Protein sprint

Overview
NameProtein sprint
Smed IDSMED30021679
Length (bp)1617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein sprint (SMED30021679) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein sprint (SMED30021679) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein sprint (SMED30021679) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein sprint (SMED30021679) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021679

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30021679h1SMcG0015813 dd_Smed_v4_10582_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021679h1SMcG0015813 dd_Smed_v4_10582_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021679h1SMcG0015813 dd_Smed_v4_10582_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein sprint vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 53.1434 bits (126), Expect = 9.543e-7
Identity = 29/92 (31.52%), Postives = 53/92 (57.61%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  224 KFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 314          
BLAST of Protein sprint vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 52.7582 bits (125), Expect = 1.800e-6
Identity = 36/139 (25.90%), Postives = 70/139 (50.36%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+ + + +    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  663 FHMADGSWKQLKENLQLVRQRNPQELGV---FAPTPDFVDV-EKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 796          
BLAST of Protein sprint vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 52.373 bits (124), Expect = 1.836e-6
Identity = 36/139 (25.90%), Postives = 70/139 (50.36%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+ + + +    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  614 FHMADGSWKQLKENLQLVRQRNPQELGV---FAPTPDFVDV-EKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 747          
BLAST of Protein sprint vs. Ensembl Zebrafish
Match: vps9d1 (VPS9 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050306-57])

HSP 1 Score: 53.1434 bits (126), Expect = 5.268e-7
Identity = 35/96 (36.46%), Postives = 49/96 (51.04%), Query Frame = 1
Query: 1288 YSPLEKLE-------ILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            Y P +KLE       I+C    D  L+ +      S  IGAD+L+PIL ++ ++ +  ++      LE  I   YLIG EGY L SL  ALT+  S
Sbjct:  393 YCPQKKLECIVRTLRIICGCAEDYRLLQENDPPPRSAAIGADDLLPILAFVALRSEMPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALTYVES 488          
BLAST of Protein sprint vs. Ensembl Zebrafish
Match: vps9d1 (VPS9 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050306-57])

HSP 1 Score: 53.5286 bits (127), Expect = 5.543e-7
Identity = 35/96 (36.46%), Postives = 49/96 (51.04%), Query Frame = 1
Query: 1288 YSPLEKLE-------ILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            Y P +KLE       I+C    D  L+ +      S  IGAD+L+PIL ++ ++ +  ++      LE  I   YLIG EGY L SL  ALT+  S
Sbjct:  550 YCPQKKLECIVRTLRIICGCAEDYRLLQENDPPPRSAAIGADDLLPILAFVALRSEMPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALTYVES 645          
BLAST of Protein sprint vs. Ensembl Zebrafish
Match: si:ch211-168d1.3 (si:ch211-168d1.3 [Source:ZFIN;Acc:ZDB-GENE-160113-13])

HSP 1 Score: 52.373 bits (124), Expect = 1.424e-6
Identity = 27/104 (25.96%), Postives = 59/104 (56.73%), Query Frame = 1
Query: 1237 ISILDDQTSQFSK-----LRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICAL 1533
            + +LD +  + +K     ++  +SP++K+ +L Q+   +   +  Q    ++G+D+ +P L Y++I+C+  ++ L  +Y+  L+  S+L G  GY L S+  +L
Sbjct:  490 VGVLDVRGVERAKAKLMLMQRSHSPIDKVLLLLQVCKSVYKAMGTQPGQ-DVGSDDFLPALSYVLIQCNIPQLLLETEYMMELLEPSWLTGEGGYYLTSVYASL 592          
BLAST of Protein sprint vs. Ensembl Zebrafish
Match: rin2 (Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-194])

HSP 1 Score: 50.0618 bits (118), Expect = 7.004e-6
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +F+ +  +YSP +K+ +L   C++I  +M      N+    GAD+ +P+L Y++ +CD  E+    +Y+  L+  S L G  GY L S   A++ 
Sbjct:  702 KFNNMCKMYSPEKKVSLLLSVCKLIYTIM----ENNSGRMYGADDFLPMLTYVMAQCDMPELDTEIQYMMELLDPSLLHGEGGYYLTSAYGAMSL 792          
BLAST of Protein sprint vs. Ensembl Zebrafish
Match: rin2 (Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-194])

HSP 1 Score: 50.0618 bits (118), Expect = 7.004e-6
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +F+ +  +YSP +K+ +L   C++I  +M      N+    GAD+ +P+L Y++ +CD  E+    +Y+  L+  S L G  GY L S   A++ 
Sbjct:  702 KFNNMCKMYSPEKKVSLLLSVCKLIYTIM----ENNSGRMYGADDFLPMLTYVMAQCDMPELDTEIQYMMELLDPSLLHGEGGYYLTSAYGAMSL 792          
BLAST of Protein sprint vs. Ensembl Xenopus
Match: vps9d1 (3 beta-hydroxysteroid dehydrogenase type 7-like [Source:Xenbase;Acc:XB-GENE-986527])

HSP 1 Score: 58.151 bits (139), Expect = 2.383e-8
Identity = 41/155 (26.45%), Postives = 76/155 (49.03%), Query Frame = 1
Query: 1108 IYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQ---IITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFIS 1563
            +Y+ + +A +E L+Q    +K   +N +    +P+K   + EV         +   L   ++P  K+E + +   +I +   +      +  IGAD+L+PIL ++++K    ++      LE  I   YLIG +GY L SL+ AL++  S   +S
Sbjct:  486 LYRHVLLAREESLLQA---MKSYRDNAQSVVGVPQKLFPE-EVEQPYKAAVEEIGHLPLHHTPQRKMECIVRTMRVICECAEEYCTAPGTSAIGADDLLPILAFVVLKTQMPQLLSECAALEEFIHEGYLIGEDGYCLTSLLSALSYVESLPLLS 636          
BLAST of Protein sprint vs. Ensembl Xenopus
Match: ENSXETT00000014340.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:68305663:68312067:-1 gene:ENSXETG00000003967.1 transcript:ENSXETT00000014340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 5.404e-7
Identity = 42/150 (28.00%), Postives = 71/150 (47.33%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFIS 1563
            F  YD  L   N+ ++  E+     N  P   +  P  +  + ++   FS +   YSP + + +L   C+ I + M       AS   GAD+ +P+L+++++ CD   + L  +Y+  L+  S L G  GY L +L  AL    S N +S
Sbjct:  177 FHRYDGSL---NKLLENQEKMKGMRNQKPRSGVPGPATMEKIQNK---FSLMHVTYSPEKMIRLLLKVCKFIYESM------EASRAFGADDFLPVLIHVLLSCDLTSLQLDVEYIMELVDPSQLQGEGGYYLTTLFGALYHISSFNTVS 314          
BLAST of Protein sprint vs. Ensembl Xenopus
Match: ucma (upper zone of growth plate and cartilage matrix associated [Source:Xenbase;Acc:XB-GENE-5752310])

HSP 1 Score: 53.1434 bits (126), Expect = 8.478e-7
Identity = 59/253 (23.32%), Postives = 111/253 (43.87%), Query Frame = 1
Query:  817 SPEVSCLSFILKMNN------VHPVVDFVNRLVERLVNCSVSKENQN------AFLEELKVWNDTIEDL----SKLCCLVINANSSDKISIIYPKLQNVLIEYIFK--NIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFI--TQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILI 1515
            SPE   L FI +M+          + DF+ R+ +        K+ ++        L+E++ + D ++ +    ++L    ++    D++      L+  L   I K  N  +   I+K +  + D  L +  +N++ ++  N   +LL    +  T PE+  I      +  +++  YSP +K+ +L Q    +   I  Q      GADE +P L Y++  CD  ++ +H  Y   L+P   L+G  GY L 
Sbjct:   96 SPERKVLMFIEEMSRDIQTEFGKELQDFLRRVTDGESMGGKEKDTEDEEGSYKTLLKEVRDFMDKVKHVLRESAELQLETLSLEEQDRV------LEKSLHRLILKPLNAHLVSVIHKGVEESGD--LERLGKNMQAVK--NSGSSLLGVSLMAPTAPELEKI----RHKLLRMQEKYSPTDKVRLLLQACRLVYRNIDAQQDDA-CGADEFLPALCYVLALCDLPQLLIHTYYTGELLPQDTLVGEGGYYLT 333          
BLAST of Protein sprint vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 51.2174 bits (121), Expect = 3.885e-6
Identity = 33/105 (31.43%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 1228 PEVISILDDQTSQFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICAL 1533
            PE IS+++  T +FS +   YSP +K+  L   C++I D M+        L  GAD+ +P+L+Y++ +CD  E+    +Y+  L+  +  +G   Y L +   AL
Sbjct:  671 PE-ISVMEKITQKFSVMHKTYSPEKKVSYLLKACKMIYDSMAT--GSPGKLH-GADDFLPVLMYVLARCDLTELLQDVEYMMELMDPALQLGEGSYYLTTTYGAL 771          
BLAST of Protein sprint vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 51.2174 bits (121), Expect = 4.208e-6
Identity = 33/105 (31.43%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 1228 PEVISILDDQTSQFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICAL 1533
            PE IS+++  T +FS +   YSP +K+  L   C++I D M+        L  GAD+ +P+L+Y++ +CD  E+    +Y+  L+  +  +G   Y L +   AL
Sbjct:  745 PE-ISVMEKITQKFSVMHKTYSPEKKVSYLLKACKMIYDSMAT--GSPGKLH-GADDFLPVLMYVLARCDLTELLQDVEYMMELMDPALQLGEGSYYLTTTYGAL 845          
BLAST of Protein sprint vs. Ensembl Mouse
Match: Rin2 (Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MGI:1921280])

HSP 1 Score: 53.1434 bits (126), Expect = 7.178e-7
Identity = 37/139 (26.62%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+++  L+    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  578 FHTADGSWKQLKENLQLVRQRNPQELGV---FAPTPDLME-LEKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 711          
BLAST of Protein sprint vs. Ensembl Mouse
Match: Rin2 (Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MGI:1921280])

HSP 1 Score: 53.1434 bits (126), Expect = 7.413e-7
Identity = 37/139 (26.62%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+++  L+    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  623 FHTADGSWKQLKENLQLVRQRNPQELGV---FAPTPDLME-LEKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 756          
BLAST of Protein sprint vs. UniProt/SwissProt
Match: sp|Q9D684|RIN2_MOUSE (Ras and Rab interactor 2 OS=Mus musculus OX=10090 GN=Rin2 PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 5.185e-6
Identity = 37/139 (26.62%), Postives = 71/139 (51.08%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+++  L+    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  623 FHTADGSWKQLKENLQLVRQRNPQELGV---FAPTPDLME-LEKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 756          
BLAST of Protein sprint vs. UniProt/SwissProt
Match: sp|Q8WYP3|RIN2_HUMAN (Ras and Rab interactor 2 OS=Homo sapiens OX=9606 GN=RIN2 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 8.816e-6
Identity = 36/139 (25.90%), Postives = 70/139 (50.36%), Query Frame = 1
Query: 1123 FVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            F   D    Q   N++ + + N  +  +   F   P+ + + +    +F  ++ +YSP +K+ +L ++   + + ++N N+    GAD+ +P+L Y+I +CD  E+    +Y+  L+  S L G  GY L S   AL+ 
Sbjct:  614 FHMADGSWKQLKENLQLVRQRNPQELGV---FAPTPDFVDV-EKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMEN-NSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSL 747          
BLAST of Protein sprint vs. TrEMBL
Match: A0A4W4DY51 (Ras and Rab interactor 1a OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.598e-9
Identity = 39/107 (36.45%), Postives = 63/107 (58.88%), Query Frame = 1
Query: 1219 ITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +T P+   I D    + S +R  YSP++KL +L QI   L+ K    NA  E GAD+ +P L Y+I++C+  E+ +  +Y+  L+ +S+L G  GY L S+  +L+F
Sbjct:  158 VTVPDTQGI-DKLRRKMSLVRRAYSPIDKLHLLLQICK-LIYKAMKNNAGQEFGADDFLPALSYVIVQCNMPELSVEVEYMMELLDTSWLTGEGGYYLTSVYASLSF 262          
BLAST of Protein sprint vs. TrEMBL
Match: A0A4W4DWA8 (Ras and Rab interactor 1a OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.070e-9
Identity = 39/107 (36.45%), Postives = 63/107 (58.88%), Query Frame = 1
Query: 1219 ITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +T P+   I D    + S +R  YSP++KL +L QI   L+ K    NA  E GAD+ +P L Y+I++C+  E+ +  +Y+  L+ +S+L G  GY L S+  +L+F
Sbjct:  202 VTVPDTQGI-DKLRRKMSLVRRAYSPIDKLHLLLQICK-LIYKAMKNNAGQEFGADDFLPALSYVIVQCNMPELSVEVEYMMELLDTSWLTGEGGYYLTSVYASLSF 306          
BLAST of Protein sprint vs. TrEMBL
Match: A0A2G8LMK7 (VPS9 domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_01616 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.214e-9
Identity = 47/169 (27.81%), Postives = 86/169 (50.89%), Query Frame = 1
Query: 1036 SIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKI----QNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICA 1530
            +I    L  +L+E +   I +C FI  F      E L   +RN++  +E +  +  + +KFI  P   + +     +F+ ++  +SPL+KLE L  ++ ++ S +       NA   +GAD+ +P+L+Y+++ CD   I +  +Y+  L+    L G  GY L +L  A
Sbjct:  183 AIFEGALHQILLEPLKDQIYLC-FIKHF---NQSESLKLLDRNIRSAKEKSPEELGIKDKFI--PPAKAAMISIKERFTDIQKAFSPLQKLEYLLHVVREIYSSVFDSTLGSNAMTSMGADDFLPMLIYVLVHCDQIHIEIEVEYMWGLLDPPLLSGEGGYYLTTLSSA 345          
BLAST of Protein sprint vs. TrEMBL
Match: A0A5N5M3F9 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00059600 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.932e-8
Identity = 34/96 (35.42%), Postives = 58/96 (60.42%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSD 1551
            + S +R  YSP++K+ +L QI   L+ K    N   E GAD+ +P L Y+I++C+  E+ L  +Y+  L+ +S+L G  GY L S+  +L++  S+
Sbjct: 1124 KMSLMRRAYSPIDKVVLLLQI-CKLIYKAMKTNTGQEFGADDFLPALSYVIVQCNMPELSLEVEYMMELLETSWLTGEGGYYLTSVYASLSYIQSE 1218          
BLAST of Protein sprint vs. TrEMBL
Match: A0A2C9KGW0 (VPS9 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106069174 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.263e-8
Identity = 50/174 (28.74%), Postives = 86/174 (49.43%), Query Frame = 1
Query: 1102 PF---IYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFI-----------TQPEVISILDDQTSQFSKLRNIYSPLEKLE-------ILCQIITDLMSKIQNQNASLE----IGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            PF   I+K LF  +   ++ Y + +       KY N+ PE              TQP   +I     ++ S +++ Y+ L KLE       ++C+ + +   KIQ+++AS++    +GAD+L+PIL Y+II+    ++    + +   I   Y++G EGY L +L  AL F  S
Sbjct:  644 PFFKPIWKTLFRLF--RVVNYKQELVLASIMTKYSNITPEDLKVSKKLCLTDSDTQPYQAAI-----TELSHVQDYYTMLTKLECVVKVCRMICECVDEYYKKIQDRDASMKKAPSLGADDLLPILSYVIIRSGLPQLAAECEAMTEFIHEGYMMGEEGYCLTTLRTALNFVTS 810          
BLAST of Protein sprint vs. Ensembl Cavefish
Match: rin1a (ras and Rab interactor 2-like [Source:NCBI gene;Acc:103041548])

HSP 1 Score: 63.929 bits (154), Expect = 2.619e-10
Identity = 35/110 (31.82%), Postives = 63/110 (57.27%), Query Frame = 1
Query: 1237 ISILDDQT-----SQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSD 1551
            +S+ D Q       + S +++ YSP++K+ +L QI   L+ K    N + E GAD+ +P L Y+I++C+  E+ L  +Y+  L+ + +L G  GY L S+  +L+   S+
Sbjct:  576 VSVPDTQGIEKIKQKLSLMKSAYSPIDKVHLLLQICK-LIYKAMKSNTAQEFGADDFLPALSYVIVQCNMPELLLEVEYMMELLETPWLTGEGGYYLTSVYASLSHIQSE 684          
BLAST of Protein sprint vs. Ensembl Cavefish
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:103022367])

HSP 1 Score: 51.9878 bits (123), Expect = 1.630e-6
Identity = 27/92 (29.35%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +F  +  +YSP +K+ +L ++   L+  I   N+    GAD+ +P+L Y++ +CD  ++    +Y+  L+  S L G  GY L S   A++ 
Sbjct:  715 KFQNMSKLYSPEKKVSLLLRV-CKLIYTIMEDNSGRMYGADDFLPMLTYVLAQCDMPQLDTEIQYMMELLDPSQLHGEGGYYLTSAYGAMSL 805          
BLAST of Protein sprint vs. Ensembl Cavefish
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:103022367])

HSP 1 Score: 51.9878 bits (123), Expect = 1.640e-6
Identity = 27/92 (29.35%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1264 QFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            +F  +  +YSP +K+ +L ++   L+  I   N+    GAD+ +P+L Y++ +CD  ++    +Y+  L+  S L G  GY L S   A++ 
Sbjct:  740 KFQNMSKLYSPEKKVSLLLRV-CKLIYTIMEDNSGRMYGADDFLPMLTYVLAQCDMPQLDTEIQYMMELLDPSQLHGEGGYYLTSAYGAMSL 830          
BLAST of Protein sprint vs. Ensembl Cavefish
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:103037074])

HSP 1 Score: 51.6026 bits (122), Expect = 1.949e-6
Identity = 59/236 (25.00%), Postives = 96/236 (40.68%), Query Frame = 1
Query:  907 VNCSVSKENQNAFLEELKVW----NDTIEDLSKLCCL---VINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNI------YSPLEKLEIL---------CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            ++C +    + A  E LK      +++I+ L  LC L    +N  SS    +         IE +F      P +  F  V  + EL  +  +V+     +  D  +  K    P+  ++L       S ++ +      Y P  KLE +         C     L+        +  IGAD+L+PIL Y+ ++ +  ++      LE  I   YLIG EGY L S+  ALT+  S
Sbjct:  390 LDCHIQDLEERALKEHLKAIVKDIHNSIDRLLSLCLLSFECLNTASSKDHCV-------ACIEEVFFTPIWSPLLALFRRVHRERELA-FEHSVQLYHNASPGDVGVAAKLY--PKDSALLHGSYPYESAVQELKLLCRDYCPQRKLECIVRTLRLICACAEHYRLLQGNDQSPKTAAIGADDLLPILSYVALRSEQPQLVSECAALEEFIHEGYLIGEEGYCLTSMQSALTYVES 615          
BLAST of Protein sprint vs. Ensembl Cavefish
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:103037074])

HSP 1 Score: 51.2174 bits (121), Expect = 2.132e-6
Identity = 59/236 (25.00%), Postives = 96/236 (40.68%), Query Frame = 1
Query:  907 VNCSVSKENQNAFLEELKVW----NDTIEDLSKLCCL---VINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNI------YSPLEKLEIL---------CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            ++C +    + A  E LK      +++I+ L  LC L    +N  SS    +         IE +F      P +  F  V  + EL  +  +V+     +  D  +  K    P+  ++L       S ++ +      Y P  KLE +         C     L+        +  IGAD+L+PIL Y+ ++ +  ++      LE  I   YLIG EGY L S+  ALT+  S
Sbjct:  451 LDCHIQDLEERALKEHLKAIVKDIHNSIDRLLSLCLLSFECLNTASSKDHCV-------ACIEEVFFTPIWSPLLALFRRVHRERELA-FEHSVQLYHNASPGDVGVAAKLY--PKDSALLHGSYPYESAVQELKLLCRDYCPQRKLECIVRTLRLICACAEHYRLLQGNDQSPKTAAIGADDLLPILSYVALRSEQPQLVSECAALEEFIHEGYLIGEEGYCLTSMQSALTYVES 676          
BLAST of Protein sprint vs. Ensembl Sea Lamprey
Match: rin2 (Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-194])

HSP 1 Score: 48.521 bits (114), Expect = 3.460e-6
Identity = 28/92 (30.43%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1267 FSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICAL 1533
             +++   YSP +K+ +L   C+ I D M    +   S   GAD+ +P+L+Y++ +CD   + +  +Y+  L+  S L G  GY L ++  AL
Sbjct:  508 LARMHATYSPSKKVLLLLKACKFIYDAMG---SGLGSTMFGADDFMPVLMYVLARCDMPFLDMEVEYMMELLDPSLLSGEGGYYLTTVYGAL 596          
BLAST of Protein sprint vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000108.1 (pep scaffold:Pmarinus_7.0:GL477060:88433:93624:1 gene:ENSPMAG00000000093.1 transcript:ENSPMAT00000000108.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 4.322e-6
Identity = 36/148 (24.32%), Postives = 69/148 (46.62%), Query Frame = 1
Query: 1096 ICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVIS------ILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISL 1521
            IC  I K L    D+ +  Y+     I++          K + +  V +       L+     F+ ++  Y PL K++ L +I   +   +++  +  ++GADEL+P+L Y++++CD A +     Y+  L+    + G   Y LIS+
Sbjct:  120 ICKCILKSLKGQLDQSIGDYHLRDGSIKQLRCSSEATQNKTLEELGVTAKVPNEDTLEGIRRAFASIQQDYLPLRKIKCLLKICKVIYKSMED-GSGRQLGADELMPVLTYVLVRCDIATLKQDMDYMTELMEPCMIHGEGQYYLISI 266          
BLAST of Protein sprint vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002461.1 (pep scaffold:Pmarinus_7.0:GL476414:561132:574898:1 gene:ENSPMAG00000002247.1 transcript:ENSPMAT00000002461.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 4.945e-6
Identity = 42/170 (24.71%), Postives = 83/170 (48.82%), Query Frame = 1
Query: 1054 LQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYD-NLLPEKFITQPEVISILDDQT-----SQFSKLRNIYSPLEKLEIL---CQIITDLMSKIQNQNASLEI-GADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICAL 1533
            ++  L + + K +K  P + + L   ++++ +     VK ++ N  +  + LP +    P V +  D  T     ++ S L   YSP+ K++ L   C+++ + M       +S E+ GAD+  P+L Y ++ CD  ++ +   Y+  L+  + + G  GY L S+  AL
Sbjct:   76 VEKALYKCVLKPLK--PTLEQALMSTHNKQGL-----VKRLQSNCFWGRSQLPTELGVSPSV-NTPDSATQERIRAKLSDLAASYSPMVKVDSLLKVCKMVYNAM------GSSGEVRGADDFFPVLTYSLLHCDCPQLAIQVDYIMELLNPNLMSGESGYYLTSVYAAL 231          
BLAST of Protein sprint vs. Ensembl Medaka
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:101155108])

HSP 1 Score: 54.299 bits (129), Expect = 2.485e-7
Identity = 34/104 (32.69%), Postives = 51/104 (49.04%), Query Frame = 1
Query: 1243 ILDDQTSQFSKLRNIYSPLEKLEILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            IL D   Q    R +   +  L ++C    D   + ++ +   +  IGAD+L+PIL ++ ++C   ++      LE  I   YLIG EGY L SL  AL F  S
Sbjct:  392 ILQDSCPQ----RKLECIVRTLRLICVCAEDYRCLQEVDSTPKTAAIGADDLLPILSFVAVRCQCPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALAFVES 491          
BLAST of Protein sprint vs. Ensembl Medaka
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:101155108])

HSP 1 Score: 54.299 bits (129), Expect = 2.837e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query: 1306 LEILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            L ++C    D   + ++ +   +  IGAD+L+PIL ++ ++C   ++      LE  I   YLIG EGY L SL  AL F  S
Sbjct:  533 LRLICVCAEDYRCLQEVDSTPKTAAIGADDLLPILSFVAVRCQCPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALAFVES 615          
BLAST of Protein sprint vs. Ensembl Medaka
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:101155108])

HSP 1 Score: 53.9138 bits (128), Expect = 2.933e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query: 1306 LEILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            L ++C    D   + ++ +   +  IGAD+L+PIL ++ ++C   ++      LE  I   YLIG EGY L SL  AL F  S
Sbjct:  533 LRLICVCAEDYRCLQEVDSTPKTAAIGADDLLPILSFVAVRCQCPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALAFVES 615          
BLAST of Protein sprint vs. Ensembl Medaka
Match: vps9d1 (VPS9 domain containing 1 [Source:NCBI gene;Acc:101155108])

HSP 1 Score: 53.9138 bits (128), Expect = 3.619e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query: 1306 LEILCQIITD--LMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVS 1548
            L ++C    D   + ++ +   +  IGAD+L+PIL ++ ++C   ++      LE  I   YLIG EGY L SL  AL F  S
Sbjct:  593 LRLICVCAEDYRCLQEVDSTPKTAAIGADDLLPILSFVAVRCQCPQLVSECAALEEFIHEGYLIGEEGYCLTSLQSALAFVES 675          
BLAST of Protein sprint vs. Ensembl Medaka
Match: si:ch211-85n16.4 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:101171225])

HSP 1 Score: 50.8322 bits (120), Expect = 3.506e-6
Identity = 29/104 (27.88%), Postives = 55/104 (52.88%), Query Frame = 1
Query: 1228 PEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTF 1539
            P+ ++I +    +F  +R +YSP +K+ +L ++   L+  I   N+    GAD+ +P+L Y++ +C+   +    +Y+  L+  S L G  GY L S   A+  
Sbjct:  742 PDSVAI-EKIRQKFLNMRKMYSPEKKVRLLLRV-CKLIYTIMQDNSGRMYGADDFLPMLTYVVAQCNMPRLDTDIQYMMELLDPSLLQGEGGYYLTSAYGAMAL 843          
BLAST of Protein sprint vs. Planmine SMEST
Match: SMESG000042164.1 (SMESG000042164.1)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 498/499 (99.80%), Postives = 499/499 (100.00%), Query Frame = 1
Query:   82 MNSLNEVKNFIYQTMQLDQNNDNSIEIRLFIYQKYVKSIKDIFTVLDEDLNTCSFENKLETVKHIRNNHLSILTTAQHCCRRVTEQFSDENENKLKSQISNSLEKKRNXXXXXXXXXXXXXXXXXTERPANPIDSAKLNIQKLVKSTNKLLESGRLSVSEKVSLQLRISREIEQNLSIARKQETQMYQINVNNLEILLTKISEDINRFGFFKNNPDFPILYRNSQLFYYHILKDSRTYSFVKSTHSPEVSCLSFILKMNNVHPVVDFVNRLVERLVNCSVSKENQNAFLEELKVWNDTIEDLSKLCCLVINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFISHITKT 1578
            MNSLNEVKNFIYQTMQLDQNNDNSIEIRLFIYQKYVKSIKDIFTVLDEDLNTCSFENKLETVKHIRNNHLSILTTAQHCCRRVTEQFSDENENKLKSQISNSLEKKRNPSLSKSMSPMSSIDSLLTERPANPIDSAKLNIQKLVKSTNKLLESGRLSVSEKVSLQLRISREIEQNLSIARKQETQMYQINVNNLEILLTKISEDINRFGFFKNNPDFPILYRNSQLFYYHILKDSRTYSFVKSTHSPEVSCLSFILKMNNVHPVVDFVNRLVERLVNCSVSKENQNAFLEELKVWNDTIEDLSKLCCLVINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVK+IEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFISHITKT
Sbjct:    1 MNSLNEVKNFIYQTMQLDQNNDNSIEIRLFIYQKYVKSIKDIFTVLDEDLNTCSFENKLETVKHIRNNHLSILTTAQHCCRRVTEQFSDENENKLKSQISNSLEKKRNPSLSKSMSPMSSIDSLLTERPANPIDSAKLNIQKLVKSTNKLLESGRLSVSEKVSLQLRISREIEQNLSIARKQETQMYQINVNNLEILLTKISEDINRFGFFKNNPDFPILYRNSQLFYYHILKDSRTYSFVKSTHSPEVSCLSFILKMNNVHPVVDFVNRLVERLVNCSVSKENQNAFLEELKVWNDTIEDLSKLCCLVINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVAYDEELIQYNRNVKFIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLRNIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDSAEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFISHITKT 499          
The following BLAST results are available for this feature:
BLAST of Protein sprint vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RIN29.543e-731.52Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
RIN21.800e-625.90Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
RIN21.836e-625.90Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein sprint vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein sprint vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein sprint vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps9d15.268e-736.46VPS9 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
vps9d15.543e-736.46VPS9 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch211-168d1.31.424e-625.96si:ch211-168d1.3 [Source:ZFIN;Acc:ZDB-GENE-160113-... [more]
rin27.004e-630.53Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
rin27.004e-630.53Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protein sprint vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps9d12.383e-826.453 beta-hydroxysteroid dehydrogenase type 7-like [S... [more]
ENSXETT00000014340.15.404e-728.00pep primary_assembly:Xenopus_tropicalis_v9.1:2:683... [more]
ucma8.478e-723.32upper zone of growth plate and cartilage matrix as... [more]
rpn23.885e-631.43ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
rpn24.208e-631.43ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
back to top
BLAST of Protein sprint vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rin27.178e-726.62Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MG... [more]
Rin27.413e-726.62Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Protein sprint vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9D684|RIN2_MOUSE5.185e-626.62Ras and Rab interactor 2 OS=Mus musculus OX=10090 ... [more]
sp|Q8WYP3|RIN2_HUMAN8.816e-625.90Ras and Rab interactor 2 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Protein sprint vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W4DY512.598e-936.45Ras and Rab interactor 1a OS=Electrophorus electri... [more]
A0A4W4DWA84.070e-936.45Ras and Rab interactor 1a OS=Electrophorus electri... [more]
A0A2G8LMK79.214e-927.81VPS9 domain-containing protein OS=Stichopus japoni... [more]
A0A5N5M3F95.932e-835.42Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2C9KGW07.263e-828.74VPS9 domain-containing protein OS=Biomphalaria gla... [more]
back to top
BLAST of Protein sprint vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rin1a2.619e-1031.82ras and Rab interactor 2-like [Source:NCBI gene;Ac... [more]
rin21.630e-629.35Ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
rin21.640e-629.35Ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
vps9d11.949e-625.00VPS9 domain containing 1 [Source:NCBI gene;Acc:103... [more]
vps9d12.132e-625.00VPS9 domain containing 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Protein sprint vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rin23.460e-630.43Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000000108.14.322e-624.32pep scaffold:Pmarinus_7.0:GL477060:88433:93624:1 g... [more]
ENSPMAT00000002461.14.945e-624.71pep scaffold:Pmarinus_7.0:GL476414:561132:574898:1... [more]
back to top
BLAST of Protein sprint vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein sprint vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein sprint vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps9d12.485e-732.69VPS9 domain containing 1 [Source:NCBI gene;Acc:101... [more]
vps9d12.837e-734.94VPS9 domain containing 1 [Source:NCBI gene;Acc:101... [more]
vps9d12.933e-734.94VPS9 domain containing 1 [Source:NCBI gene;Acc:101... [more]
vps9d13.619e-734.94VPS9 domain containing 1 [Source:NCBI gene;Acc:101... [more]
si:ch211-85n16.43.506e-627.88Ras and Rab interactor 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Protein sprint vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042164.10.000e+099.80SMESG000042164.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021679 ID=SMED30021679|Name=Protein sprint|organism=Schmidtea mediterranea sexual|type=transcript|length=1617bp
TTTTAAATTAGAATTTAGGATGTGTGTATTGTAATTTCAATTTTCACATA
AACCAGTGTTTAGAAACAGTGCAAATTTAACATGAATTCTCTCAATGAAG
TTAAAAATTTTATTTATCAAACAATGCAACTTGATCAAAATAATGACAAT
TCCATAGAAATCAGATTATTTATTTATCAAAAATATGTCAAAAGCATAAA
AGATATATTTACGGTTTTGGACGAAGATTTGAACACGTGTTCCTTTGAAA
ATAAATTGGAAACAGTGAAACATATACGCAATAATCATTTAAGCATCCTA
ACAACTGCTCAGCATTGCTGCCGTCGAGTAACCGAGCAATTTTCAGACGA
GAATGAAAATAAACTAAAATCACAAATTTCCAACTCCTTAGAAAAGAAAA
GAAATCCCAGCTTATCAAAATCTATGTCACCAATGTCATCCATTGACAGT
CTTTTAACGGAAAGACCCGCAAATCCTATAGATTCAGCTAAATTGAATAT
ACAAAAATTAGTCAAGTCTACCAATAAACTACTAGAATCTGGGAGGTTGT
CTGTGAGTGAAAAGGTGTCACTGCAATTGCGTATTAGTCGAGAAATTGAA
CAAAATCTTAGCATCGCCAGAAAACAAGAAACCCAAATGTATCAAATAAA
TGTAAATAATTTGGAAATATTGCTGACGAAAATTTCCGAAGATATTAACC
GTTTTGGATTTTTCAAAAACAATCCGGATTTCCCAATATTATACAGAAAT
AGTCAGTTGTTTTATTATCATATTTTAAAGGATAGCCGAACTTATTCATT
TGTAAAATCCACTCATTCTCCAGAAGTTTCATGTTTATCTTTTATTTTAA
AAATGAATAATGTTCATCCGGTAGTTGATTTTGTTAACCGATTAGTTGAA
CGGTTGGTTAATTGTTCTGTTAGTAAAGAAAATCAAAACGCTTTTCTTGA
AGAATTGAAGGTTTGGAATGACACAATTGAAGATTTGTCGAAATTGTGTT
GTTTGGTAATTAATGCCAATTCCAGTGACAAAATTTCAATTATCTATCCG
AAATTGCAAAATGTTTTAATAGAGTATATTTTCAAGAATATTAAAATTTG
TCCGTTTATTTATAAGTTTTTGTTTGTTGCATATGATGAAGAATTAATAC
AATATAATCGAAATGTCAAGTATATTGAAGAAAACAATAAATATGATAAT
TTGCTCCCAGAAAAATTTATTACTCAACCCGAAGTGATTTCGATTTTGGA
TGATCAAACTTCACAATTTTCAAAATTGCGTAATATTTACAGTCCTCTTG
AAAAGCTAGAAATCCTTTGCCAAATTATCACTGACTTAATGTCGAAAATC
CAAAACCAGAATGCCTCATTAGAAATTGGAGCTGACGAATTGGTACCGAT
TCTTGTCTATATGATAATTAAATGCGATTCTGCTGAAATATTCCTTCATG
GAAAATATTTAGAACATTTGATCCCAAGTAGTTATCTAATTGGAATTGAA
GGATATATTCTGATTTCCCTTATATGTGCATTGACATTTTGCGTATCAGA
TAATTTTATTTCACATATTACGAAAACCTGATTTTTCAGCTTAAAAATTA
TTTTCACTTAATCAAGC
back to top

protein sequence of SMED30021679-orf-1

>SMED30021679-orf-1 ID=SMED30021679-orf-1|Name=SMED30021679-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MNSLNEVKNFIYQTMQLDQNNDNSIEIRLFIYQKYVKSIKDIFTVLDEDL
NTCSFENKLETVKHIRNNHLSILTTAQHCCRRVTEQFSDENENKLKSQIS
NSLEKKRNPSLSKSMSPMSSIDSLLTERPANPIDSAKLNIQKLVKSTNKL
LESGRLSVSEKVSLQLRISREIEQNLSIARKQETQMYQINVNNLEILLTK
ISEDINRFGFFKNNPDFPILYRNSQLFYYHILKDSRTYSFVKSTHSPEVS
CLSFILKMNNVHPVVDFVNRLVERLVNCSVSKENQNAFLEELKVWNDTIE
DLSKLCCLVINANSSDKISIIYPKLQNVLIEYIFKNIKICPFIYKFLFVA
YDEELIQYNRNVKYIEENNKYDNLLPEKFITQPEVISILDDQTSQFSKLR
NIYSPLEKLEILCQIITDLMSKIQNQNASLEIGADELVPILVYMIIKCDS
AEIFLHGKYLEHLIPSSYLIGIEGYILISLICALTFCVSDNFISHITKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037191VPS9_dom_sf
IPR003123VPS9
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003123VPS9 domainSMARTSM00167vps9_2coord: 389..499
e-value: 5.4E-4
score: 13.3
IPR003123VPS9 domainPFAMPF02204VPS9coord: 393..487
e-value: 7.1E-18
score: 64.7
IPR003123VPS9 domainPROSITEPS51205VPS9coord: 349..496
score: 20.691
IPR037191VPS9 domain superfamilyGENE3DG3DSA:1.20.1050.80coord: 349..496
e-value: 9.3E-17
score: 63.1
IPR037191VPS9 domain superfamilySUPERFAMILYSSF109993VPS9 domaincoord: 285..491
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..118
NoneNo IPR availableTMHMMTMhelixcoord: 467..489