +GE G  G  G  G  G KG  G+ G RG PG+ G  G  G  G  G VGPQG  G  G +G  GLPG+ GE G
Sbjct:   71 VKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRP---GRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESG 624          

HSP 6 Score: 96.2857 bits (238), Expect = 8.755e-20
Identity = 154/428 (35.98%), Postives = 190/428 (44.39%), Query Frame = 3
Query: 2934 LPGLQGPRGNQGSDGDVGRQ---------------GMPGSQ---GSPGEQGEKGDHGIPGPSGKTG-----------LSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGE------------AGITGKEGLPGELGIKGLQGVNGQRGDPGLPG---------------------------DRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDG 4013
             P ++G RG  G  GD+G Q               G PG+Q   G PG QG++G  G PG S +              +GI+G  G PG  G PG  G  G  G +G +   GEVG+ G+ G  G +G  GP G  G +G    F      GA G +GE+G  GP+G PG  GL G KG  G +G+ G +G PG  G  GAPG  G  G  GK G  G+ G  GP G  G            L G  G+ G  G RG+PG  G +GK G  G  G PG             +G +G SG QG+KG+ GI G  G  G+ G+             GI G  G PG  G  G  G+NG RG PG PG                            RGKIG +GP   +GP G+PG +G  G  G PG  G
Sbjct:   68 YPPVKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQR---GEVGLPGESGSAGRRGASGPPGSPGIDG----F-----SGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPG------------LQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGN------------QGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGP---MGPIGDPGSRGATGPRGFPGAAG 456          

HSP 7 Score: 88.9669 bits (219), Expect = 1.346e-17
Identity = 122/321 (38.01%), Postives = 146/321 (45.48%), Query Frame = 3
Query: 3150 YQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG--------------------------AKGLKGEQGYMGPN---GYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            Y   KG +GP G  G +G  G  G  G  GP G  G  G+QG  G PGPQG                          A G+KG  G  GP    G PGP G  G +G  GEVG PG  G  G  G  G PG  G+ G  G PG+ G++G  GP G  G  G         L G  G +G  G RG+   +G  G+PG  G  G PG P                     G +G+ G+ G  GPRG +G  G+ G  G PG  G +GL       G+PGL G RG  GS G PG  GPQG  G +G KG+ G+ G+ GEPGL
Sbjct:   68 YPPVKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPG---------LKGQKGEEGNLGERGM---VGRPGRPGFDGAPGAPGSP---------------------GAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLP------GNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGL 349          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 275.404 bits (703), Expect = 7.160e-76
Identity = 404/1247 (32.40%), Postives = 549/1247 (44.03%), Query Frame = 3
Query: 1335 FGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGH---------KGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRG------------LDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVG---LIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGP---RGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESG-FPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVG----EVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXI------------QGNKGETGIR---------------GLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKF--QDFGNPDQLLGYYFDSVCF 4892
             G  G RG  G +G  G QG  GL+G  G  GP GE+G +G +G +G                    G IG +G +G+ G+ GV+G  G KG  G  G+KG          KGAIG                      +GK G PG  G  G  G  G  G  G +G+ GG+G+ G  G +GF G +G +G  G  G  G +G  G TG+ G  G  GPIGA+GI G              GP G  GF G  G  G  G  G  GF G  G  G  G +G  GP+G   ++G +GA       G PG  GL G  G EG+ G  G PGP   +G+PG+ G++G  G+ G  G +G  GD G  GD             G  GL G+I P   KG + +  +   + ES           L  L      PG   +    G    L     + +P    P   RG++GP G +G LG+ GP G  G  G  G  G  G  G IG  G IG +G +G++G  G KG  G MGS                      G  G+ G  G++GP G  GS+G  G  G PG  G  G +G KG +G+PG  GK GL G  G TG  G+ G+ G  G  G++G+ G+ G +G    E G+ GK GL      RGP G  G +G++G  G  G +G  GL+G+QG  G  G  G     G+KG+ GE    GPIG  G  GR G  G  G+ GP GK G VG  G  GP G  G+ G  G     G +G +G++G  G +G PG IG  G  G +G +G  G+ G  G  G  GE G  G  G             QG  G  GIR               GL+GPRG  G  G+ G++G  GE G  G  G  G++G  G  G  GK G++GPPG  G  G+ G KG  G LG  G+ G+   +          + +   + +Q          +  +I N+  S+             L E+  K    LGS+ NP+ +C +  ++    I  G +WIDPN G  SD++   CKF         PA      K + +   +   +  W    K + G    KIT+     Q+ FL+ L +K  Q I++ C+  VV+F    K+Y  + +   FN  +   +      S +  N+L    +D C          ++      +R LPI+D  +  +    P++  G   + VCF
Sbjct:    1 MGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVG------------------SHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIG---------------------IIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGA------PGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDE------------GNEGLPGDIVPR-YKGHLVILDKREILDESKILKNVENNTRLPLLRMKLRSPGCFLQHLWAGPALALRYVQALMYPILSNPLLSRGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGS---------------------KGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGL------RGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGET---GPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSK---GKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGK---LGPPGEPGKPGEILNLHLLKQ----------NTHLIVNDKKSL------------YLSEMDDKSKTPLGSRANPALTCHE--LKHVNGIKDGEYWIDPNQGCSSDAIKVYCKFKTGGESCVRPAL-----KMIPKETWNNATTAGWYQFSKLERG---YKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVWFHRHSKSYDYSWKFHGFNGHQFTYN-----SSRSSLNVL----RDACKYDDGRWRRTELLFETTKLRTLPIVDFTYYHRSLTTPEE-FGVKIEPVCF 1111          

HSP 2 Score: 115.931 bits (289), Expect = 8.173e-26
Identity = 181/562 (32.21%), Postives = 233/562 (41.46%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNI------GMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIG---AIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRG------------------EPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQG---------------------------EIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNL 2741
            +G  G +G  G  GP GL GD G            P+G  G  G +GNI      G++G+ GEQGP G  G  G  G KG  G                           D G++G RG  GE+G  GV G  G  G +G  G +G KG                                                     G PG  G  G  G +G  G        G++G KGP G+ G  G  G  G+ GP G+E      G  G+ G  GP G  G +GE    G++G  G++GF G +GD G  G  GPIG     G +G  G  GPIG QGL G+ G +G  G  GP+G                  + G+ G +G+ G IG  G  G +G     GD G  GPKG  GD+G +G +G                           + GP G  G  G+RG  G IG+SG  G YGL+G RG  G+ G  G  G +G++G  G LG+ G  G  G  G  G RG+ GP G  G +G+ G  G  GS+G +G +G L
Sbjct:  409 AGPSGPRGALGHPGPQGLEGDRG------------PIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPG---------------------------DFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGP---------------------------------------------------NGLPGLPGKRGLRGSEGSTGVY------GMKGMKGPIGVPGFRGQHGTPGDIGPPGSE-----SGVPGKTGLRGPMGHKGPDGE---KGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGS---PGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRGKL 863          

HSP 3 Score: 82.4185 bits (202), Expect = 1.417e-15
Identity = 126/363 (34.71%), Postives = 155/363 (42.70%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPE------GASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQV 2291
            G IGRKGEKG++G  G+ G+ G  G+ G  G  GP+G  G  G +G IG+ G +G        G DGS GP GE G TG                          G  G +GG G IG  G+QG  G  GL GD G  G  G  G                                               G+ G PG  G  G +G KG +G VG  G  G  G  GP G+ G  G  G+ G+    G +G+ G  G  G  G PGP+      GA G  G++G PG  G  G  G  G +GD G  GL GP G    QG  G PG  G +GL G  G+ G+IG+PG  G+ G  GL G +
Sbjct:   50 GLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSP------GKDGSEGPTGESGPTGAL------------------------GAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGH---------------------------------------------AGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDA---GYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGF---QGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDI 331          

HSP 4 Score: 56.6102 bits (135), Expect = 9.932e-8
Identity = 99/304 (32.57%), Postives = 118/304 (38.82%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGS---PGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGK---EGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGE 2108
             SG  G  G KGQKG  G IG               P G  GF   +G +G++G+ G  G  G  GH G+   PGP+G  G                    G  G+ GD G  G  GG G IG  G+QG  G  GL GD G  G  G  G                                               G+ G PG  G  G +G KG +G VG     G+RG+ G +GP G  G +GL G  G  G  G  GIRG +         G +G SGK G IG PG  GDEG  G  G+
Sbjct:  117 ESGPTGALGAKGQKGGVGSIG---------------PSGLQGF---QGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPI------------------GAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGH---------------------------------------------AGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHE---------GLQGVSGKAGSIGDPGDPGDEGNEGLPGD 330          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO33050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC3])

HSP 1 Score: 200.675 bits (509), Expect = 7.153e-53
Identity = 231/608 (37.99%), Postives = 294/608 (48.36%), Query Frame = 3
Query: 1974 EGIRGLDGPKGQIGF------------------------PGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQ------GDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPG------------FYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGF---IGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY------PGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP-IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQ 3641
             G +G  GPKG+ G+                         GP+G  G+ G  G  G  G +GKRG  GE G     GL+GP+         G PGP G+QG  G++G +GA G  G  G PG +GL G  G  G  G  GPQG  G+ GDRGP GP G Q      G +G  GL G  G  G +G  G++GE G  G+SG PG              G +G+ G  G  G+ G++G  G+ G  G LG  G  G  G  GP+GL+G  G  G+KG+ G DG  GF    G+ GI G QG +GP G  G+ G++G  G  G RGL G +GP G +G  G  G                 G +G+ G PG++G  G QG  G  G  G PG +G+ GE+G  G+ G+    G  G  G  G+ G  GI+G+ G  G TG  G++G+ GP G  G LG PG  G +G RGP G+ G  G +G  G  G  G +G +GEQG  GP G        GP G  G  G+ G  G  GPIG PG  G+ G PG +G  G   G PGK G +                  GP+G  G  G +GY G RG  G +G Q
Sbjct:  251 RGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSP---GLVGPV---------GLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPP---------------GFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGM---KGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLR------------------GPMGHKGPDGEKGYVGKRGEKGFMGKQ 810          

HSP 2 Score: 199.134 bits (505), Expect = 2.283e-52
Identity = 226/572 (39.51%), Postives = 282/572 (49.30%), Query Frame = 3
Query: 1842 GPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIG------PIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIG------------------LQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGS---VGIRGH---QGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPH-GLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVG 3464
            GP+G  G  G  G +GVQG KG RG+ G  G  G+    GP+G  G  G+ G  GQ GF   EGA G +G  G PG +G  G RG  G++G  GP G+ G      P G  G QG  G  G +G  GLIG++GEKG  G  G +GE G  G                   +G +GIIG+ G+ G  G  G  G+ GP G  G +G  G +G    IGPSGL+G  G      ++G  G  G+ G+ G +G  G+ G PG  G  G  G KG+LGD G  G PG RG   L G+ GPEG  G  G  GP GF G     GIRGH   QG  G  G IG PG+ G  G KG  G  G+KG  G  G                     + G  G+IG+ G+QGP G  G DG  G  G  G +G+ G  G +G  G  GP GK G+SG +G  G  G +GL         QG++G QGP       G  G GG  G +GP G  G  G  G  G+ GP G  G +G+ G  G  G PG   G+PG  G+ G +G  GP G  G +G++G  G +G
Sbjct:  291 GPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGL---VGPVGLPGPEGIQGDPGQKGF---EGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVG---SIGPSGLQGFQG------RMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRG---LNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEG---------------------NEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGL---------QGDRGEQGP------FGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMG 808          

HSP 3 Score: 197.978 bits (502), Expect = 6.533e-52
Identity = 204/514 (39.69%), Postives = 266/514 (51.75%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGY---VGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGD---------SGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGL---RGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQ 3299
            QG+PG  G  GA G KGF G    +G  G+RG  G++G RG  G+ GL G  G  GP G +G RG+ G  G  G  G +G  GKEG  G  G  G +GK G  G+KG           G +G+IG  G+ G  GS G  G  G  G +G +G+KG +G+ GP G     G QG++G+ G  G  G  G  G  G+ G  GP+G  G IG  G+ G++G  G+ GS GL   RG  G +G SG PG          PG +G+PG  G  G  G +G+ G  G +G PG +G  G +G SG +G+KG+ G++G  G  G +GI G Q   GP G  G  G+ G  G  G RG  G  GP GL                         GD+G IG PG+ G +GN G+ G +G QG  G QG  G +G  GD G  GP G  G +G+ G+ G  G +G+PGF G+ G  G+ G   P  E G+ GK GL G  G +GP G+ G+ G +G+ G  G Q
Sbjct:  338 QGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGL---QGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPG---------PPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQ---GPPGVTGKDGQQGAAGPSGPRGALGHPGPQGL------------------------EGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGP--PGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGKQ 810          

HSP 4 Score: 193.356 bits (490), Expect = 1.712e-50
Identity = 234/610 (38.36%), Postives = 300/610 (49.18%), Query Frame = 3
Query: 2226 KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAK------GLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            +G  G PGP+GEP   G +  +G+     +     +I     +GP G KG  G  G  G+QG  G  GL             GE+G PG  G +GL G  G +G+PG  G EG +G KG  G  G MG  G RG  G +G  GP+G++G LG+ GP G  G  G RG +G +G  G IG  GE G++G  G +G  G KG SGL G              G +G  GH G KG IG+ G  G  G  GS+G  G  G  G+ G+ G++G  G  G  G  G  G  G++G  G  G+ G  G +G TG  G +G+ GP+G  GILG  G  G  G RG  G  G EGD G  G+PGP G +      G++G +G  G +G  G  G PG KG  GE    G+ G  G PG+ G +G PG +G+ G  G PG  GK G  G  G  G +G       +G  G  G +G  GP G PG  GT+G  G  GRIGL                        QG++GE   +G  GP+G  G+ G  G  G  G  G+ G++G+ G  G PG  G  G  G IGPPG     G PG  G++G +G  G DGE G +
Sbjct:  251 RGPKGEPGPKGEP---GYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLP------------GEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGD------------KGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGA------LGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGL------------------------QGDRGE---QGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE--SGVPGKTGLRGPMGHKGPDGEKGYV 798          

HSP 5 Score: 151.369 bits (381), Expect = 4.080e-37
Identity = 223/523 (42.64%), Postives = 278/523 (53.15%), Query Frame = 3
Query: 1329 GYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPK------GERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK------PGVQGLNGMKGLVGD---VGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSM------GLRGEPGQIGESGFPGFYGLLGLR---GLPGDKGE------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGP-LGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR 2804
            GY G +G +G  G RG  GE G PGL+G  G PGP+      G++G  G +G  GFPG  G  G  G  G PGD+G  GP+G QG +G       PG QG  G+KG VG    +G KG KG  G DG  G  G +G  G PG  G +G  G PG+ G IG  G  G  G  G +G  G  G TGALG KG  G VG  G  G+QG +G  G+ G  G  GVDG  G  G  GI    GP+G +   GP GA G  G++G PG  G  G  G  G +GD G  GL GP G    QG  G PG  G +GL G  G+ G+IG+PG +G  GE G  G+ G+    G+ G +G+ G+ GD G  G +GP G  GK G QG  GPSG +G++      GL G+ G IG+ G  G  G +G +   GL GD+GE       G  G+ G +G  G  G  G+ G  G +GP G+ G  G  G  G++G  G   G  G  G+RG  G+ GPDG  G  G+ GEKG  GK+
Sbjct:  300 GYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGI---PGPQGTM---GPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGF---QGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGM---KGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGKQ 810          

HSP 6 Score: 134.42 bits (337), Expect = 9.640e-32
Identity = 176/476 (36.97%), Postives = 219/476 (46.01%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEG---ARGVQGEKGPRGITGLTGL------RGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGK------EGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIG----ESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLG 2591
            G IGRKGEKG++G  G+ G+ G  G+ G  G  GP+G  G  G +G IG+ G +G  G       DGS GP GE G TG                          G  G +GG G IG  G+QG  G  GL GD G  G  G  G                                               G+ G PG  G  G +G KG +G VG  G   +RG+ G +GP G  G +GL      +G  G+ G  G EG++G+ G  G IG PG +G  G++G  G  G  GD G  G  G  GD G +G+ GP G  G  G  GA GP G +G +G       EG++G IG PG  G  G IG +G++G+ G  G  GP G  G  GD G  GP G +G  G  G++G  GP G+ G  G  G PG IG    ESG PG     GLRG  G KG  G  G  G+RG+KG +G
Sbjct:  411 GLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPG------KDGSEGPTGESGPTGAL------------------------GAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGH---------------------------------------------AGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGK---TGLRGPMGHKGPDGEKGYVGKRGEKGFMG 808          

HSP 7 Score: 124.02 bits (310), Expect = 1.456e-28
Identity = 160/391 (40.92%), Postives = 191/391 (48.85%), Query Frame = 3
Query: 2919 KGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQG---KFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRG---------KIGSIGPPGR---VGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQ 4046
            KG  GL G  G  G+QG  G  G++G+PG  GSPG  G  G   +PGP G  G  G +G  G  GI G PG  G  G  G +G+ G  G  G  G  GL G +GPRGP G+ GF G +G     G+ G +G KG +G  G  G  G  G  GLPGDKG  G  G PG  G  G IG+ G+PG  G  GP G+ G  G  G  G +G  G          IG SG  G QG  G +G  G  G  G  G  G  G+PG                    G  G  G  GI G VG  GM G  G+ G  G  G+LG  GL G  G +GDPG PG RG         K GSIG PG+   +G +G  G +G+KG+ G  G +G PG I II +Q
Sbjct:  290 KGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVG---LPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGS---------IGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGP------------------QGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQ 650          

HSP 8 Score: 101.679 bits (252), Expect = 1.251e-21
Identity = 142/380 (37.37%), Postives = 185/380 (48.68%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFG---FRGPRGNIGMRGNTGEQGP---PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGV---QGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIG---PIGAIGSQGSHGAPGPIG----LQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGR 2306
             SG  G  G KGQKG  G IG  G  G QG+ G+ G  GY G   F+G  GN G+ G  G  GP    G++G  G+PG  G RGL G +G  G  G                 G  GP G QG+ GKPG+   +GL G+ G  G +G+ G KG IGE G  G  G +G  G                                 D+G  G  G+ G +G +G  G  GK+G +G  G  GPRG  G  G +G++G+ GPIG  G+ G  G  G  G  G +G  G++G  GP G  GD G +G  G +G +G  G+ G   PIG  G +G HG PG IG      G+ GK G +G +G+ GP GE G +G +G+ G +G+
Sbjct:  478 ESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLG---------------HSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPG---------------------------------DEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGK 809          

HSP 9 Score: 62.3882 bits (150), Expect = 1.326e-9
Identity = 122/336 (36.31%), Postives = 161/336 (47.92%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFG---LIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQG---EPGGIGNTGALGPKGFIGY---------VGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPE-GASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSH 2174
            H+G+ G  G +G  GP G   ++GD+G  G  G        G  G RGP G++G   ++G  GPPG  G  G PG +G  GL G  G  G  G  G  G         + G+ GP G QG  G PG +G  G+ G +G +G +G  G  G+DG                     ++G  G  G  G  G  G +G++GD+G   +PG  G  G +G KG IG           G +GA G  G KGP G  G TG+ G+ G  GPIG  G RG  G  G IG PG E G  GK G  GP G  G +G++G+ G++G+ G    +G  G +G  G H
Sbjct:  526 HAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGS------RGLNGTRGPEGDLG---HSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKG---------NIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDG---------------------QQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKG---FMGKQGGVGPTGGH 819          

HSP 10 Score: 54.6842 bits (130), Expect = 3.263e-7
Identity = 85/264 (32.20%), Postives = 106/264 (40.15%), Query Frame = 3
Query: 3330 YMGPNGYPGPHGLPGDKG---------------------ISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKG------------VKGELGLPGQDGEPG 4022
            Y GP G PGP G PG K                      I G  G  G  GY G+ G QGA G  G+ G  G PG VG                     P+GL G  G QG  G +G  G  G +G PG  G +GL                         G++G  G +G  GP+G+ G  G  G  G PGE G +G++G  G  G  G  G++GK G  G  G  G +G+ GL G             KG +G+ G+ G PG
Sbjct:  250 YRGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVG---------------------PVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGL------------------------MGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPG 468          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S288])

HSP 1 Score: 203.371 bits (516), Expect = 1.473e-52
Identity = 355/965 (36.79%), Postives = 420/965 (43.52%), Query Frame = 3
Query: 1326 MGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITG------------LTGLRGVDGETGPIGA---------EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG------------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGD------------------IGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQ---------GEKGSQGPVGEVGI------------------LGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGL--------VGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGE 3962
            +G  G  G RG+   RG  G +GPPGL G  G PG +G RG  G  G  G  GP G  G  G  G PG RG+ G  G  G  G+ G QG  G KG  G +G +G KG +GE G  G  GP G  G+ GT                               G  G  G  GA GP+G  G +G +G RG  G  GP+G+ G            + G  G++GE+GP G          +G RG +GP G  G PG  G  G  G  G PG  G            D   +G +G  G  GP G  G  G  GS G  G  GP G +G +G  G  G  G+PG  G+ GE G  G  G+ G  G  G  G+                   G DG +G AG  G  G IG  G  G  G  GL G  G +G PG+ G  G  G  G  G RG  G++GEPG  G +G  G +G+ G  GI G                 G++GE G  GP+G  G  G  G QG  GP G  G  GE G  G  G  G PGI G  G MG  G  G  G  G PG  G  G  GD G    PG QGPRG QGSDG  G  G PG  G PG+ G  G  G+PGP G+ G  G+RG  G  G  G  G  G+TG           GE G+ GP G  GI                  +G+PG  G  GP+GP G  G  G  G  G PG  G  GL+      GP G PG +G  G +G  GE G PG +G PG  G +G PGL        V   G  G+PG+ G  G                   IG  G  G+QG  GP G P   GT G PG  G  G PG                   +G++GNKG  G  G +G  G+ G  G  G  G  G  G KG  G +G  G  GL GD G+ G  G PGR G QG+
Sbjct:  145 VGIPGLPGKRGD---RGTPGAKGPPGLAGEPGEPGTQGPRGDPGDVGEPGEAGPSGRNGANGTAGPPGVRGQPGAIGSPGPKGQQGPQGAEGFKGDRGLIGRRGPKGNLGEKGEKGAEGPGGVEGKNGT------------------------------DGAAGPAGEPGADGPRGSPGALGDQGERGPAGAPGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAGRNGAGGDKGARGENGPAGPQGRPGAAGRQGDPGRDGAPGAPGKPVSTASNSESPDHIAKGDAGRAGPQGPQGAEGRTGRRGSLGERGGKGPQGSRGPVGPRGANGVPGSPGADGDTGEAGEHGADGLKGDRGADGLPGEDGIPGPRGPSGPTGPPGPDGKDGQKGEAGRDGENGQIGPQGRAGAPGSPGLGGQKGDQGMPGKPGNPGAAGLRGAPGARGDYGERGEPGAPGRDGSPGQRGVPGVPGIPGL---------------AGMQGEPGAQGPMGADGKRGAPGAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSPGPSGPKGDSGE---PGQQGPRGTQGSDGKRGANGNPGIPGVPGDAGLTGPRGVPGPPGRPGDDGMRGPDGPVGPPGDVGEMGDTGSNGDPGDDGDPGELGNIGPAGPEGIKGASGSPGGIGPPGAPGAVGRPGPVGLPGPQGPAGPDGDHGMDGAKGDPGAAGVNGLR------GPRGKPGRNGKDGSRGKRGEDGRPGAVGPPGKTGPRGKPGLQFGKELMFVCWQGDPGEPGRDGTPGA------------------IGPQGPQGAQGSQGPAGSP---GTDGIPGARGTPGQPGT------------------AGVKGNKGYAGNPGTLGLEGLRGRTGAQGPIGDRGRSGPKGAAGEDGAEGAAGLVGDSGEKGYRGAPGRQGLQGK 1013          

HSP 2 Score: 198.364 bits (503), Expect = 4.738e-51
Identity = 333/951 (35.02%), Postives = 409/951 (43.01%), Query Frame = 3
Query: 1530 DRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAI---------GSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQG------------DIGMDGDRGPAGPKGPQGDIGKIGLQGEI------------GPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTD------------------GEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGS---PGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGY---------------------------------QGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQ---------------GYMGPNGYPGPHGLP---GDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGK--------IGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDP---GLPGDRGKIGSIGP---PGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            DRG  G +G  G  G+PG  G  G +G  GDVGE G  G  G +G+ G                                            G PG  G  GA+G  G  G  G +GA G +G+   RG+ G  G +G  GE G  GAEG  G++G  G  G  GP G  G +G  G PG +GD+G+RG +G     GP GL G  G           G  G  G  GP GL G  G  G+KGA G  GP G  G  G  G+ G  GRDG  G  G            D    GD G AGP+GPQG  G+ G +G +            GP G +G+ G+ G PG  G++G  G +G  GL+G  G  G PG D                  G++GQ+G+ G  G+ G +   GP+G  G  GS G  G KG+ G  G  G  G+ G+RG  G  G  G  G PG  G  G+ G+RG+PG+ G  GL G         +QG+PG  G +G +G +G  G  G +GPRG QG  G+ G  G  G+ G+   PGEQG  G  G PGP G  G  G  G +G  G  G PG  G  G QG  G +G  G  GI G PG  G                                   G  G  G  G +GD G+ G  GP G +G+KG                 G  GP G PGP G     GD G+ G  GDP            GA G+ G+ GP GKPG+ GK G  G  G+             G  G VG  G  GPRG PG         +  QG PG  GR G PG                       G +G  G +G  GP G  G  GI G  G PG+ G  G++G  G  G+P   GL G RG+ G+ GP    GR GP+G  G  G +G  GL G  GE G 
Sbjct:  156 DRGTPGAKGPPGLAGEPGEPGTQGPRGDPGDVGEPGEAGPSGRNGANGTA------------------------------------------GPPGVRGQPGAIGSPGPKGQQGPQGAEGFKGD---RGLIGRRGPKGNLGEKGEKGAEGPGGVEGKNGTDGAAGPAGEPGADGPRGSPGALGDQGERGPAGA---PGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAGRNGAGGDKGARGENGPAGPQGRPGAAGRQGDPGRDGAPGAPGKPVSTASNSESPDHIAKGDAGRAGPQGPQGAEGRTGRRGSLGERGGKGPQGSRGPVGPRGANGVPGSPGADGDTGEAGEHGADGLKGDRGADGLPGEDGIPGPRGPSGPTGPPGPDGKDGQKGEAGRDGENGQI---GPQGRAGAPGSPGLGGQKGDQGMPGKPGNPGAAGLRGAPGARGDYGERGEPGAPGRDGSPGQRGVPGVPGIPGLAG---------MQGEPGAQGPMGADGKRGAPGAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSPGPSGPKGDSGEPGQQGPRGTQGSDGKRGANGNPGIPGVPGDAGLTGPRGVPGPPGRPGDDGMRGPDGPVGPPGDVGEMGDTGSNGDPGDDGDPGELGNIGPAGPEGIKGASGSPGGIGPPGAPGAVGRPGPVGLPGPQGPAGPDGDHGMDGAKGDP------------GAAGVNGLRGPRGKPGRNGKDGSRGKRGED------------GRPGAVGPPGKTGPRGKPGLQFGKELMFVCWQGDPGEPGRDGTPG---------------------AIGPQGPQGAQGSQGPAGSPGTDGIPGARGTPGQPGTAGVKGNKGYAGNPGTLGLEGLRGRTGAQGPIGDRGRSGPKGAAGEDGAEGAAGLVGDSGEKGY 1001          

HSP 3 Score: 179.489 bits (454), Expect = 3.321e-45
Identity = 250/646 (38.70%), Postives = 304/646 (47.06%), Query Frame = 3
Query: 1803 QGEPGG------IGNTGALGPKGFIGYVG--------------------------------KEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI---------------GLQGEIGPSGLK------GSMGLRGEPGQIGESGFPGFYGLL---GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGP---TGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNI---------GLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHG---------LPGDKGISGEVGDPGPIGYPGNIGRQGA---PGLVGVTGPIG 3482
            +G+PG        G  G  GPKG  G  G                                + G  G+ G++G RG  G  G  G+ GE G  G +G RG  G  G+ G  GP G +G  G  GPPG       RG  G  G  GP G  GP GA G +G  G  G  G +G +G++GEKGA G  G  G+ G  G  G  G  G DG  G  G +G  G+RGPAG  GPQG  G                 G++GE GP+GL       G  G RGE G  G  G PG  G     G  G PG  G+P +     +  D    GD G  G  GP+G    TG RGS G  G KG  G+ GP+G  G+ G+ G  G  G  G  G  G  G KG +G  GLPG  G  G  G  G  G  G  G+ G  G  G +G+ G I         G PGL G +G+QG  G  G  G  G +G+PG +G+ G+ G PG  G+ G  G RG+ G PGI GL       G QGE G+QGP+G  G  G P   G QG RGP+G+ G +G++G  G  G  GA G+ GEQG MGP G PGP G           G KG SGE G  GP G  G+ G++GA   PG+ GV G  G
Sbjct:   83 KGDPGNKGQAGPPGPAGPQGPKGTQGDAGTPGGNGAPGLPGPPGARGLIGPPGPPGKPVIRRVGIPGLPGKRGDRGTPGAKGPPGLAGEPGEPGTQGPRGDPGDVGEPGEAGPSGRNGANGTAGPPGV------RGQPGAIGSPGPKGQQGPQGAEGFKGDRGLIGRRGPKGNLGEKGEKGAEGPGGVEGKNGTDGAAGPAGEPGADGPRGSPGALGDQGERGPAGAPGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAGRNGAGGDKGARGENGPAGPQGRPGAAGRQGDPGRDGAPGAPGKPVSTASNSESPDHIAKGDAGRAGPQGPQGAEGRTGRRGSLGERGGKGPQGSRGPVGPRGANGVPGSPGADGDTGEAGEHGADGLKGDRGADGLPGEDGIPGPRGPSGPTGPPGPDGKDGQKGEAGRDGENGQIGPQGRAGAPGSPGLGGQKGDQGMPGKPGNPGAAGLRGAPGARGDYGERGEPGAPGRDGSPGQRGVPGVPGIPGL------AGMQGEPGAQGPMGADGKRGAP---GAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSPGPSGPKGDSGEPGQQGPRGTQGSDGKRGANGNPGIPGVPGDAG 713          

HSP 4 Score: 174.481 bits (441), Expect = 1.180e-43
Identity = 308/916 (33.62%), Postives = 376/916 (41.05%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGH---DGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIG------------------KPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGP---RGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPE---------------------------GASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL------------GLRGLPGDKGEPGTDGEEGQRG------------DKGL---------------------------------LGDFGI------------MGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGL------PGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGN--------------QGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGL---------PGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKG------------EQGYMGP------------NGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQ 3443
              G IG  G KGQ+GP G  G  G              G  G RGP+GN+G +G  G +GP G+ G    DG+ GP GE G  G +G  G  G               D+G+ GP G  G  G                   PG++G +G  GL G  G  G KGA GE+G  GP G  G  G  G  G  G  G PG P              KGD G  G  G  GA G  G  G +G+ G +G QG +GP   RG  G+ G  G DG+TG  G  G  GL G +G  G PG +                           G  G+ G+IGP G  G  G  G  G+KGD G   + G  G  G+ G  GAPG  G  G  G+ G  G  G+PG RG PG  G+ G  G+ G  G  GP G  G  G  G  G +GP+G+ GK G +G  G  G  G+ G+ GE G +G  G PG  G              G  G PG +G  GT G +G+RG            D GL                                 +GD G             +G  GP GP G++G+SG  G  G  G  G +G  G VG+ G QG  GPDG  G+      PG  G  G +G RG PG  G  G  G                    G +G  G +G PG  GPRG               QG  G+ GR G PG+ G  G QG +G  G  G  G  G+ G RG  G+PG  G+         PG  G  G +G  G+QGP+G+ G  G  G  G  G  G  G  G  G++G  G PG QG +G +G            E G  G             NG  GP+G  GD       G PGP G+PG  GRQ
Sbjct:  213 QPGAIGSPGPKGQQGPQGAEGFKGD------------RGLIGRRGPKGNLGEKGEKGAEGPGGVEGKNGTDGAAGPAGEPGADGPRGSPGALG---------------DQGERGPAGAPGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAGRNGAGGDKGARGENGPAGPQGRPGAAGRQGDPGRDGAPGAPGKPVSTASNSESPDHIAKGDAGRAGPQGPQGAEGRTGRRGSLGERGGKGPQGSRGPVGPRGANGVPGSPGADGDTGEAGEHGADGLKGDRGADGLPGEDGIPGPRGPSGPTGPPGPDGKDGQKGEAGRDGENGQIGPQGRAGAPGSPGLGGQKGDQG---MPGKPGNPGAAGLRGAPGARGDYGERGEPGAPGRDGSPGQRGVPGVPGIPGLAGMQGEPGAQGPMGADGKRGAPGAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSPGPSGPKGDSGEPGQQGPRGTQGSDGKRGANGNPGIPGVPGDAGLTGPRGVPGPPGRPGDDGMRGPDGPVGPPGDVGEMGDTGSNGDPGDDGDPGELGNIGPAGPEGIKGASGSPGGIGPPGAPGAVGRPGPVGLPGPQGPAGPDGDHGMDGAKGDPGAAGVNGLRGPRGKPGRNGKDGSRGK------------------RGEDGRPGAVGPPGKTGPRGKPGLQFGKELMFVCWQGDPGEPGRDGTPGAIGPQGPQGAQGSQGPAGSPGTDGIPGARGTPGQPGTAGVKGNKGYAGNPGTLGLEGLRGRTGAQGPIGDRGRSGPKGAAGEDGAEGAAGLVGDSGEKGYRGAPGRQGLQGKRGPEGDPGSPGGSGEAGDKGVDGPPGSPGPQGFNGARGPNGPKGDS------GRPGPRGFPGQDGRQ 1074          

HSP 5 Score: 166.777 bits (421), Expect = 2.665e-41
Identity = 232/644 (36.02%), Postives = 288/644 (44.72%), Query Frame = 3
Query: 2235 IGNPGPRGEP--GEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEI------GEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG---------EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGP------------------------QGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNG---------------QRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGL 3998
            IG PGP G+P    +G+ G  G  G  G  G +G  G+ G+ G  G +GP+GD G +G  GE GPSG  G+ G  G PG  G+ G  G  G  G +G  G +G  G  G  G+RG KG LG+ G  G  GP G  G  G+ G  G  GE G DGP G  G++G +G +G  G  G  GLPG        G+ G +G  G+ G  GP+GL G                      NG  G+ G  G  GP G QG  G  GRQG PG  G+PG  G         E  DH   G +G+ G  G +G  GR G  G  G  G  G QG +G  GP G  G+ G PG  G  G  G  G  G +GD+G  G+PG                         +G  G  GE G +GP G  G  G PG  G  G+ G PG  G PG  G +GAPG  G  G  G+PG  G+                         G+ G +G  G  GIPG  G QG+PG  G +G  GK               +G  G QG +G  G +G  G +G +GE G  G  G+PGE G  G  G  G                +GD G PG +G  G+ G  G+ G  G PG+ GV G+ GL
Sbjct:  131 IGPPGPPGKPVIRRVGIPGLPGKRGDRGTPGAKGPPGLAGEPGEPGTQGPRGDPGDVGEPGEAGPSGRNGANGTAGPPGVRGQPGAIGSPGPKGQQGPQGAEGFKGDRGLIGRRGPKGNLGEKGEKGAEGPGGVEGKNGTDGAAGPAGEPGADGPRGSPGALGDQGERGPAGAPGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAG---------------------RNGAGGDKGARGENGPAGPQGRPGAAGRQGDPGRDGAPGAPGKPVSTASNSESPDHIAKGDAGRAGPQGPQGAEGRTGRRGSLGERGGKGPQGSRGPVGPRGANGVPGSPGADGDTGEAGEHGADGLKGDRGADGLPGEDGIPGPRGPSGPTGPPGPDGKDGQKGEAGRDGENGQIGPQGRAGAPGSPGLGGQKGDQGMPGKPGNPGAAGLRGAPGARGDYGERGEPGAPGR------------------------DGSPGQRGVPGVPGIPGLAGMQGEPGAQGPMGADGK---------------RGAPGAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSPGPSGPKGDSGEPGQQGPRGTQGSDGKRGANGNPGIPGVPGDAGL 714          

HSP 6 Score: 58.151 bits (139), Expect = 3.231e-8
Identity = 85/255 (33.33%), Postives = 106/255 (41.57%), Query Frame = 3
Query: 3276 KFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGP---------QGEPGLKGVKGELGLPGQDG 4013
            + G+PG  G +G +G  G  GP   PG  G PG+ G  G  GDPG +G PG  G  G  G  G  GP G  G+                            G +GS G  G +G  G  G +G  GL+GR G                         +GN GE G +G  GP G+ G+ G  G  G  GE G  G +G  G  GD G  G  G  G  G PG  GP         QG+PG++G  G  GL G++G
Sbjct:  144 RVGIPGLPGKRGDRGTPGAKGP---PGLAGEPGEPGTQGPRGDPGDVGEPGEAGPSGRNGANGTAGPPGVRGQ---------------------------PGAIGSPGPKGQQGPQGAEGFKGDRGLIGRRGP------------------------KGNLGEKGEKGAEGPGGVEGKNGTDGAAGPAGEPGADGPRGSPGALGDQGERGPAGAPGPQGLPGTAGPPGLPGDGGVQGDPGIEGESGPTGLAGRNG 344          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO49368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG67])

HSP 1 Score: 189.889 bits (481), Expect = 2.186e-50
Identity = 236/758 (31.13%), Postives = 327/758 (43.14%), Query Frame = 3
Query: 2634 GLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFV---PRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFL-KSQNESEWWLSKLKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            G  G+ GP+G +G  G  G  G  G+VG RG QG  GP G  G  G+ G+    G+ G PG                              ++G KG  G PG QG +G  G  G+ G++G P   G PG+ G     G PGP G  G++G  G  G  G  G PG +G+ G QG +G +G  G  G  G PG+ G  GP+G +G  G  G+QG+            +G  G +GP G PGP G PG  G +G  G PG  G  G+ G  G PG  G  GP G PG  G                     P G  G  G +G  GP+G              G  G PGKPG+ G+ G  G  G  G+ G  G  G  G+ GL G RG SG AG  G  G PG  G  G  G  G  GD G  G  G IG  G PG  GP G  G  G +G  G PG  G P  +  +   +    F         +Q  +   ++    ++   +V  I AV+N L  +       +  Y +  G+K  P+RSC+++ ++ N    SG+++IDPN GS SD+    C F+     TC+  + +     +TR L  + N  + W+++  D       KI +     Q+ FL+ +H  A+Q +   C  S  + DS        I++   N+ ++ +             L E + KD+   +    T   I+   KD   LPIID+   D  +  Q        VCF+
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKN---GQDGRPG------------------------------YDGAKGERGAPGKQGKQGVSGEKGNQGKRG-PAGAGIPGDDGR---QGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGE------------RGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKG---------------------PRGEKGAKGDRGSKGPKG--------------GASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRGPIGPQGDPGPEGPPGPPGPPGPPVSVNKLSHCIPYIIFAITGDNNANKQMFEESVSSTKQQLICFLDVCLI-AVINLLINK-------IVTYKEQEGTKGKPARSCRNLKID-NPDKKSGYYYIDPNEGSPSDAEEVWCDFTTN--ATCVFPKNTEI---ITRSLVVNSNGEDTWITENDDV------KIDYKLDVVQMKFLRLMHKTAKQNMTYHCYNSRAWEDS------RTIKLLGDNEEEITAKL----------RLNECQNKDNQWHK----TVLDISTKQKD--KLPIIDVAPYDLQDGAQFK-IELGPVCFA 631          

HSP 2 Score: 153.295 bits (386), Expect = 2.377e-38
Identity = 162/388 (41.75%), Postives = 199/388 (51.29%), Query Frame = 3
Query: 2166 GSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDG---DRGPAGPKGPQGDIGKIGLQGEIGPSG--LKGSMGLRGEPGQIGESGF---PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPG-SQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQG 3302
            G  GAPGP G QG+ G +G++G  G  GPRG+ GE G  G  G  G  G +G  G  G DG   +RG  G +G QG  G+ G QG+ GP+G  + G  G +G PG  G  G    PGF G  G  G PG  G+ G  G +GQ+GDKG  G  G+ G  G  GP G RG+ G  G +GE G  G +G  GS G  G  G  G  G  G PGE G++G+ G  GLPG                                G  G  G PGL+GPRG +G+ GD G +G  G + G PG+ G  G+ GIPG  G+ G  G  G  GRPG+ GLPG  G++G  GEKG+    GE G  G PG  G  GP G  G  G  G  G+ G PGP+G
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPG------------------------------RPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGAN---GEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRG 355          

HSP 3 Score: 148.673 bits (374), Expect = 8.650e-37
Identity = 158/361 (43.77%), Postives = 192/361 (53.19%), Query Frame = 3
Query: 2067 GFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM-----DGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPG---QIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIK-GPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILG 3122
            G  G +G +G  G KGD G  G +GP G    QG  G  GP G +G  GK G+ G  G  G +GE G  G QG+ G+ G  GN G +G  G      DG +GP GP+G +G  G  G  G+ G +G  G  G RG  G   Q G+ G  G  GL G+ G PG +GE G DG+ G++G++G +G+ G  G PGP G  G+ G +G +G  GE G     G  G+ G+ G  G+ GP G  GL G  GEKG KG RG  G K G SG  G PG  GN GI G  G  G +G  G+ G  GL GL G RG  G  G+ G  G PGS GSPG  G     G PG SG  G +GI G  G PG  G
Sbjct:    4 GAPGPQGSQGVPGTKGDRGEPGAVGPRG---QQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQ---GSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGA---MGPPGDSGSKGAAGIIGEPGSPGPRG 355          

HSP 4 Score: 145.206 bits (365), Expect = 1.029e-35
Identity = 157/398 (39.45%), Postives = 191/398 (47.99%), Query Frame = 3
Query: 2301 GRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGD--FGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPG------ILGLPGFSGETGYQGEKGSQGPVG-EVGILGKPGLG------------GYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKG------ISGEVGDPGP 3413
            G+ G  GPQG  G+ G +G    +G  G +G  G QGE GP+G     G +G+ G+ G+ G PG+ G  G RG PG +G+ G  GE+G +G +G  G    G  G  GP GP G RG +GP G  G+ G +G  G  G  G +G QG            + G+KG  G RGLPG+ G  G  G                        ++GN G PG QG RG   + G+VG  G PG  G PG  GE G  G PG  G+ G SG  G+ GRPG        GL G  GE G +G++GS+GP G   G  GKPGL             G  GP G  G+ G  G  G  G  GP G KG  GE G  G  G PG  G PGD G      I GE G PGP
Sbjct:    1 GKSGAPGPQGSQGVPGTKGD---RGEPGAVGPRGQQGEEGPTG---PAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQG------------QKGDKGGAGARGLPGVAGTPGPQG------------------------ERGNDGKPGEQGERG---AVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGP 353          

HSP 5 Score: 132.494 bits (332), Expect = 1.550e-31
Identity = 149/364 (40.93%), Postives = 179/364 (49.18%), Query Frame = 3
Query: 1806 GEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGIT---GLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFP------------------GPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSG 2834
            G PG  G+ G  G KG  G  G  G RG QGE+GP G     G  G  G DG  G  GA+G RG  G +G+ G  G +G  GK G  G  G  GD+G++G  G +G     G+ GP G  G +G++GAPG  G +G  G +G+KG  G  G RG PG  G  G  G  G DG  G QG+ G  G+ GP G  GP    G+ G+ GE   +G  G+ G RG+ G  G SG PG  G  G  G PG KG  G  G +G RG KG  G  G  GFP                  G  GP G  G  G  G+ G  G  GP G  G+ G  G  G+ G  G +G PG+ G KG  G  G PG  GP G
Sbjct:    4 GAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAG-AGIPGDDGRQGPPGPQGSR---GVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGP---AGQPGVSGE---AGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKG--GASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRG 355          

HSP 6 Score: 129.798 bits (325), Expect = 1.068e-30
Identity = 149/376 (39.63%), Postives = 185/376 (49.20%), Query Frame = 3
Query: 1941 GVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRG------FSGEKGDSGPVGLIGPIGAIGSQGSHGAPGP--IGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGP----LGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG 3032
            G  G  GP G++G+ G  G +G+ G  GP G  G+EG  GP G  GD GK G      + G KG+ G  G  G  G  G +G+ G  GP   G+ G  G++G  G  G+ G  G PG  G +G  G  GR G+ G QG  G  GD+G AG +G  G  G  G QGE G  G  G  G RG  G++G +G PG  G  G+    G+ G  GT GE GQ+G  G  G  G  G PGP G  GL+G  G +G KG+ G+ GP     GF G  G+ G+ G  G  G  G  G  GE G  G  GLPG++G SG  G  G                   NG+ G+ G PG  G  G  G  G  G  G+ G  GSPG +G
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVS---GEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGA------------------NGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRG 355          

HSP 7 Score: 123.25 bits (308), Expect = 1.149e-28
Identity = 140/337 (41.54%), Postives = 162/337 (48.07%), Query Frame = 3
Query: 1800 DQGEPGGIGN---------TGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETG------PIGA-----EGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGD---SGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPG---EIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGP---KGPQGDIGKIGLQGEIGP----SGLKGSMGLR------------GEPGQIGESGFPGFYGLLGLRGL------------PGDKGEPGTDGEEGQRGDKGLLGDFGIM---GFPGPRGP 2630
            D+GEPG +G          TG  GPKG  G  G++G  G  G KG RG  G  G +GV GE G      P GA     +G +G  GP+G  G  GP G +G +G  G PG  GD G +G  G+KGD   +G  GL G  G  G QG  G  G  G QG  G  GE G  G+PGP G+PG   E G  G  G  G+ G+SG  G  G  G  GPAG    KGP+G+ G  G +G  GP    SG  G  GL             G+ G  GE G PG  GL GLRG             PG  G PGT G  G  GD G  G  GI+   G PGPRGP
Sbjct:   20 DRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRGP 356          

HSP 8 Score: 116.316 bits (290), Expect = 1.791e-26
Identity = 152/434 (35.02%), Postives = 189/434 (43.55%), Query Frame = 3
Query: 2472 GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQ---GEKGSQGPVGEVGILGKP------------GLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLK---GEQGYMGPNGYPGP----HGLPGDKGISGEV---------GDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPG 3680
            G+SG PG  G  G+ G  GD+GEPG  G  GQ+G++G            P GP      +GP+G  G+ G DG  G+ G+ G RG             PG+ G++G  G++G  G +GP+G                             G  G  G QGP G QGS G  G  G  G +G+ G  G  GD G  GP G+ G  G  G  G PG+ G PG  GE G     GE+G +G VGEVG  G P            G  G  G RG +G +G  G  G+ G PGP GA GLK   GE+G  G  G  GP     G PG  G+ G           GD GP G  G  G  G PGL G +GP G+ G  G+                         G+ GS G  G  G PG  G++G  G++G  G PG
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEG------------PTGP------AGPKGDAGKNGQDGRPGYDGAKGERG------------APGKQGKQGVSGEKGNQGKRGPAGA----------------------------GIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGE------------------------PGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPG 352          

HSP 9 Score: 100.523 bits (249), Expect = 1.666e-21
Identity = 145/380 (38.16%), Postives = 184/380 (48.42%), Query Frame = 3
Query: 1230 GRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM---RGNTGEQGP-----PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGI---RGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI 2336
            G++GE+G  GP G  GD GK G+ G+ G  G  G  G  G +G  G+   +GN G++GP     PG  G  G PGP+G RG+TG  GF G  G +G PG  G      DRG  GP+G +G+ G  G +GL G+ G  G  GE+G+ G  GE                                              G++G  G +G TG+ GP G  G  G+ GA G  GE+G +G +G +GL G  G  GP GA G+   RG  G KG  G  GP+G  G  G  G PG  G+ G  G  G  GD GP G  G  G  G  G  G  GP G +G  G+ G  G+ G PG  G PG+ G +G  GIIG  G+ GP+G I
Sbjct:   31 GQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAG------DRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQ---------------------------------------------GERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKG--GASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGEPGSPGPRGPI 357          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000007336.2 (collagen alpha-1(XI) chain [Source:NCBI gene;Acc:101162214])

HSP 1 Score: 312.383 bits (799), Expect = 6.972e-86
Identity = 383/1172 (32.68%), Postives = 518/1172 (44.20%), Query Frame = 3
Query: 1842 GPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDG-------ETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPS---------------GLKGSMGLRGEPGQIGESGFPGFYG---------------LLGLRGLPGDKGEPG-------------------TDGEEGQRGDK------------GLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGN---------------LGPDGYI---GLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGI------------------PGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAP-GLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGK------------------EGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKII----------DIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNV------------PSIGAV-LNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLK--------DQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCFS 4895
            G  G  G+ G +G  G+ GEKGP+G  G+ GL G+DG         GP G +G++GL G +G IG+PG  G  G +G  G  G  G++G+ GF G KGD         +G  G +G +GAPGP G  G  G +G+ G++G+PG  G  GE G  G  G+ G  G  G +G +G  G  G  G KG +G  G+ G  G+ GP+               G KGS G  G PG  GE G  G  G                 GL G PG +GEPG                     GE G  GD+            GL G  G  G  G  GP G  G SGP G+KG  G  G  G +G  G++G +G                 GP G I   G PG +G  G  G++G PG KG +GL G                      +G+ G  GLPG+ GP+G  G DGD G  G PG +GS G++GE G  G                   PGP G+ GL+G +G  G  G  G  G SG  G  G  G +G  G VG +G PGL G +GP+GP G  G  G  G+ G+ G +GAKG  GE+G  G  G  GP G  G  G  G  G+ GPIG+PG++G  G P G  G  GP G  G+ GK G  G  G+ G  G  G  G +G +G  G QG  G +G  G +G  GKPG VG  G PG+P                        G  G+RG+ GP   +GE G+ G                   +G PG +G KG  G+ G  G PG PG++G  G  G  G  GP+G+ G  G K      G  GEPG+I  I             +      P   +   R  +           NNV            P   A  +  +F  L  +   V    + +G+ E+P+R+CK++ M   +      +WIDPN G   DS+   C F+    +TC+     +    L  + K +  S  W S+ +        D++G  +  +       Q+ FL+ L + A+QT    C+ S  +FDST  +Y+ A+++RA ND +L         ++A +  + + + D C ER        + + A     LPIID+  +DFG   Q  G+    VCF+
Sbjct:  492 GSPGVQGFPGAQGPIGLPGEKGPQGKPGILGLPGIDGPPQGHPGREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGD---------MGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLGFLGAPGVLGEKGRRGPAGQPGSGGQRGPNGARGGRGARGPTGKPGEKGSAGQDGPPGSPGEQGPQGPQGRNGETGPKGPNGPPGKDGLPGHPGQRGEPGFQGKNGPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAG---------------------RDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEKGESGHVGSMGPPGLHGPRGPQGPIG--GEPGGVGQPGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPGGADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKPGPVGPQGQPGRP------------------------GPEGLRGIPGP---AGEHGLNGPPGQIGPPGPIGPPGLPGFKGDPGRVGDKGHGGLIGLIGPPGEPGEKGDRGLPGIQGLQGPKGDEGAAGEK------GSKGEPGVIGSIGDPGPAGPPGPPGLPATMIEPLPFREGRRKRRRQARRAASAKENNVDLHKEGPLQREQPLEDAEGMEEVFATLSSMKNEVELMRRPIGTFESPARTCKELLM--VQPNFKDDYWIDPNQGCHKDSLRVFCNFTAGG-ETCLYPDKRTETVKLASWNKEKPGS--WYSQYRRGKQFSYSDRDGNPVHVV-------QLTFLKLLSATAKQTFTYNCQNSAGWFDSTSSSYQHALRLRASNDEEL---------TQAKSPFITV-VHDGCQERTV------LEIAAPSAELLPIIDVAPEDFGKNSQKFGFQVGHVCFN 1570          

HSP 2 Score: 191.43 bits (485), Expect = 2.053e-48
Identity = 319/883 (36.13%), Postives = 393/883 (44.51%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGK---------RGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSG-PQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGY---------------------IGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGL----------------------------------------PGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGL------------------------SGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGP---------------NGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQ----GKPGLVGR------IGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEA----GITGKEGLPGELGIKGLQ---------------GVNGQRGDPGLPGDRGKIGSIGP---PGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            +G PG +G TG  GP G  G  G +G RG  G  GPRG+ G  G+ G  G+ G  G +G+ GL G KG  G  GP G  G+ GE GP G +G +G          RG  G +G  G   L GP G IG  G  G+P   G+QG  G +         GP G PGE G QG+ GI+G  G  G PQG  G +G  G  G +G  G  G IG  G  G  G  G  G++G  G+ GE GFPG  G +G++G  GD G PG  GE+G  G KG  G  G  G PG  G  G  G  G  G  G  G  G LGF+G+ G+ G +G  GP G                       G PGE G  G  G  G PG +GP G  G  G  G +G  G PG  GL GH G +G  G                                          GL G  G +G+ GD G  G  G  G PG +G +G  G PG  G  GL                        +G  G  GRPG +G  G  GE G  GEKG+ G  G  G  G  GL G  GP+GP G+   +GD+G+ G PG +G+KG KGE G  GP               +G PGP    G +G++G  GD GP G+    G  G  GL G+ GP G+ G+ G                          G++G  G +GPRG  G IG +    G+PGLVG       +G  G  G  G  G  G +G+ GE G +GN G  G  G +GP G  G A    G  G  G PG+ G  G                 G  G+ G  G+ G +G  G++GP   PG VGPQG+PG  G +G  G+PG  GE GL
Sbjct:  361 KGPPGPLGLTGRPGPLGVPGTSGLKGDRGNDGPPGPRGLPGTPGIHGKPGKRGDRGFDGLPGLPGDKGHRGPQGPLGPRGQPGEPGPRGLVGPKGPLGPPGQPGIRGIDGVQGSKG--NLQGPPGEIGPPGQQGSP---GVQGFPGAQ---------GPIGLPGEKGPQGKPGILGLPGIDGPPQGHPGREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLGFLGAPGVLGEKGRRGPAGQPGSGGQRGPNGARGGRGARGPTGKPGEKGSAGQDGPPGSPGEQGPQGPQGRNGETGPKGPNGPPGKDGLPGHPGQRGEPGFQGKNGPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGE---DGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPR---GQQGLNGPKGDEGPRGF---KGASGPSGLQGMPGPPGEKGESGH------------------------VGSMGPPGLHGPRGPQGPIGGEPGGVGQPGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPGGADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKPGPVGPQGQPGRPGPEGLRGIPGPAGEHGL 1196          

HSP 3 Score: 172.94 bits (437), Expect = 1.032e-42
Identity = 271/772 (35.10%), Postives = 337/772 (43.65%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGP---KGQIG------------------------FPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSG---------------PVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK------------GAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQ-GDIGMDGDR---------------GPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGF---------------------PGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRG-ITGRPGILGLPGFSGETGYQGE---------------------------KGSQGPVGEVGILGKPG-LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEV---GDPGPIGYPGNIGRQGAPGLVGVTGPIGK---------------------------PGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRI 3668
            QG PG  G  G  G +G  G  G  G +G +GEKG  G  G+ G  G+ G+ G  GA G RG DGP   KGQ G                        +PG +GA G  G +G PG +G++G+RG +G+ G  G               P G  G  G+ G  G  G+PG  G QG  G+ GE             G  G+PG RGEPG  G  G  G  G  G    + G+IG  GDR               G AG +G +GD G +G  G+ GP GLKG  G RG PG +G +G                       G  G +G  G PG  G  G  GE+G+ G+KG  G  G  G P   GP GL G +GP+G  GE G+ G  G  G  G +G +G  GP G  G+ G +G  G  G  G PG +G  GL                        NG KG+      +GPRG +G+ G  G QGMP   G PGE+GE G  G  GP G  G  G +G I G PG +G PG  GE G +G                            KG+ GP+G  G LG PG  GG  G  GPKG  G  G  G  G  G  G  G  G +G++G  G  G  G+ G KG +G +   G PGP+G  G  GR G  GL G+ GP G+                           PG+VG +G  G  G  G  G  G  G  GL G  G QG  G  G  G+ G++G+PG++G I
Sbjct:  546 QGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLGFLGAPGVLGEKGRRGPAGQPGSGGQRGPNGARGGRGARGPTGKPGEKGSAGQDGPPGSPGEQGPQGPQGRNGETGPKGPNGPPGKDGLPGHPGQRGEPGFQGKNGPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRDGEP---GPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGL------------------------NGPKGD------EGPRGFKGASGPSGLQGMP---GPPGEKGESGHVGSMGPPGLHGPRGPQGPIGGEPGGVGQPGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPGGADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKPGPVGPQGQPGRPGPEGLRGIPGPAGEHGLNGPPGQIGPPGPIGPPGLPGFKGDPGRVGDKGHGGLIGLIGPPGEPGEKGDRGLPGIQGLQGPKGDEGAAGEKGSKGEPGVIGSI 1281          

HSP 4 Score: 171.785 bits (434), Expect = 2.177e-42
Identity = 307/841 (36.50%), Postives = 380/841 (45.18%), Query Frame = 3
Query: 1323 PMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGE---------------------TGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEI------------GPPGFIGDEGKRGFSGEKGDSGPVGLI-------GPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDG------------DRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLP---GDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLR---------------GSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL---QGPRGNQGSDGD------------------------VGRQGMPGSQGSPGE-------QGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGD---------PGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQ 3506
            P+G  G +GP+G  G+ G  G  GPP   GH G  GP GE+GL G  G  G  G  G  G +G  G+   RG  G +G +GE G PG++G  G+KG  GD G  G +G  G +                                    G  G  G  GD G PG  G  G LG  G  GY G++GA+G  G  G  G+ G  G RG  G+                     TG  G +G  G DGP G  G  GP+G  G+ GE             G PG  G  G+ GF G+ G  GP G++       G IG  G +G  G+PGP G QGL G  G++GA G+PGP G  G+ G  G  G  G  G  G  G  G+ G              G  GP GP G IG+ G  G +GP+   G MG +GEPG+ G +G  G  G  G  GLP   G +G PG DG++G+ G  G  G  G  G  GP GP G++               G  G +G+ G  G++GP GF G+ G  G QG  GP      PGE GE G  G  G PG+ GP G  G                       G+ G +G PGL   +G +GN G  GD                        +G  G PG  G PGE        G KGD+G PG +G TG SG  G  G PG  G  G +G+ G QG KG++G  G +G +GKP      GP GP+GQ G  G +G  G+PGP G  GL G  G +GP G  GP GLPG KG  G VGD          GP G PG  G +G PG+ G+ GP G  G  G++
Sbjct:  505 PIGLPGEKGPQGKPGILGLPGIDGPP--QGHPGREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGV---RGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPE------------------------------------GPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLGFLGAPGVLGEKGRRGPAGQPGSGGQRGPNGARGGRGARGPTGKPGEKGSAGQDGPPGSPGEQGPQGPQGRNGETGPKGPNGPPGKDGLPGHPGQRGEPGFQGKNGPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPA---GPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGP------PGEKGESGHVGSMGPPGLHGPRGPQGPI--------------------GGEPGGVGQPGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPGGADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKP------GPVGPQGQPGRPGPEGLRGIPGPAGEHGLNGPPGQIGPPGPIGPPGLPGFKGDPGRVGDKGHGGLIGLIGPPGEPGEKGDRGLPGIQGLQGPKGDEGAAGEK 1269          

HSP 5 Score: 132.494 bits (332), Expect = 2.343e-30
Identity = 262/714 (36.69%), Postives = 323/714 (45.24%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNG------------MKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDG------------------ETGPIGA------EGIRGLDGPKGQIGFPGPEGAS---GKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGE------PGTDGEEGQRGDKGLLGDFGIMGFPGPRGPT----GLRGSSGPEGIKGELGNDGPLG---------------FIGSVGIRGHQ---------GNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIP------GPSGKTGLSGIRGITGRPGILG 3122
            +G  G +GE G +GP G  G +G  G  G  G  G +G  G  G  G  G +G+ G  G PG++G  G  GP G+ G  G +G  G  G  G  GP G PG  G  G+ GP G  GE G  G QG NG              GL G  G++G  G  G++                 G    ++G  G  G  G  G  G  G  G+QG PG  G  GA G  G +G  GK G  G++G +G RG  G  G  G+ G                    GP GA       G  G  GP G+ G PG +G +   G++GE GP G  G  G +G  GE GD G  G  G  G+ G +G  G  GP G+QG +G  G  GA G PGPRG+ G  G +G  G  G  G SGP G  GM    GP G KG  G +G +G  G  GP G +G +G  GEPG +G+   PG  G  G +G  G+KG+       G  G  G  G+ G  G+ G +GFPG  GP     G  G+ GP+G  GE G  GP G                +G+ G  G Q         GNLGP G  G  G  G+ G  G  GL GI GP+G  G  G  G  G  G  G  GL G  GD G +               GD G  G+ G  G PGE GEKGD G+P      GP G  G +G +G  G PG++G
Sbjct:  600 NGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLGFLGAPGVLGEKGRRGPAGQPGSGGQRGPNGARGGRGARGPTGKPGEKGSAGQDGPPGSPGEQGPQGPQGRNGETGPKGPNGPPGKDGLPGHPGQRGEPGFQGKN-----------GPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMP---GPPGEKGESGHVGSMGPPGLHGPRGPQGPIG--GEPGGVGQ---PGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPGGADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKPGPVGPQGQPGRPGPEGLRGIPGPAGEHGLNGPPGQIGPPGPIGPPGLPGFKGDPGRV---------------GDKGHGGLIGLIGPPGEPGEKGDRGLPGIQGLQGPKGDEGAAGEKGSKGEPGVIG 1279          

HSP 6 Score: 99.3673 bits (246), Expect = 2.426e-20
Identity = 202/597 (33.84%), Postives = 244/597 (40.87%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQK----------------GPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGP---------KGFIGYVGKEGARGVQGEKGPRGITGLT------GLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK---------------------GAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQ------------GDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTD---------------------GEEGQRGDK------------GLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSV 2714
            H G  G  G +G+                 G  G  GD G  G  G  G  G  G  G  G +G+ G  G +G+ GPPGL G       +G RG  G  G  G  G +G PG  G  G  G+RG  GP G  G+ G+PG  G  G  G  G+ GEKG  G  G D                                                GEPG  G  G  GP         KG  G  G++G++G +GE GP G  G+       G  G DGE GP G +G+ G  G +G  GF G  G SG +G  GPPG  G+ G  G  G  G  GP G  GPIG  G  G  G PG +G +G  G  GEK                     G  GN GP G PG++G  G+ G  G DG  GP+GD G  G  GP G  G              G  GK G QG  G  G  G++G  G+PG +G  G PG  G  GLRG+PG  GE G +                     G+ G+ GDK            G  G+ G  G PG +   GL+G  G EG  GE G+ G  G IGS+
Sbjct:  746 HPGQRGEPGFQGKNGPPGPPGVVGPQQGKSGEIGPTGDRGHPGSPGPPGEQGLPGTAGKEGAKGDPGPLGASGKSGPPGLKGF------RGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRD------------------------------------------------GEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEKGESGHVGSMGPPGLHGPRGPQGPIG--GEPGGVGQPGLVGEKGAKGNVGEKGDAGAPGAAGPPGPRGVPGEDGPKGNLGPIGFPGDLGPPGEPG--GADGAPGPKGDNGEPGKAGPTGASGEPGPPGPPGRRGHVGAAGKEGKQGMKGAKGATGNLGPMGKPGPVGPQGQPGRPGPEGLRGIPGPAGEHGLNGPPGQIGPPGPIGPPGLPGFKGDPGRVGDKGHGGLIGLIGPPGEPGEKGDRGLPGIQ---GLQGPKGDEGAAGEKGSKGEPGVIGSI 1281          

HSP 7 Score: 78.1814 bits (191), Expect = 8.450e-14
Identity = 119/360 (33.06%), Postives = 151/360 (41.94%), Query Frame = 3
Query: 3057 GPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPV------GEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKG------------------LKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQG------------APGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            GP G+ GL+G+ GI G PG L +  F     Y       GPV          IL +  L      +GP G  G  G  G  GVPG  G KG                  + G+ G  G  G+ G  GLPGDKG  G  G  GP G PG  G +G             PG+ G+ G  G  G +           +            G  G  G  G  GP G+PG+ G QGKPG++G  G+ G P                    +G  GE G++GL G +G  G  G  G +G  G  G+KG +G  G+ G PG+ GD G  G  G  G  GP+GE G +G KG+ G  G  G PG+ 
Sbjct:  304 GPPGRPGLAGVDGIPGPPGTLLMIPFK----YSAGDSQNGPVMSPQEAQAQAILQQSRLS----LKGPPGPLGLTGRPGPLGVPGTSGLKGDRGNDGPPGPRGLPGTPGIHGKPGKRGDRGFDGLPGLPGDKGHRGPQGPLGPRGQPGEPGPRGLVGPKGPLGPPGQPGIRGIDGVQGSKGNLQGPPGEIGPPGQQ-----------GSPGVQGFPGAQGPIGLPGEKGPQGKPGILGLPGIDGPPQGHPGR--------------EGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIA 630          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1a2 (collagen type I alpha 2 chain [Source:NCBI gene;Acc:105355091])

HSP 1 Score: 283.493 bits (724), Expect = 3.303e-77
Identity = 353/1094 (32.27%), Postives = 477/1094 (43.60%), Query Frame = 3
Query: 2001 KGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGM------------DGDRGPA------------------------GPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIG---------------------------LPGEIGEKGT---KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDV---------------GRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGG---YQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGE---------------------QGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGL------------------VGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLK-GVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD------QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            +G  G PGP+G  G  G  G PG  G +G  G  GE+G  GP G IG  GA G++G+ GAPG    +GL G EG  G IG PG RG  G  G +G  G  GR G  GP G  G+            +G  GP+                        GPKGP G+ GK G +G  GP+GL      RG PG  G +G     G +G  G PG+KGE G  G  G +G  G  G  G  G PG RG  G +G SGP G KGE G +G      S G  G QG +GP G  G                           +PGE G  GT   KG++G PG KGP G  G  G +G  G  G PG  G  G  G+ G+ G  G  GPRG  G  G+V               G+ G  G +G  G +GE G  G  GP+G++G SG  G  G PG  G  G  G TG+ G  G  G  G+ GI+G PGL G     GPRG +G  G  G  G+ G+ GP G  G KG                      QG++G +G  G  G PG    +G VG+PG  G PG  G +G PG +G+ G  G  G+ G+ G  G +               G  G  G+ G+ G RG PG  G+ G  G                    G  G  G  GI G  G  G  G +GE G+ G+KGE G++GL G  G+ G  G +G  G  G  G  GL G  G  G  G PG  G+ G+ G  G  G +G PG                        D+  G  ++   +   +A+D +                + A +  L T++E L  L  +     GS++NP+R+C+DI +  +   +SG +WIDPN G ++D++   C F+ +E  TCI +   S  +    +  ++N+   W  +  +       N +TL   +     +Q+ F++ L ++A Q I   C+ S+ Y D    + + A+ ++  ND +L +  + R        +  + ++D C       +   I         LPI+DI   D G  DQ  G     VCF
Sbjct:  336 RGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPG---SRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGL------RGPPGPDGNNGA---AGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNG------SPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPG---AAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPGND---------------GPPGRPGAAGFKGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPTGPAGIAGARGGAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSGPAGDSGPAGPNGLSGPRGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGFSGPAGPAGAPGLPGPPGPAGGGYDVSGGYDEYRADQPTLRAKDYE----------------VDATIKSLNTQIENL--LTPE-----GSRKNPARTCRDIKL-GHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRE--TCIYSHPESIAR-KNWYRSTENKKHVWFGETINGGTEFAYNDETLSPQSMA---TQLAFMRLLSNQASQNITYHCKNSIAYMDGESGSLKKAVLLQGSNDVELRADGNSRF-------IFSV-LEDGCTRHTGEWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355          

HSP 2 Score: 191.815 bits (486), Expect = 1.403e-48
Identity = 299/887 (33.71%), Postives = 362/887 (40.81%), Query Frame = 3
Query: 1824 GNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVG---------------------LIGPIGAIGSQGSHGAPGPIGL------------QGLIGKEGE------------------------------KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGL---RGLPGDKGEPGTDGEEGQRG------------DKGLLGDFGI------------------MGFPGPRGPT------GLRGSSGPEGIKGELGND------GPLGFIGSVGIRGHQGNLGPDGYIGLP---GEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQG------------------------MP---GSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTG---------------FEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI---GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGE 4016
            GN G  G  G  G  G +GARG  G  G  G+ G  G  G+DG  G  GA G +G  G  G  G PG  G  G  GE G PG  G  G RG  G  G +GP G                      IG  G  G QG+ G PG  G              GL G +G                               +G  G+PGP+G  G+ G +G+ G  G  G  GPQG+ G          +GP G+IG  G  G  G  G  GS GL G  G+ G  G PG  G  G    RG PGD G  G  G  G RG             +G  G  G                    GF GP+GP+      G RGS+GP G++G  G D      GP+G +G+ G +G QG  G  G+ GLP   G  GE G  G+RG+PG +G SG  G+                      G++G  G PG  GP+G  G  G  G  G                        MP   G+ G+PG +GEKG+ G  GP G +G  G RG+ G  G  G  G +G+   +GE GS GP G              GPRGP G+ G                +G  G  G  GP G KG  G  G  GP G  GP G  G  G  G  GD GP+   G+PG  GR GAPG  G+ G                              P GL+G  G  G  G RG PG  G  G+ G+VG  G+ G+ G  G  G  G  G  G +G  G +G  G+ G  G RG  G AG  G+ G  G  G  G +G  G  G PG+ G +G+ G  G PG  GP G PG  G KG+ G PG  G 
Sbjct:  139 GNNGRPGKPGDRGAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKGEPGAHGAAGSPGLAGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPGNPGANGLNGAKGAAGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGK---------RGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGA---------------------KGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGD---KGESGSFGPAGPA------------GPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVG------------------------------PPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGDRGEPGPAGS 950          

HSP 3 Score: 159.458 bits (402), Expect = 1.170e-38
Identity = 297/817 (36.35%), Postives = 353/817 (43.21%), Query Frame = 3
Query: 1941 GVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMD------GDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGE---------------PGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIK------GPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPN---------------------GYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGL---------------------------VGVTGPIGKPGKV---------------GKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGK------IGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGE------------------------LGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEP---GLKGVKGELGLPGQDGEPG 4022
            G DG  G  G  G RG  GP+G  GFPG             PG  G +G RG++G  G  G  G  G  G  G+ G+ G+PG  G +GL G+ G  G  G  G RG  G +G  G  G +G  G  G  G  G        G  GP+GP+G +G+ G  G  G +GP G  G+ GL G                 G  G  G  G  G  G RGL GD   PG  G +G  G KG  G+ G  G PGP+G  G RG +G  G  G  GN G  G  GS G+ G +G  GP   IG+PG  G  G+ G RG PG        GP+GL G PG+ G+ G  G+ G  G  G +G  G  G  G +G  GN G  G  G  G PG  G  G  G  G  G PGP G  G +G  G  G PG  G  G +G  G+QG  G  GP GE G  G+ G+ G QG  GP G  G  G  G  G  GPQG  G +G  G  G +                     G PG  G  G  G  GE G+PG  G  GN GR GA G+                            G  GP G+ G+V               G+ G  G  G  G KG  G SGP G +G  G  G  GP G PG       +G  G PG  GR+G PG+          G  G  G +G  G  G  G+RG  GP G SGE G+ G  G+ GE                         G  GL G  G RG PG  G  G+ G  GPPG  GP+G P   G+ G+ G  G  G+DG PG
Sbjct:  136 GDDGNNGRPGKPGDRGAPGPQGARGFPGT------------PGLPGMKGHRGYTGLDGRKGEPGAAGAKGEPGAHGAAGSPGLAGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPGNPGANGLNGAKGAAGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGD---PGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGP---IGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQ---------AGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPG 925          

HSP 4 Score: 152.525 bits (384), Expect = 1.481e-36
Identity = 244/603 (40.46%), Postives = 289/603 (47.93%), Query Frame = 3
Query: 1827 NTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGF------PGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKE---------------GEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGL---------------GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYP------------GNIGRQGAPGLVGVTGPIGKPG 3491
            N+G  GPKG  G  GK G RG  G  G RG  G  G  G  G  G +GA G +G  GP G  GF       GP G +GK GE G PG  G  G  G  GE+G +G  G  GP G IG +G  GAPG  G +G  G                 GE+GA G PGP+GE GE G +G       DGNSG  G  GM G  GP GP G  GD G+ G  G  GP+G +G  G RGE G  G  GF G  G  G  G  G++G  G  GE G  G  G  G  G  G  GP G  G RG +GP G+ G  G  G +G  G  GI G  G  GP G  G  G  G+ G  G  G  G+ GP G+ G  G+ G  G  G PG  G  G  G +G +GL G +G RG  G+ G VG  G  G  G+ G +G  G+ G+PG SG  G +   G  G PG  G PG  G  G++G++G  GP G +G+ G PG                 G  GP GP G  G  G  G  G  G +G  G KGE+G  G  G+PG  G+PG  G +G+ G  GP G              G  GR GA G +G  G  G PG
Sbjct:  485 NSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGP------DGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEA---GRDGNPGNDGPPGRPGAAGFKGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPTGPAGIAGARGGAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSGPAGDSGPAGPNGLSGPRGPAGPHGPPGKDGRAGAHGTIGAPGARGPPG 1078          

HSP 5 Score: 150.214 bits (378), Expect = 8.513e-36
Identity = 218/587 (37.14%), Postives = 263/587 (44.80%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQI------------------GFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRG---------------DKGLLGDFGIMGFPGPRGPTGLRGS---SGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLP------------------GFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVG 3401
            +G PG  G TG +G  G  G  G  G RG  G+ G  G  G  GLRG+ G  G  G  G  G  GP GQ                   GF GP+G SG+ G+ G  G  G  G RG  G  G++G  G +G +GA G +G  G  G  G QGL G  G  G  G PG RG PG+ G+ G  G  G  G +   G  G  G +GP GP+GP G  G  G +GE G +G  G+ G +G  G  GE G  G  G  G +G PG KG  G  G +G RG               DKG  G FG  G  GPRGP+G RG    +GP G  G  G DG  G  G  G  G +G  GP G  G  G+ G  G  G  G PG +G +G +G                             G PG  G  G  G  G VG  G+ G  G  G +G +GD G  GPSG+ G+ G  G++G  G  G P                  GF G +G +G++G+ G  G VG  G+ G  G  GPRGP G  G        G+ GPQG  G  G  G  GP G PG  G  GD+G  G  G
Sbjct:  399 RGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGLPGSPGSSGPPGKEGAAGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAVGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTN---GSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGL---------------------------TGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMP------GMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGDRGEPGPAG 949          

HSP 6 Score: 104.375 bits (259), Expect = 8.567e-22
Identity = 213/610 (34.92%), Postives = 249/610 (40.82%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK------------------------PGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVG------------------KEGARGV------QGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPE---GASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPV------GLIGPIGAIGSQGS---------------------HGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL---------------KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPG 2771
            G +G  GEKG++GP G  G  G        G  GP G  G  G RG  G +G +G  G  G  G +GSPG  G                               +G IGPRG  G  G                         PG +G  G  G  G+ GE GHKG  G  G  G  G  GP G PG  G+ G K                        GE G  G  G  GP+G  G  G                  + GARG       +GE GP G  G  G  G  G +GP GA G RG  GP G  GFPG     GA G+ G +GPPG  G  GK G  G +GD GP       G++GP G  G +GS                      G  G  G +G  G  G  GA+G PG  G PG  G +G  G IG  G SGPQG+ G DG+ G  GP G  G  G  G +GE GP+G                 G  G RGE G  G +G  G  G  G  G  G +GE G  G++G+RG KGL G  G+ G PGP GP G  G +GP G+ G  G  GP G  G  G  G  G +G  G  G PG
Sbjct:  529 GAVGAPGEKGEQGPAGAAGFQG------LPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGP------------------------------QGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDK------------------------GESGSFGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPTGPAGIAGARGGAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSGPAGDSGPAGPNGLSGPRGPAGPHGPPGKDGRAGAHGTIGAPGARGPPG 1078          

HSP 7 Score: 53.1434 bits (126), Expect = 3.184e-6
Identity = 164/459 (35.73%), Postives = 185/459 (40.31%), Query Frame = 3
Query: 1326 MGYFGFRGPRGNIGMRGNTGE---QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGL---------RGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDG---------EEGQRGDKGLLGDFGIMGFPGPRGPTGL 2639
             G  G  GPRG  G RG  G     G  G  G DG PG +GERG +G +G  G  GP GP             G+ GP G  G  G PG +G  G  GL G  G  G  GA G+ G                                               G PG  G  G  GP+G  G  G  G  G QG  GP G++G  G           G  G TGP+G +G  GL G +G  G PG  GA G+ G  GPPG  G  G  G  G  G SGP G  G  G  G+ G  G PG  G +G                RGEPG  G  G  G  G  G +G  G  G  G+ GPAGP GP G  G  G  G  GP G KG  G +GE G  G  G PG  G+ G  G  GD G  G +G           G  G  G  G  G +G PG RGP G 
Sbjct:  693 FGPAGPAGPRGPSGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPA------------GQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIV---------------------------------------------GPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDGNPGNDGPPGRPGAAGFKGD---------------RGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPTGPAGIAGARGGAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPSGPAGDSGPAGPNGLSGPRGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGF 1079          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1a2 (collagen type I alpha 2 chain [Source:NCBI gene;Acc:105355091])

HSP 1 Score: 266.544 bits (680), Expect = 3.547e-72
Identity = 355/1161 (30.58%), Postives = 477/1161 (41.09%), Query Frame = 3
Query: 1875 EGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIR---------------------GLDGPKGQIGFPGPEGASGKEGEIGPPGFIGD---------------------------------EGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGE---KGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKG---------------------SMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEE-----------GQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIG---------------------------------LPGEIGEKGT---KGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGL---GGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGE---------------------QGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPAQASSRGKPLTRFLKSQNESEWWLSKLKD------QNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            +G RG+ GE+G  G  G  G RG DG  GP G  G                       G  GP G  G  G  G++G  G +GPP  IG                                   G RG SG+ G  G  G  GP G  G+ G  GAPGP G +G  G  GE    GA GN G RG PG  GL G       +G +GP G  G  G  G AGP+GP GD G+    GE GP+GL+G                     + G  G  G  GE G PG  G  G  GL   +G PG DG             G++G++G  G  G  G PGP GP G  G  G  GI G+ G  GP G  G  G  G  G  GP G IG                                 +PGE G  GT   KG++G PG KGP G  G  G +G  G  G PG  G  G  G++G +G  G  G  G  G+DG  G +   G +G  G +GE G  G  GP+G++G SG  G  G PG  G  G  G TG+ G  G  G  G+ GI+G PGL    G  GPRG +G  G  G  G+ G+ GP G  G KG                      QG++G +G  G  G P   G +G VG+PG  G PG  G +G PG +G+ G  G  G+ G+                     + L+                  G +G+PG  G +GL G PG  G  G  G  G +GE+G  G +GE G+ G  G RGM G  G  G +G+PG         V+G  GD G                     + G  G  G +G PG  G PG               P        D+    D        + P++ A    +   ++ L+  +       GS++NP+R+C+DI +  +   +SG +WIDPN G ++D++   C F+ +E  TCI +   S  +    +  ++N+   W  +  +       N +TL   +     +Q+ F++ L ++A Q I   C+ S+ Y D    + + A+ ++  ND +L +  + R        +  + ++D C       +   I         LPI+DI   D G  DQ  G     VCF
Sbjct:  158 QGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPVSIGKCSFSAKFGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGS------EGRTGPIGMPGARGSTGSAGPRGPPGDAGRA---GEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGL---RGPPGPDGNNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGAR---GERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTP---GAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRD--------------------VSLN------------------GDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPS-------VSGPAGDSGPGPAGPHGPPG----------KDGRAGAHGTIGAPGARGPPGFSGPAGPAGAPGLPGPPGPAGGGYDVSGGYD----EYRADQPTLRAKDYEVDATIKSLNTQIENLLTPEGSRKNPARTCRDIKL-GHPEWSSGFYWIDPNQGCINDAIKVFCDFTTRE--TCIYSHPESIAR-KNWYRSTENKKHVWFGETINGGTEFAYNDETLSPQSMA---TQLAFMRLLSNQASQNITYHCKNSIAYMDGESGSLKKAVLLQGSNDVELRADGNSRF-------IFSV-LEDGCTRHTGEWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1226          

HSP 2 Score: 162.925 bits (411), Expect = 9.089e-40
Identity = 290/844 (34.36%), Postives = 344/844 (40.76%), Query Frame = 3
Query: 1923 GLTGLRGV-DGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGP------RGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKI------------------------------------GLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRG---------------------HQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQ---GSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGI---------------------LGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQG---------------PRGPKGQT------------GFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPI---GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRG-DPGLPGDRGKIGSIGP------------------------PGRVGPQGEPGLKGVKGELGLPGQDGEPGL 4025
            G     G+  G  G  G  G RG  GP+G  GFPG  G  G +G  G  G  G +G+ G +G K       L+   G  G  G  G PGP G  G  G +G  G  G  GP       G PG  G +G+VG IG  G SGPQG+ G  G  G  GP GP   IGK                                     GL G+ GP G KG  G +GEPG  G  G PG  G  G RG  G+ G  G  G  G RG  G  G  G  G  GP G  G RGS+G  G +G  G+ G  G  G  G+RG                     + G  GP G  G PG+ GE+G+ G  GL G  GP G                 G  G  G  G  G  G  GL GP G  G  G  G +G+PG Q   G  G +GE+G +G PG +G  G  G RG  G PG                       G+PG  G  G  G KG +G  G  G  G  G  G +G                +G +G+             G +G  G  G  GP G KG  G  G  GP G  GP G  G  G  G  GD GP+   G+PG  GR GAPG  G+ GP G  G  GK                   GP GL G  G  G  G +G+ G  G  G+ G  G  G  G PG  G  G  G +G  G SG +G++G  G  G VG  G +G  G  G  G PG +G+ G+ G  G+ G D  L GDRG+ G  G                          G  GP+GE G+ G KGE G+ G  G PGL
Sbjct:   85 GCCCFLGLCHGNNGRPGKPGDRGAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKVREHQTSLL--QGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPVSIGKCSFSAKFGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDG-------NNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKD------------------GPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGL 901          

HSP 3 Score: 156.762 bits (395), Expect = 5.712e-38
Identity = 289/835 (34.61%), Postives = 344/835 (41.20%), Query Frame = 3
Query: 2016 FPGPEGASGKEGEIGPPGFIGDEG------------KRGFS---GEKGDSGPVGLIGPI----GAIGSQGSHGAPGPIGLQ------GLIGKEGEKGAIGNPGPRGEPGEIG----------LQGQVGII---GRDGNSGPQGDIGMDGDRGPAGPKGPQ---------------------GDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFY------------------------GLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQG--------------EKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTG---------------------------FEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPG---------------DKGISGEVGDPGPI---------GYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGI---------------------KGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDG 4013
            F GP G  GK+G+ G PG  G  G            KR FS    +K  +G    +G      G  G  G  GAPGP G +      GL G +G +G  G  G +GEPG  G          LQGQ G+    GR G +GP G  G DG+ GPAGP GP                      G  G  G QG  G  G  G++G  G P  IG+  F   +                        G  G RGL GD   PG  G +G  G KG  G+ G  G PGP+G  G RG +G  G  G  GN G  G  GS G+ G +G  GP   IG+PG  G  G+ G RG PG  G +G  G  G +G  G  G+PG  G  G  G  GN G  G +GP G  G  G+ G  G  G +G PG  G              EKG+    GP+G  G  G+ G  G  G  G PG  G  G QG  G  G  GE G  G PG  G QGP GP+G  G                             G++G  G PGP   KG KGE G+ GP+G  G  G  G               DKG  GEVG  GP          G PG  G +G  G  G TGP G  G  G+                      G SG  G  G  G RG  G +G  G PG  GR+G PG+          G  G  G +G  G  G  G+RG  GP G SGE G+ G  G+ GE G                      +G  G++G RGD G P   G  G++G PGR GP G  G +G  G +G+PG  G
Sbjct:   35 FKGPPGPDGKDGKPGFPGPPGPPGPPGPSGLGGVSLKRVFSVTVAQKCLAGCCCFLGLCHGNNGRPGKPGDRGAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKVREHQTSLLQGQRGLAGERGRPGPAGPAGARGADGNVGPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPVSIGKCSFSAKFGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGD---PGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGP---IGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKGEQ---GPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGP---KGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQS---------------------GPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQ---------AGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTP---GAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSG 824          

HSP 4 Score: 149.828 bits (377), Expect = 9.928e-36
Identity = 235/703 (33.43%), Postives = 291/703 (41.39%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQ---IGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKG---------------------DSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEK--------GAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQ------------------------IGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRG---------------DKGLLGDF---------------GIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGL---PGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGS---------------------QGSPGEQGEKGDHGIPGPS------GKTGLSGIRGITGRPGILGLPGFSGETG-------YQGEKGSQGPVGEVGILGKPGLGGY------------QGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNI-----GRQGAPGLVGVTGPIGKPG 3491
             G+PG  G  G  GPKG  G  G +GA G QGE+G RG TG  G  G  G  G  GA G RGL G +G+   IG PG  G++G  G  GPPG  G  G+ G +G +G                     +SG  G  GP G  G  G  G+ GP GL+G  G +G          GA G  G +G  G  G QG  G  G  G +G  G+ G+ GD+G +GP G +G+ G  G  G  GP G  G  G  G PG                          GE G  G  G  G +G PG KG  G  G +G RG               DKG  G+                G  G  G RGP+G +G +GP G  G  G  GP G  G  G  G +G+ GP G  G PG  G  G  G+ G+   PG+ GP+G                         +G +G  G PG  GP G QG  G  G  G  GS                     QG  G  G +GD G PG +      G+ G  G  G  G PG +G+PG SG  G         G++G  GP G +G+ G PG  G              GP GP+G+ G  GD+G+         +G+KG +G+ G  G PGP        +SG  GD GP     +      GR GA G +G  G  G PG
Sbjct:  287 SGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAG------------------------KDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGE---------RGMKGLRGHPGLQGMPGPS-------VSGPAGDSGPGPAGPHGPPGKDGRAGAHGTIGAPGARGPPG 949          

HSP 5 Score: 148.673 bits (374), Expect = 1.816e-35
Identity = 198/567 (34.92%), Postives = 238/567 (41.98%), Query Frame = 3
Query: 1827 NTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGV-----------DGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKE---------------GEKGAIGNPGPRGEPGEIGLQGQVGIIGRDG------------------NSGPQGDI------------------GMDGDRGPAGPKG---PQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPL------------------GFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKR------GLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGL---------------------------QGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSG--------------KTGLSGIRGITGRPGILGLPGFS 3137
            N+G  GPKG  G  GK G RG  G  G RG  G  G  G             GE GP GA G +GL GP G      P G +GK GE G PG  G  G  G  GE+G +G  G  GP G IG +G  GAPG  G +G  G                 GE+GA G PGP+GE GE G +G  G  GRDG                  + G +G++                  G  G+RGP+G KG   P G  G  G  G  GPSG  G+ G RG+ G +G +GFPG  G +G  G  G  G PG  G  G+ G +GL GD      PGP GP+G +G  GP G+ GE G+ G                    GF+G  G RG +G  G  G +G PG  G  G  G R      G+PG+ GP G  G   +                  NGD+G  G  G                             GPRG +G  GD G +GM G +G PG QG  G   + GP+G              K G +G  G  G PG  G PGFS
Sbjct:  415 NSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAG------PAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGD------PGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSL-----------------NGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQGMPGPS-VSGPAGDSGPGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGFS 951          

HSP 6 Score: 107.842 bits (268), Expect = 6.446e-23
Identity = 246/706 (34.84%), Postives = 300/706 (42.49%), Query Frame = 3
Query: 2244 PGPRGEP---------------GEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLL-GLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGET---------GYQGEKGSQGPVGEVGILGKPGLG---------------------------GYQGPRGPKGQTGFEGDQGKF------GVPGP--------------------QGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGET------------------GIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQ---GVNGQRGD------PGLPGDRGKIGS------IGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLI 4028
            PGP G                  +  L G    +G     G  G  G  GDRG  GP+G +G  G  GL G  G  G  G  G +GEPG  G         LL G RGL G++G PG  G  G RG  G +         GP GP G  G++GP G  G  G  G +G IG+ G  G QGN G  G  G  G +G   + GK         S   G+PG  G  G  G  G  G  G  G  G  GL G  GP+G +G  G  G  G  G QG+PG QGE+G  G  G  G TG +G RG  G PG  GLPG  G T         G  G  G +GP G+ G  G+PG                             G+ GP+GP G+ G  G++G        G PGP                    QG  G  G QG  GP G  G  G PG++GI G+ G  GP G  G  G  G+PG  G  GPIG  G  G  G  G +G+ G  G  G  G  G  G  G +G     G PG  G +G+PG  G  G  G+ G  G  G  G  G  G +G +G +GE                   G RG  GP G  GE G +G  G  G+ G  G     G  G RGD       G PG  G++G+      +GPPG  GP G+ G +G++G+ G  G  GE G++
Sbjct:   57 PGPPGPSGLGGVSLKRVFSVTVAQKCLAGCCCFLGL--CHGNNGRPGKPGDRGAPGPQGARGFPGTPGLPGMKGHRGYTGLDGRKGEPGAAGAKVREHQTSLLQGQRGLAGERGRPGPAGPAGARGADGNV---------GPAGPAGPMGAAGPPGFPGGPGPKGEVGPIGATGPSGPQGNRGEPGSNGAVGPVGPPVSIGKCSF------SAKFGTPGPGGAPGFAGARGGPGPQGPQGAAGPRGLSGDPGPQGTKGDTGPKGEPGNAGPQGAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPGNSGFTGPKGPSGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAA---GTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMV 742          

HSP 7 Score: 103.605 bits (257), Expect = 1.260e-21
Identity = 224/641 (34.95%), Postives = 272/641 (42.43%), Query Frame = 3
Query: 1221 GHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGM---RGNTGE---QGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEG------------------------------------------IRGLDGPKGQIGFPG---PEGASGKEGEIG---------PPGFIGDEGKR---------------------GFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDI---GMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEG-------IKGELGNDGPLGFI---------------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKG 2825
            G  G +GE+G++GP G IG  G  G +G  G  G  G  G  G  G IGM   RG+TG    +GPPG  G  G PGP G RG +G  G  G PGP GP G  G      + G  GP+G  GE GKPG       +G  G  G +G  G  G +G+ GPVG   P  +                                +QG  G  G  G  GP G  G  GK G RG+ G++G  G  G  G RG +G  G  G +G                                            G  GPKG+ G PG   P+G SG++G  G         P G  GD+G+R                     G  GE+G SG  G  GP G  G  G  G  GP G  G  G  G+ G +G  G  G  G +G  GQ GI+G  G +GP G     G+ GD GPAGP G QG +G  G+ GE G  G  G  G  G PG  G  G  GF GL G R   GD+G PG     G  G+ G  G  G  G  GP G  G+ G SGP+G       + G+ G  GP G +               G  G RG  G  GP G  G+ G+ GE+G KG RG PG++G
Sbjct:  312 GAPGPQGEEGKRGPTGEIGATGAAGNRGARGAPGSRGLPGSEGRTGPIGMPGARGSTGSAGPRGPPGDAGRAGEPGPAGLRGPSGQDGRPGPPGPSGPRGQPG------NSGFTGPKGPSGEPGKPG------ERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKG-------------------------------EQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTNGSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDGNSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGAR---GDRGTPGA---AGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGDKGERGMKGLRGHPGLQG 903          

HSP 8 Score: 100.523 bits (249), Expect = 1.037e-20
Identity = 200/575 (34.78%), Postives = 236/575 (41.04%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXX-----------XXXXXXXPMGYFGFR---GPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGK------------------------PGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGV------QGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPE---GASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPV------GLIGPIGAIGSQGS---------------------HGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQG----DIGMDGDRGPAGPKGPQ------------GDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQR-----------GDKGLLGDFGIMGFPGPRGPTGL 2639
            SG  G+ GE+G  GP GL G  G  G             G++G  GP G  GF+   GP G  G  G  GE+G PG  G  G  G KGERG                    G PG  G +G IGPRG  G  G                         PG +G  G  G  G+ GE GHKG  G                          G  G  G+ G  G  G  G  GD+GE G +G  G  G  G  G  G+ GARG       +GE GP G  G  G  G  G +GP GA G RG  GP G  GFPG     GA G+ G +GPPG  G  GK G  G +GD GP       G++GP G  G +GS                      G  G  G +G  G  G  GA+G PG  G PG  G +G  G IG  G SGPQG    D+ ++GDRG  GP G              G  G+ G +GE GP+G +G  G+ G+    GE G  G  G  GL+G+PG    P   G  G             G  G  G  G +G PG RGP G 
Sbjct:  425 SGEPGKPGERGSTGPTGLRGPPGPDGNNGAAGPVGAGAPGEKGEQGPAGAAGFQGLPGPAGPAGEAGKPGERGIPGDQGVSGPAGAKGERGTN------------------GSPGATGPQGPIGPRGPAGAPGADGGKGEPGAAGAAGAQGHQGAGGMPGERGAAGTPGPKGEKGEPGHKGPDG------------------------NSGRDGARGMPGPAGPPGPNGANGDKGERGEVGPAGPPGFAGPPGADGQPGARGERGPSGGKGETGPSGPAGPAGQSGPSGPSGPAGAPGARGDTGPVGLTGFPGAAGRVGAPGQAGIVGPPGLAGPAGKDGPRGLRGDPGPAGPSGEQGMVGPPGVSGEKGSPGEPGPAGAPGPPGTTGPLGLQGFVGLSGARGDRGTPGAAGAVGEPGRAGPPGAAGPRGPPGNIGMPGMSGPQGEAGRDVSLNGDRGEPGPAGSMGLGGAPGPAGPTGAPGRPGGRGEAGPAGPRGEKGVAGD---KGERGMKGLRGHPGLQGMPG----PSVSGPAGDSGPGPAGPHGPPGKDGRAGAHGTIGAPGARGPPGF 950          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000110.2 (collagen alpha-2(V) chain [Source:NCBI gene;Acc:101172057])

HSP 1 Score: 267.314 bits (682), Expect = 3.961e-72
Identity = 469/1353 (34.66%), Postives = 596/1353 (44.05%), Query Frame = 3
Query: 1347 GPRGNIGMRGNTGEQGP---PGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIG---------DEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEG---EKGAIGNPGPRGE---PGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGL------------------RGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGL---------PGLQGPRGNQGSDGDVGRQGMPGSQGSPG------------EQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPG------------FSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK---------------------------FGVPGPQGAKGLKGEQGY---MGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIG---LSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIG---------------LPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPG------------------------------------RVGPQGEPGLKGVKGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDMKSTTDPDVM-------VIPN-NVPSIGAVLNR---LFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCIPA-QASSRGKP-LTRFLKSQNESEWWLSKLKDQNGKTL-----KKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            GP G  G+ G  GE GP   PG  G DG+PG  G  G                              + GP G  GE G PG QG  G  GL G+ G KG KG  G  G  G +G  G  G+ G  G++G  G  G PG+ G  G IG  G  G QG PG +G  G +GP G  G  G  G  G++GE GP G+ G+ G +G  G+ G +G  G  G  G  G  G PGP G+SG  G  GPPG +G           G  G  G+ GD G  GL G  G  G +G HG PGPIGL G  GK G   + G+IG PGP GE   PG  G  G  G+ G+ G  G +G  G+ G +G +G  G  G+ G  G +G  GP G +G+ G  G+ G  GE G PG  G  G RG  G  G PG    +G  GD G  G+ G  G PG RGP G                   RG  GP+GI G  G  GP G  G  G  G QG  G  G +G  G  GE+G  G+RG     GP+GL G  G+ G  G  G  G  G  G +G+ G  GL         PG  GP+G+ GS G+ G +G  G+ G  G              G+KG+ G PGP+G+ G  G+ G TG PG +G  G              GETG  G KG  G  G  G+ GKPG    QGP G  G  G  G QG+                            G PG +G  G++GE G     G +G PG  G PG+K  SGE G PGP G PG  G  G  G+VG  GP G+ G VG  G  GP GK G  G  G  GP G   L G  G +G  G  GI G  G  GK GLVG  G                PG  G  G  G  G +G KG  G  G++G+ G+RG VGP+G  GE G  G++G  G+ G +G  G+ G  G  G  GD G+ G +GP G                                      GP GEPG  G  G  G P  +        +D +  +    P        D+    DP           +PN N+    AVLN    +   L+ L+  +       GSKENP+++C+DI  +      SG +W+DPN GS  D++   C     E  TCI A QA   GK   T+   S N+  W+ +   D NG T      K+    A   Q+  LQ L  ++ Q +   C+ SV   D    N++ A+ ++ +N +++ +H + R++           I+D C +         I    +    LPI+D+   D G  DQ  G     VCF
Sbjct:   37 GPTGGQGIPGEAGEPGPMGEPGHRGPDGAPGKPGRDG------------------------------EPGPDGAPGEPGNPGSQGPRGFPGLPGNRGLKGPKGNAGPQGPKGELGVVGLKGKSGAPGTMGAPGPQGPPGLQGERGRIGPTGHVGKQGTPGDVGKPGPMGPIGIPGLPGYPGNPGMKGEPGPAGVRGILGPQGPRGDAGRVGPSGPTGQRGAAGADGSPGPRGSSGIAGVQGPPGLVGAAGLPGPQGSTGAPGAKGQLGDGGVPGLKGEPGMKGERGEHGTPGPIGLMGEDGKRGPRGDAGSIGPPGPAGETGAPGNRGFPGSDGLPGQKGAPGERGLPGVGGAKGLSGDPGRNGEPGLTGARGLAGPIGAQGAEGGPGQMGLAGEDGKPGPAGAAGNRGSAGTMGLPGP---KGFAGDAGKAGEAGSPGPPGQRGPNGKDGEEGAAGPPGPAGLAGKRGEQGPQGISGFQGLPGPPGPPGESGKPGDQGLAGEAGAVGATGPRGERGPSGERGE---TGPNGLQGPKGSPGGPGPDGPKGNPGPKGADGEPGAPGLQGMSGERGIPGSSGPKGDAGSIGEKGPEGKAGADGPRGLPGSVGPIGPGGPNGDKGETGPPGPTGRRGTRGVPGSTGEPGPIGPAGFPGPPGPDGQPGVKGETGEPGLKGEAGAPGPQGMAGKPGT---QGPVGVTGLKGGRGTQGQAGSPGFPGLPGGVGPPGALGAAGAAGPIGEPGKRGPSGVRGENGAPGRKGESGTPGLPGSPGEKAESGEDGPPGPDGPPGPPGATGQRGVVGQPGPRGEKGLVGLPGPAGPPGKPGTPGASGGKGPAGGIGLPGASGPRGDAGSEGIAGAEGPPGKDGLVGERGQRGEPGPEGLPGGPGSPGNEGPVGTTGGPGSRGEKGPRGPPGSQGQPGVRGKVGPQGPQGEKGGAGEQGERGQKGHRGFTGLQGLPGITGATGDTGEKGIVGPAGLRGPPGVTGPPGNEGIIGQPGPMGPPGSRGSSGDLGEQGPSGEPGPPGPPGPPGPPSANVNDLFSHSVDYEENLVD--PESDGNVEYDL--AADPPASPKFNRDEALPNKNL----AVLNADMGIKVTLKALNGNLQVMRSPDGSKENPAKTCRDIK-QCYPEKKSGEYWLDPNQGSTKDAIKVFCNMESDE--TCISASQAVIPGKAWWTKSSPSPNKPVWFGA---DINGGTKFLYGNKEERQNAVTVQLKLLQLLSRESHQNVTYRCKNSVAVKDEKSSNFKKALVLKGYNGQEIKAHGNSRLRYTV--------IEDGCSKSNGQWAKTVIEYRTQTSTRLPIVDLAPMDIGQADQEFGLDIGPVCF 1328          

HSP 2 Score: 152.91 bits (385), Expect = 1.203e-36
Identity = 303/884 (34.28%), Postives = 381/884 (43.10%), Query Frame = 3
Query: 1218 SGHIGRKG------EKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGF---RGPRGNIGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGE------IGLQGQVGIIGRDGNSGPQG---------------------DIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEP------------GQIGESGFPGFYGLLGLRGLPGD---KGEPGTDGEEGQRGDKGLLGDFGI---------------MGFPGPRGPTGLRGSSGPEGIKGELGNDGPL---------------GFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHG------IPGPSGKTGLSGIRGITGRPGILG---------------------------------LPGFS---GETGYQGEKGSQGPVGEVGILGKPG------------------------------LGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPG 3410
            +GH+G++G      + G  GP G+ G  G  G  G +G  GP G  G    +GPRG+ G  G +G  G  G  G DGSPGP+G  G+          G  GPPG  G  G+PG +G  G  G +G++G  GV GL G  G+ G+ GE G  G IG                                             + G+ G+ G  G+ G++GP G  G  G  G RG  G        GL G +G  GE G  G  G +GL G  G+ G PG  GA G  G IG  G  G  G+ G +GE G  GP G     G  GS G+ G PGP G  G  GK GE G+ G PG RG  G+       G  G  G+ G+ G  GPQG                     D G+ G+ G  G  GP+G+ G  G +GE GP+GL+G  G  G P            G  GE G PG  G+ G RG+PG    KG+ G+ GE+G  G  G  G  G+                G  GP GPTG RG+ G  G  GE G  GP                G  G  G++G  G  GP G  G P      GT+G  G+ G+KG  G  G  G+ G  G+ G  G  G +G  G  G IG PG +GP G +G +G  GR+G  G+ G PG  GEK + G        GP G  G +G RG+ G+PG  G                                 LPG S   G+ G +G  G++GP G+ G++G+ G                                G +GPRGP G  G  G +GK G  GPQG KG  GEQG  G  G+ G  GL G  GI+G  GD G
Sbjct:  156 TGHVGKQGTPGDVGKPGPMGPIGIPGLPGYPGNPGMKGEPGPAGVRGILGPQGPRGDAGRVGPSGPTGQRGAAGADGSPGPRGSSGIA---------GVQGPPGLVGAAGLPGPQGSTGAPGAKGQLGDGGVPGLKGEPGMKGERGEHGTPGPIG---------------------------------------------LMGEDGKRGPRGDAGSIGPPGPAGETGAPGNRGFPGSD------GLPGQKGAPGERGLPGVGGAKGLSGDPGRNGEPGLTGARGLAGPIGAQGAEGGPGQMGLAGEDGKPGPAGA---AGNRGSAGTMGLPGPKGFAGDAGKAGEAGSPGPPGQRGPNGKDGEEGAAGPPGPAGLAGKRGEQGPQGISGFQGLPGPPGPPGESGKPGDQGLAGEAGAVGATGPRGERGPSGERGETGPNGLQGPKGSPGGPGPDGPKGNPGPKGADGEPGAPGLQGMSGERGIPGSSGPKGDAGSIGEKGPEGKAGADGPRGLPGSVGPIGPGGPNGDKGETGPPGPTGRRGTRGVPGSTGEPGPIGPAGFPGPPGPDGQPGVKGETGEPGLKGEAGAPGPQGMAGKP------GTQGPVGVTGLKGGRGTQGQAGSPGFPGLPGGVGPPGALGAAGAAGPIGEPGKRGPSGVRGENGAPGRKGESGTPGLPGSPGEKAESGEDGPPGPDGPPGPPGATGQRGVVGQPGPRGEKGLVGLPGPAGPPGKPGTPGASGGKGPAGGIGLPGASGPRGDAGSEGIAGAEGPPGKDGLVGERGQRGEPGPEGLPGGPGSPGNEGPVGTTGGPGSRGEKGPRGPPGSQGQPGVRGKVGPQGPQGEKGGAGEQGERGQKGHRGFTGLQGLPGITGATGDTG 970          

HSP 3 Score: 145.976 bits (367), Expect = 1.340e-34
Identity = 303/859 (35.27%), Postives = 365/859 (42.49%), Query Frame = 3
Query: 1215 HSGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGNIGMRGNTG---EQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIG------PPGFIGDEGKRGFSGEKGDSGPVGLIGPIG------------AIGSQGSHGAPGPIGLQGLI------------------GKEGEKGAIGNPGPRGEPGEIGLQGQVG------------------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPG---------QIGESGFPGFYGLLGLRGLPGDKGEP---------------------GTDGEEGQRGDKGLLGDFGIMGFPGPRGP---TGLRGSSGPEGIK---------------------------GELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKG---------------TKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGIT---------GRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGY 3350
            + G+ G KGE G  G  G++G  G  G+ G+ G  GP G  G  G  G+ G RG++G    QGPPGL+G  G PGP+G  G                                G +G  G+ G PG++G  GMKG  G+ G  G  G +GEDG                     K+G  G+ G IG PG  G  G  G++G PG  G  G  G  G  G  G  GA+G+ G+ G  G  GLTG RG+ G  G  GAEG  G  G  G+ G PGP GA+G  G  G      P GF GD GK   +GE G  GP G  GP G              G  G  G  GP G+ G                    G  GE GA+G  GPRGE G  G +G+ G                          G DG  G  G  GM G+RG  G  GP+GD G IG +G  G +G  G  GL G  G           GE+G PG  G  G RG+PG  GEP                     G  GE G +G+ G  G  G+ G PG +GP   TGL+G  G +G                             GE G  GP G  G  G  G +G  G  G  G PGE  E G                 G+RG+ G  GP G  G  G  G  G  G+PG  G  G  G  G IGLPG  GPRG+ GS+G  G +G PG  G  GE+G++G+ G  G  G  G  G  G           G  G  G PG  G+ G +G+ G QGP GE G  G+      QG RG KG  GF G Q   G+PG  GA G  GE+G +GP G 
Sbjct:  185 YPGNPGMKGEPGPAGVRGILGPQGPRGDAGRVGPSGPTGQRGAAGADGSPGPRGSSGIAGVQGPPGLVGAAGLPGPQGSTGAP------------------------------GAKGQLGDGGVPGLKGEPGMKGERGEHGTPGPIGLMGEDG---------------------KRGPRGDAGSIGPPGPAGETGAPGNRGFPGSDGLPGQKGAPGERGLPGVGGAKGLSGDPGRNGEPGLTGARGLAGPIGAQGAEGGPGQMGLAGEDGKPGPAGAAGNRGSAGTMGLPGPKGFAGDAGK---AGEAGSPGPPGQRGPNGKDGEEGAAGPPGPAGLAGKRGEQGPQGISGFQGLPGPPGPPGESGKPGDQGLAGEAGAVGATGPRGERGPSGERGETGPNGLQGPKGSPGGPGPDGPKGNPGPKGADGEPGAPGLQGMSGERGIPGSSGPKGDAGSIGEKGPEGKAGADGPRGLPGSVGPIGPGGPNGDKGETGPPGPTGRRGTRGVPGSTGEPGPIGPAGFPGPPGPDGQPGVKGETGEPGLKGEAGAPGPQGMAGKPGTQGPVGVTGLKGGRGTQGQAGSPGFPGLPGGVGPPGALGAAGAAGPIGEPGKRGPSGVRGENGAPGRKGESGTPGLPGSPGEKAESGEDGPPGPDGPPGPPGATGQRGVVGQPGPRGEKGLVGLPGPAGPPGKPGTPGASGGKGPAGGIGLPGASGPRGDAGSEGIAGAEGPPGKDGLVGERGQRGEPGPEGLPGGPGSPGNEGPVGTTGGPGSRGEKGPRGPPGSQGQPGVRGKVGPQGPQGEKGGAGE------QGERGQKGHRGFTGLQ---GLPGITGATGDTGEKGIVGPAGL 980          

HSP 4 Score: 99.3673 bits (246), Expect = 2.651e-20
Identity = 123/293 (41.98%), Postives = 155/293 (52.90%), Query Frame = 3
Query: 3168 SQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPG---ELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKGVKGELGLPGQDGEPGLIKII 4037
            S GP G  GI G+ G  G  G  G +G  G  G  G+ G PGP GA G  G  G  GP G+PG   LPG++G+ G  G+ GP G  G +G      +VG+ G  G PG +G  G  GP G +GE             G +G  G+ G +G PG +G   KPG +G IG+PG PG  G+ G KGE G  G  GI G +G  G  G VGP G +G+ G  G +G PG     GI G+QG  G  G  GLPG +G  G+ G  G++G  G PGLKG  G  G  G+ G PG I ++
Sbjct:   35 SSGPTGGQGIPGEAGEPGPMGEPGHRGPDGAPGKPGRDGEPGPDGAPGEPGNPGSQGPRGFPG---LPGNRGLKGPKGNAGPQGPKGELG------VVGLKGKSGAPGTMGAPGPQGPPGLQGE------------RGRIGPTGHVGKQGTPGDVG---KPGPMGPIGIPGLPGYPGNPGMKGEPGPAGVRGILGPQGPRGDAGRVGPSGPTGQRGAAGADGSPGPRGSSGIAGVQGPPGLVGAAGLPGPQGSTGAPGAKGQLGDGGVPGLKGEPGMKGERGEHGTPGPIGLM 303          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1a1b (collagen alpha-1(I) chain [Source:NCBI gene;Acc:101162163])

HSP 1 Score: 259.61 bits (662), Expect = 5.133e-70
Identity = 365/1084 (33.67%), Postives = 465/1084 (42.90%), Query Frame = 3
Query: 1902 KGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQI-----------GESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGN------QGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRG---------------PKGQTGFEGDQGKFGVPGPQG---------------AKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGET------------GIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGP---QGEPGLKGV---------------KGELGLPGQDGEPGLIKIIDIQVGMYQFVPRRVKRQARDM----KSTTDPDVMVIPNNVPSIGAVLNRLFTRLEMLDELVTKYNKSLGSKENPSRSCKDIYMESNKTIASGHFWIDPNMGSVSDSVFAECKFSEQEIKTCI-PAQASSRGKPLTRFLKSQNESEWWLSK-----LKDQNGKTLKKITFTATNSQIVFLQELHSKAEQTIVLTCRKSVVYFDSTRKNYRSAIQMRAFNDRKLHSHYDKRIKSEAGTNLLEIRIKDDCMERIATSTSAQITLIAKDVRYLPIIDIKFQDFGNPDQLLGYYFDSVCF 4892
            +G RG  G  GL G+ G        G  GLDG KG  G  GP+G  G  GE G PG +G    RG  GE+G     G  GP GA G+ G+ GA GP         EG  G+ GNPG +G PG  G+ G  G+ G  G  G QG +G  G +G    K        + L+       L+GS     E G             GE+G  G  G  G RG PG  G  G  G  G+R            G PGP GP G  G SG  G  G  G+    G  GS G  G  G  GP G  G  G  G  G  G RG PG+ G  G  GS G  G  G  G  G  G+ G  G++G  GLPG++G R +       G  G VG  G+ G +GSPGE+GE       GP G  G +G  G  G+P   GL G SG+TG +G+ G+ GP G VG  G  G  GY GP G               P G  G +G +G+ G  GP G                KG  G  G  G  G PGP G+ G +GI G  G  G  G+PG  G  G PG  G +GP+G+                  +G  G +GP GLSG  G  G  G  G  G  G  G PG  G  G  G PG  G  G  G  G  G SG  G++GET            G+RG  GP G  G+ G TG+ G  G  G +G  G+ G  G  G  G+RG  GS GP G  GP    G PG  GV                G++G  G  G PGL          + FV + ++ +A D         DP+ MV   ++         + T L+ L + V K     GS+++P+R C+D+ M  +    SG +W+DPN GS  D++   C     E  TC+ P+Q+S   K   R    + +   W S+      + Q G +  +      N QI F++ + ++A Q I   C+ S+ Y DS   N + A+         L    D  I++E  +       +D C     T     I         LPIIDI   D G PDQ  G     VCF
Sbjct:  210 QGARGFPGTPGLPGIKGH------RGFSGLDGAKGDAGPAGPKGEPGAPGENGIPGAMG---ARGLPGERGRP---GAPGPAGARGNDGNTGAAGPPVSTTTHKTEGNPGSDGNPGAKGSPGMAGITGAPGMPGMRGPPGGQGAVGAQGQKGNNVSK----QFCMLILKKVCQVYKLQGSSNTLNENGFCQQGDPGPPGPKGEAGAKGEPGAPGARGFPGADGAGGPKGAPGER------------GAPGPMGPQGATGESGSPGAPGAPGSK---GVTGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGEN------GPPGPAGFAGPPGADGQP---GLKGESGDTGPKGDAGAPGPAGPVGAAGPQGPTGYPGPAGRVGPPGPAGAAGPPGPVGPVGKDGARGQRGETGPAGRPGEAGAAGPPGPPGEKGSPGSDGAAGTPGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGE------------------RGAPGPAGPPGLSGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGDRGETGPAGPSGPAGPAGVRGPAGPAGAKGDRGETGEAGERGHKGHRGFTGMQGLPGPAGPSGERGPAGSSGPAGPRGPAGNNGSPGKDGVNGMPGPIGPPGPRGRNGDMGPAGPPGPPGLPGPPGPPGSGFDFVSQPIQEKAPDPLRGGYRADDPN-MVRDRDM--------EVDTTLKTLSQRVEKIRSPDGSQKSPARMCRDLRM-CHPEWKSGMYWVDPNQGSPLDAIKVHCNMETGE--TCVSPSQSSIPMKNWYRTKNIREKKHVWFSESMTGGFQFQYGGS--EADPEDVNIQIAFMRLMSNQASQNITYHCKNSIAYMDSATGNLKKALL--------LQGSSDTEIRAEGNSRFTYSVSEDGCTSHTGTWGKTVIDYKTPKTSRLPIIDIAPMDVGGPDQEFGVEVGPVCF 1213          

HSP 2 Score: 149.058 bits (375), Expect = 1.619e-35
Identity = 198/492 (40.24%), Postives = 236/492 (47.97%), Query Frame = 3
Query: 1800 DQGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKG---PRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIGLQGLI---GKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGL---------------KGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPG 3212
            ++G PG +G  GA G  G  G  G  G++GV G  G   P G  G  G  G DG TGP G  G RG     G +GFPGP+G+SG+ G  G PG +G  G +G  GE+G +G  G+ G   +I +    G PGP+G+ GL    G  GE+G  G PGP G  G  G  GQ G+ G  G++GP+GD G  G  GP G  GPQG  G  G  G +GP G                 G+ G RGE G  G  G  G  G  G  G  G  G  G  G  G  G +G+ G  GI+G PG RG  G  G  GP G  G+ G  GP+G  G+ G  G  G  G  G  G  G  G  G  G+ G PG KG  G  G+PG  G  G  G PG +G  G  GD+G  G  G  GP G  G  G  G  G  G +G  GE GE+G              G RG TG  G+ G  G SGE G  G  G  GP G  G  G PG
Sbjct:  426 ERGAPGPMGPQGATGESGSPGAPGAPGSKGVTGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQ---PGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGLKGESGDTGPKGDAGAPGPAGPVGAAGPQGPTGYPGPAGRVGPPGPAGAAGPPGPVGPVGKDGARGQRGETGPAGRPGEAGAAGPPGPPGEKGSPGSDGAAGTPGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGERGAPGPAGPPGLSGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGDRGETGPAGPSGPAGPAGVRGPAGPAGAKGDRGETGEAGERGHK------------GHRGFTGMQGLPGPAGPSGERGPAGSSGPAGPRGPAGNNGSPG 902          

HSP 3 Score: 134.42 bits (337), Expect = 4.628e-31
Identity = 235/698 (33.67%), Postives = 284/698 (40.69%), Query Frame = 3
Query: 1803 QGEPGGIGNTGALGPKGFIGYVGKEGARGVQGEKGPRG---------ITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGSHGAPGPIG--------------------LQGLIGKEGEKGAI-----------GNPGPRGEPGEIGLQGQVGI---------IGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKG---------------EPGTDGEEGQRGDKGLLGDFG---------IMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFI------GSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHNGDKGNIGLPG------------LQGPRGNQGSDGDVGRQGMPGSQ---------GSPGEQGEKGDHGIPGPSGKTGLSGIRG---------------ITGRPGILGLPGFSGETGYQGEKGSQGPVGE------------------------VGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGE---VGDPGPIGYPGNIGRQGAPGLVGVT 3470
            QG  G  G  G  G KG  G+ G +GA+G  G  GP+G         I G  G RG+ GE G  GA G  G  G  G  G  GP  ++      G PG  G+ G +G  G  G +G  G+ G  G  G QG+ GA G  G                    LQG      E G             G  G +GEPG  G +G  G           G  G  GP G  G  G+ G  G  G  G  G  G  G  GP G  G  G  G+ G+ G +G PG  G  G+ G PG KG                PG  G  G+RG  GL G  G         ++G PGP G  GL G  G  G +GE G  GP GF       G  G++G  G+ GP G  G PG  G  G  G +G  G  GP+G +G PG  G  G  G  G +G  G  G +G  G  G              G +G+ GSDG  G  G PG Q         G PG++GE+G  G+PGP+G+ G  G  G               ++G PG  G  G +G  G  G  G+ GP G+                         G  G  G  G  GP GP G  G  G  G  G  G +G  G  GE+G+ G  G+ G  GLPG  G SGE    G  GP G  G  G  G+PG  GV 
Sbjct:  210 QGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGAPGENGIPGAMGARGLPGERGRPGAPGPAGARGNDGNTGAAGPPVSTTTHKTEGNPGSDGNPGAKGSPGMAGITGAPGMPGMRGPPGGQGAVGAQGQKGNNVSKQFCMLILKKVCQVYKLQGSSNTLNENGFCQQGDPGPPGPKGEAGAKGEPGAPGARGFPGADGAGGPKGAPGERGAPGPMGPQGATGESGSPGAPGAPGSKGVTGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGLKGESGDTGPKGDAGAPGPAGPVGAAGPQGPTGYPGPAGRVGPPGPAGAAGPPGPVGPVGKDGARGQRGETGPAGRPGEAGAAGPPGPPGEKGSPGSDGAAGTPGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGERGAPGPAGPPGLSGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGDRGETGPAGPSGPAGPAGVRGPAGPAGAKGDRGETGEAGERGHKGHRGFTGMQGLPGPAGPSGERGPAGSSGPAGPRGPAGNNGSPGKDGVN 907          

HSP 4 Score: 113.62 bits (283), Expect = 1.069e-24
Identity = 178/469 (37.95%), Postives = 216/469 (46.06%), Query Frame = 3
Query: 1536 GKIGPRGGQGEIGKPGV------QGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPK------------GFIGYVGKEGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEG---------------------KRGFSGEKGDSGPVG---------------LIGPIGAIGSQGSHGAPGPIGLQG------LIGKEGEKGAIGNPGPRGEPGEIGLQGQVG------------IIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGL---------QGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLR---GSSGPEGIKGELGNDG 2690
            G +GP+G  GE G PG       +G+ G  G  G  G+ G  GA G+DG  GP GP G  G+PG  G  G KG  G PG  G PG +G  G++G  GE G  G  G  G +            G +G  G  G RG  GE+G  G  G  G  G  G  G  G +G  G  GPKG  G PGP G  G  G  GP G+ G  G                     K G  G++G++GP G                 G  G+ G+ G+ GAPGP G+ G      L G+ GE+G  G PGP GEPG+ G  G VG            + G  G +G +G  G DG  G  G  GP+GD G+ G           G  G  G  G  G RGE G  G SG  G  G+ G  G  G KG+ G  GE G+RG KG  G  G+ G PGP GP+G R   GSSGP G +G  GN+G
Sbjct:  431 GPMGPQGATGESGSPGAPGAPGSKGVTGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGLKGESGDTGPKGDAGAPGPAGPVGAAGPQGPTGYPGPAGRVGPPGPAGAAGPPGPVGPVGKDGARGQRGETGPAGRPGEAGAAGPPGPPGEKGSPGSDGAAGTPGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGERGAPGPAGPPGLSGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGDRGETGPAGPSGPAGPAGVRGPAGPAGAKGDRGETGEAGERGHKGHRGFTGMQGLPGPAGPSGERGPAGSSGPAGPRGPAGNNG 899          

HSP 5 Score: 108.227 bits (269), Expect = 5.008e-23
Identity = 187/520 (35.96%), Postives = 222/520 (42.69%), Query Frame = 3
Query: 1218 SGHIGRKGEKGQKGPFGLIGDIGKXXXXXXXXXXXPMGYFGFRGPRGN---------IGMRGNTGEQGPPGLMGHDGSPGPKGERGLTXXXXXXXXXXXXXXXXXXXXXXXXXDRGKIGPRGGQGEIGKPGVQGLNGMKGLVGDVGEKGHKGAIGEDXXXXXXXXXXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXXXXXDQGEPGGIGNTGALGPKGFIGYVGK---------------------EGARGVQGEKGPRGITGLTGLRGVDGETGPIGAEGIRGLDGPKGQIGFPGPEGASGKEGEIGPPGFIGDEGKRGFSGEKGDSGPVGLIGPIGAIGSQGS------HGAPGPIGLQGLIGKEGEKGAIGNPGPRGEPGEIGLQGQVGIIGRDGNSGPQGDIGMDGDRGPAGPKGPQGDIGKIGLQGEIGPSGLKGSMGLRGEPGQIGESGFPGFYGLLGLRGLPGDKGEPGTDGEEGQRGDKGLLGDFGIMGFPGPRGPTGLRGSSGPEGIK 2669
            +G  G  G  G+ GP G  G  G+ G  G  G  G  G  GF GP+G+          G  G+ G QG PG  G  G PG KGER        LG PGP G  G  GP G PG+RG+ GP G  G  G PG  G  G+KG  GD G KG  GA G                                                     G +G  G  GP G+ G  G+                     +GARG +GE GP    G  G  G  G  GP G +G  G DG  G  G PGP+G +G+ G +G PG  G+ G  G  G  G+ G  G  GP+G  G+ G        GAPG  G +G  G +G  G  G PGP+G+ GE G  G  G  G  G  G  G  G  GDRG  GP GP G  G  G++G  GP+G KG    RGE G+ GE G  G  G  G++GLPG  G  G  G  G  G              GPRGP G  GS G +G+ 
Sbjct:  457 TGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGLKGESGDTGPKGDAGAPGPA---------------------------------------------------GPVGAAGPQGPTGYPGPAGRVGPPGPAGAAGPPGPVGPVGKDGARGQRGETGP---AGRPGEAGAAGPPGPPGEKGSPGSDGAAGTPGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGERGAPGPAGPPGLSGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGDRGETGPAGPSGPAGPAGVRGPAGPAGAKGD---RGETGEAGERGHKGHRGFTGMQGLPGPAGPSGERGPAGSSGPA------------GPRGPAGNNGSPGKDGVN 907          

HSP 6 Score: 89.3521 bits (220), Expect = 2.891e-17
Identity = 116/328 (35.37%), Postives = 144/328 (43.90%), Query Frame = 3
Query: 3087 IRGITGRPGILGLPGFSGETGYQGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGKFGVPGPQGAKGLKGEQGYMGPNGYPGPHGLPGDKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGP----------IGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYY-----GPRGIPGKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGEAGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPP---GRVGPQGEPGLKGVKGELGLPGQDGE 4016
            ++G  G PG  GLPG  G  G+ G  G++G  G  G  G+PG  G  G  G  G  G  G++G+ G PGP GA+G  G  G  GP      H   G+ G     G+PG  G PG  G  GAPG+ G+ GP            K   V KQ  M    K  +          G S T+   G+      GP G  G+ G +G+PG  G  G PG                 G  G +G  GE G  G +GP+G +GE+G  G  G PG  G+          G PG PG  GK G  G P   GR GP G PG +G  G +G PG  G 
Sbjct:  209 LQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGAPGENGIPGAMGARGLPGERGRPGAPGPAGARGNDGNTGAAGPPVSTTTHKTEGNPGSD---GNPGAKGSPGMAGITGAPGMPGMRGPPGGQGAVGAQGQKGNNVSKQFCMLILKKVCQVYKLQ-----GSSNTLNENGFCQQGDPGPPGPKGEAGAKGEPGAPGARGFPGA---------------DGAGGPKGAPGERGAPGPMGPQGATGESGSPGAPGAPGSKGVT---------GSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGS 504          

HSP 7 Score: 73.559 bits (179), Expect = 1.984e-12
Identity = 182/558 (32.62%), Postives = 221/558 (39.61%), Query Frame = 3
Query: 2598 GIMGFPGPRGPTGLRGSSGPEGIKGELGNDGPLGFIGSVGIRGHQGNLGPDGYIGLPGEIGEKGTKGKRGLPGIKGPSGLMGSXXXXXXXXXXXXXXXXXXXXHN----------------GDKGNIGLPGLQGPRGNQGSDGDVGRQGMPGSQGSPGEQGEKGDHGIPGPSGKTGLSGIRGITGRPGILGLPGFSGETGY------------------QGEKGSQGPVGEVGILGKPGLGGYQGPRGPKGQTGFEGDQGK--------------FGVPGPQGAKGLKGEQGYM-----------------GPNGYPGPHGLPG------------DKGISGEVGDPGPIGYPGNIGRQGAPGLVGVTGPIGKPGKVGKQXXXXXXXXXXXXXXXXXXXPIGLSGTVGSQGYYGPRGIP------------GKIGTQGKPGLVGRIGLPGKPXXXXXXXXXXXXXXXXXXXIQGNKGETGIRGLVGPRGMSGE---------AGITGKEGLPGELGIKGLQGVNGQRGDPGLPGDRGKIGSIGPPGRVGPQGEPGLKG 3977
            GI  F  P+GP G  G  G  G  G  G  G  G  G+ GI G            L     E G  GK G PG +G +G   S  + G    +     L    +N                G +G  G PGL G +G++G  G  G +G  G  G  GE G  G++GIPG  G  GL G RG  G PG  G  G  G TG                    G  G++G  G  GI G PG+ G +GP G +G  G +G +G                 V   QG+     E G+                  G  G PG  G PG            ++G  G +G  G  G  G+ G  GAPG  GVTG  G PG  GK    GP G  G+ G  G +GP G  G  G  G+ GP+G              G  G QG PG  G  GLPG          KGE+       + G  G  G+ GL GPRG  GE         AG  G  G  G+ G+KG  G  G +GD G PG  G +G+ GP    GP G PG  G
Sbjct:   98 GIFVFFIPQGPAGPPGRDGIPGQPGLPGPPGLPGAPGTTGIGGET--------FFLRDRSTESGEPGKPGRPGERGSAGPQVSDSSPGKGTQRKLIKFLVFELYNACGDDLFLEITFIFLQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGPKGEPGAPGENGIPGAMGARGLPGERGRPGAPGPAGARGNDGNTGAAGPPVSTTTHKTEGNPGSDGNPGAKGSPGMAGITGAPGMPGMRGPPGGQGAVGAQGQKGNNVSKQFCMLILKKVCQVYKLQGSSNTLNENGFCQQGDPGPPGPKGEAGAKGEPGAPGARGFPGADGAGGPKGAPGERGAPGPMGPQGATGESGSPGAPGAPGSKGVTGSPGSPGPDGK---AGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGPKGSSGEPGAAGAPGGVGSPGMQGMPGERGAAGLPG---------VKGERVSITALFLLGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGLKG