Zinc finger MYM-type protein 1
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30021676 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 53.5286 bits (127), Expect = 3.011e-7 Identity = 24/44 (54.55%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 PNI+ A + FLT P+TVA+ RSFSK K+IKN+L S++ ++R S Sbjct: 645 PNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLS 688
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2H8TX80 (Zinc finger MYM-type protein 1 OS=Melanaphis sacchari OX=742174 GN=ZMYM1_24 PE=4 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 1.136e-7 Identity = 30/42 (71.43%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQR 257 PNIEIAL+ FLT P+TVA+ +RSFSK KIIKN+L STLG++R Sbjct: 754 PNIEIALRIFLTLPVTVASCERSFSKLKIIKNYLRSTLGQER 795
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: J9LV19 (Dimer_Tnp_hAT domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2) HSP 1 Score: 60.4622 bits (145), Expect = 1.603e-7 Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 PN+EI + FLT P+T AT +RSFSK K+IKN+L ST+G++R S Sbjct: 57 PNVEIVFRIFLTMPVTAATCERSFSKLKLIKNYLRSTMGQERLS 100
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2PFL8 (Zinc finger MYM-type protein 1 (Fragment) OS=Schizaphis graminum OX=13262 GN=ZMYM1_81 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.438e-7 Identity = 27/44 (61.36%), Postives = 35/44 (79.55%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 PNIEI + FLT P+T AT +RSFSK K+IKN+L ST+G++R S Sbjct: 145 PNIEIVFRIFLTMPVTAATCERSFSKLKLIKNYLRSTMGQERLS 188
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A026WET7 (Zinc finger MYM-type protein (Fragment) OS=Ooceraea biroi OX=2015173 GN=X777_05687 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.830e-7 Identity = 25/45 (55.56%), Postives = 38/45 (84.44%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 PNI +AL+ FLT P+++A+ +RSFSK K+IKN+L ST+G++R S+ Sbjct: 11 PNINVALRIFLTLPVSIASCERSFSKLKLIKNYLRSTMGQERLSS 55
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: J9LQW5 (Dimer_Tnp_hAT domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 6.926e-7 Identity = 31/70 (44.29%), Postives = 47/70 (67.14%), Query Frame = 3 Query: 63 GTVANEAGFS--SFKKAPLNDQVFNPNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 G+V++E S K D+ PNIEIA++ FL+KP+T A+ +RSFSK K+IK +L ST+ ++R S+ Sbjct: 71 GSVSDEKSVELVSNLKEYQEDKESYPNIEIAIRIFLSKPVTTASRERSFSKLKLIKTYLRSTMAQERLSS 140
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 55.0694 bits (131), Expect = 6.918e-8 Identity = 26/49 (53.06%), Postives = 36/49 (73.47%), Query Frame = 3 Query: 120 QVFNPNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 Q PN+ IAL+ LT P+TVA+ +RSFSK K+IK +L ST+G++R S Sbjct: 740 QEVYPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSG 788
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 51.2174 bits (121), Expect = 9.621e-7 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 3 Query: 135 NIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 ++ ALK FLT P+TVA+ +RSFSK K+IKN+L ST+ + R S Sbjct: 560 DVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSG 603
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 50.8322 bits (120), Expect = 1.182e-6 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 3 Query: 135 NIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 ++ ALK FLT P+TVA+ +RSFSK K+IKN+L ST+ + R S Sbjct: 544 DVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSG 587
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000055782.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001476.1:1798:4262:-1 gene:ENSAMXG00000042376.1 transcript:ENSAMXT00000055782.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 50.447 bits (119), Expect = 2.141e-6 Identity = 23/41 (56.10%), Postives = 32/41 (78.05%), Query Frame = 3 Query: 135 NIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQR 257 N+ IAL+ LT P+TVA+ +RSFS K+IKNFL ST+ ++R Sbjct: 668 NLSIALRLLLTLPITVASGERSFSSLKLIKNFLRSTMSQER 708
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 49.6766 bits (117), Expect = 3.815e-6 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = 3 Query: 135 NIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQR 257 I IAL+ F T P+TVA +R+FSK K++KN+L ST+G+ R Sbjct: 703 EICIALRIFCTLPITVAGGERAFSKLKLVKNYLRSTMGQDR 743
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000078916.1 (SMESG000078916.1) HSP 1 Score: 52.7582 bits (125), Expect = 3.024e-8 Identity = 24/46 (52.17%), Postives = 34/46 (73.91%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASAP 269 PN+ ALK LT P++VA+ +RSFS+ K+IKN+L S+L + R S P Sbjct: 74 PNLYFALKILLTMPVSVASGERSFSRLKLIKNYLRSSLTQNRLSGP 119
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000004944.1 (SMESG000004944.1) HSP 1 Score: 48.1358 bits (113), Expect = 4.034e-7 Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 3 Query: 108 PLNDQVFNPNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 P D VF PN++IAL+ LT +++A+ +RSFS+ K+I +L +++G+ R S Sbjct: 23 PYGDDVF-PNLQIALQVLLTISVSIASGERSFSRLKLILYYLRASMGQDRLS 73
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000026726.1 (SMESG000026726.1) HSP 1 Score: 49.6766 bits (117), Expect = 5.810e-7 Identity = 22/45 (48.89%), Postives = 34/45 (75.56%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRASA 266 PN+ IALK LT P++VA+ +RSFS+ K+IK++L S++ + R S Sbjct: 113 PNLYIALKILLTMPVSVASGERSFSRLKLIKDYLRSSMTQNRLSG 157
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000077250.1 (SMESG000077250.1) HSP 1 Score: 48.1358 bits (113), Expect = 8.880e-7 Identity = 23/44 (52.27%), Postives = 32/44 (72.73%), Query Frame = 3 Query: 132 PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 PN+ IALK LT P+ VA+ +RSFS K+IKN+L S++ + R S Sbjct: 63 PNLYIALKILLTMPVNVASGERSFSLLKLIKNYLRSSMTQNRLS 106
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000048892.1 (SMESG000048892.1) HSP 1 Score: 47.3654 bits (111), Expect = 1.518e-6 Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 3 Query: 63 GTVANEAGFSSFKKAPLND--QVFN-------PNIEIALKTFLTKPMTVATTDRSFSKPKIIKNFLMSTLGKQRAS 263 G + N A + S + LN+ +F PN+ I+++ FLT P+TVA+ +SFSK KIIKN+ ST+ ++R S Sbjct: 30 GEIDNVASYISSEMNALNNINYLFTNNLTYLFPNLVISIRIFLTLPVTVASGKKSFSKLKIIKNYPRSTIRQERLS 105 The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021676 ID=SMED30021676|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1041bpback to top Annotated Terms
The following terms have been associated with this transcript:
|