Succinate-semialdehyde dehydrogenase, mitochondrial

Overview
NameSuccinate-semialdehyde dehydrogenase, mitochondrial
Smed IDSMED30021672
Length (bp)1908
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Succinate-semialdehyde dehydrogenase, mitochondrial (SMED30021672) t-SNE clustered cells

Violin plots show distribution of expression levels for Succinate-semialdehyde dehydrogenase, mitochondrial (SMED30021672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinate-semialdehyde dehydrogenase, mitochondrial (SMED30021672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinate-semialdehyde dehydrogenase, mitochondrial (SMED30021672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30021672h1SMcG0021567 dd_Smed_v4_8292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH5A1 (aldehyde dehydrogenase 5 family member A1 [Source:HGNC Symbol;Acc:HGNC:408])

HSP 1 Score: 146.747 bits (369), Expect = 7.155e-38
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  251 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 408          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH5A1 (aldehyde dehydrogenase 5 family member A1 [Source:HGNC Symbol;Acc:HGNC:408])

HSP 1 Score: 147.132 bits (370), Expect = 2.599e-37
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  350 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 507          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH5A1 (aldehyde dehydrogenase 5 family member A1 [Source:HGNC Symbol;Acc:HGNC:408])

HSP 1 Score: 147.132 bits (370), Expect = 4.771e-37
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  378 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 535          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH5A1 (aldehyde dehydrogenase 5 family member A1 [Source:HGNC Symbol;Acc:HGNC:408])

HSP 1 Score: 146.747 bits (369), Expect = 5.912e-37
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  391 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 548          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Match: ALDH9A1 (aldehyde dehydrogenase 9 family member A1 [Source:HGNC Symbol;Acc:HGNC:412])

HSP 1 Score: 103.99 bits (258), Expect = 9.498e-23
Identity = 60/162 (37.04%), Postives = 84/162 (51.85%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILE--KYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
            +D   GPLIN+  + +V   +  + E GA+V  GG   + E  K   G + +P V+T+C  D    K EIFGPV +I     E   +  AN    GLA  +F+ D ++  RV  ELQ G   +N   VS  E PF G+K+SG G E+G   I+ Y   K +C
Sbjct:  347 EDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVC 508          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-7 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:O02266])

HSP 1 Score: 135.576 bits (340), Expect = 2.712e-36
Identity = 66/156 (42.31%), Postives = 100/156 (64.10%), Query Frame = 1
Query: 1402 QGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
            QGPL+NQ A+ K E L++ ++  G+++  GGKR        G  ++PT+IT+  ++  +   EIFGP+ ++ K  DE+  +  AN+   GLAGY+F  D  ++ RV+ +L++G++GVNEG +S  EA F G KESG+G E G  GIDE+   KYIC
Sbjct:   52 QGPLVNQKAVDKCELLLSDALGKGSELICGGKRG-----EHGTSYEPTLITNVQSNTNIAHTEIFGPIASVQKFRDEQEVLEAANNCRVGLAGYVFGRDQSRLQRVARKLEVGMVGVNEGLISCAEAAFGGVKESGIGREGGAQGIDEFTNWKYIC 202          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-7 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:O02266])

HSP 1 Score: 134.806 bits (338), Expect = 4.341e-35
Identity = 66/158 (41.77%), Postives = 100/158 (63.29%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
              QGPL+NQ A+ K E L++ ++  G+++  GGKR        G  ++PT+IT+  ++  +   EIFGP+ ++ K  DE+  +  AN+   GLAGY+F  D  ++ RV+ +L++G++GVNEG +S  EA F G KESG+G E G  GIDE+   KYIC
Sbjct:  338 TTQGPLVNQKAVDKCELLLSDALGKGSELICGGKRG-----EHGTSYEPTLITNVQSNTNIAHTEIFGPIASVQKFRDEQEVLEAANNCRVGLAGYVFGRDQSRLQRVARKLEVGMVGVNEGLISCAEAAFGGVKESGIGREGGAQGIDEFTNWKYIC 490          

HSP 2 Score: 33.113 bits (74), Expect = 4.341e-35
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            C+SANRI VHE IHD++
Sbjct:  300 CVSANRIYVHEKIHDQY 316          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-7 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:O02266])

HSP 1 Score: 134.806 bits (338), Expect = 4.341e-35
Identity = 66/158 (41.77%), Postives = 100/158 (63.29%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
              QGPL+NQ A+ K E L++ ++  G+++  GGKR        G  ++PT+IT+  ++  +   EIFGP+ ++ K  DE+  +  AN+   GLAGY+F  D  ++ RV+ +L++G++GVNEG +S  EA F G KESG+G E G  GIDE+   KYIC
Sbjct:  338 TTQGPLVNQKAVDKCELLLSDALGKGSELICGGKRG-----EHGTSYEPTLITNVQSNTNIAHTEIFGPIASVQKFRDEQEVLEAANNCRVGLAGYVFGRDQSRLQRVARKLEVGMVGVNEGLISCAEAAFGGVKESGIGREGGAQGIDEFTNWKYIC 490          

HSP 2 Score: 33.113 bits (74), Expect = 4.341e-35
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            C+SANRI VHE IHD++
Sbjct:  300 CVSANRIYVHEKIHDQY 316          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-3 (10-formyltetrahydrofolate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:G5ECV9])

HSP 1 Score: 90.1225 bits (222), Expect = 1.563e-20
Identity = 52/162 (32.10%), Postives = 89/162 (54.94%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDE--KSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
            +    GP  +   + K+ + + ++V  GA+V++GGKR  LE+  +G +F PT++++   ++     E FGP+  ++   D+  +  +R AN    GLA  +F+ D  +  RV+E L  G + VN    +   APF G+K+SG G + G   ++EYLV K I 
Sbjct:  748 RSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEVGGKR--LER--EGLYFPPTILSNIDDENFAASEESFGPIMCVSSFDDDDIEDVLRRANDTEFGLAAGVFTRDSSKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLVTKTIT 905          

HSP 2 Score: 29.261 bits (64), Expect = 1.563e-20
Identity = 10/23 (43.48%), Postives = 18/23 (78.26%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIIIK 1405
            CI+A R+ + +SIHD+F K +++
Sbjct:  713 CIAAGRVFIAKSIHDDFVKKLVE 735          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: alh-11 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q8MNS6])

HSP 1 Score: 82.0333 bits (201), Expect = 3.732e-16
Identity = 49/153 (32.03%), Postives = 75/153 (49.02%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
            +D   G  I+ +   KVE  I+ ++  GA    GG R  +     G +  P ++T  +    +++ EIFG V  I     E  A++IAN  + GLA  L ++D  + +RVSE+L  G + VN         PF G  ESG G E+G   ++ Y
Sbjct:  334 EDTQVGSHISAEHRNKVEGYISTAIAEGATKLCGGDRVAVHGLENGFYLSPCILTGITPKMTVYREEIFGSVLLIIPFDTEDEAIKIANDTDMGLAAGLVTKDLSRSYRVSEQLNAGNVYVNTYNDVSPLVPFGGVGESGFGRENGTAVLEHY 486          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Ssadh (gene:FBgn0039349 transcript:FBtr0100569)

HSP 1 Score: 141.739 bits (356), Expect = 9.919e-36
Identity = 74/165 (44.85%), Postives = 103/165 (62.42%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGN-FFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D   GPLIN+    KV   +  +    A + LGG     +  P KG+ F+ PT++TD      L+  E+FGPV +I +  DE+ AV+ AN    GLAGY +SE+ +Q+FRV++ L++G++GVNEG +S  EAPF G KESG+G E    GID+Y+  KYIC GNL
Sbjct:  347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGG-----QPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYICMGNL 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Ssadh (gene:FBgn0039349 transcript:FBtr0100571)

HSP 1 Score: 141.739 bits (356), Expect = 9.919e-36
Identity = 74/165 (44.85%), Postives = 103/165 (62.42%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGN-FFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D   GPLIN+    KV   +  +    A + LGG     +  P KG+ F+ PT++TD      L+  E+FGPV +I +  DE+ AV+ AN    GLAGY +SE+ +Q+FRV++ L++G++GVNEG +S  EAPF G KESG+G E    GID+Y+  KYIC GNL
Sbjct:  347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGG-----QPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYICMGNL 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Ssadh (gene:FBgn0039349 transcript:FBtr0300728)

HSP 1 Score: 141.739 bits (356), Expect = 9.919e-36
Identity = 74/165 (44.85%), Postives = 103/165 (62.42%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGN-FFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D   GPLIN+    KV   +  +    A + LGG     +  P KG+ F+ PT++TD      L+  E+FGPV +I +  DE+ AV+ AN    GLAGY +SE+ +Q+FRV++ L++G++GVNEG +S  EAPF G KESG+G E    GID+Y+  KYIC GNL
Sbjct:  347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGG-----QPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYICMGNL 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Ssadh (gene:FBgn0039349 transcript:FBtr0084891)

HSP 1 Score: 141.739 bits (356), Expect = 9.919e-36
Identity = 74/165 (44.85%), Postives = 103/165 (62.42%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGN-FFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D   GPLIN+    KV   +  +    A + LGG     +  P KG+ F+ PT++TD      L+  E+FGPV +I +  DE+ AV+ AN    GLAGY +SE+ +Q+FRV++ L++G++GVNEG +S  EAPF G KESG+G E    GID+Y+  KYIC GNL
Sbjct:  347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGG-----QPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYICMGNL 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Ssadh (gene:FBgn0039349 transcript:FBtr0100570)

HSP 1 Score: 141.739 bits (356), Expect = 9.919e-36
Identity = 74/165 (44.85%), Postives = 103/165 (62.42%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGN-FFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D   GPLIN+    KV   +  +    A + LGG     +  P KG+ F+ PT++TD      L+  E+FGPV +I +  DE+ AV+ AN    GLAGY +SE+ +Q+FRV++ L++G++GVNEG +S  EAPF G KESG+G E    GID+Y+  KYIC GNL
Sbjct:  347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGG-----QPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYICMGNL 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 154.066 bits (388), Expect = 4.012e-40
Identity = 74/162 (45.68%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN  A  KVE+ +  +V+ GA V  GGKR       +G+F +PT++++ ++D    + E FGP+  + K + E+ A+ IAN+   GLAGY +S D  QI+RV+E++++G++GVNEG +S  EAPF G K+SGLG E  I+G+DEYL  KY+C G L
Sbjct:  324 TTQGPLINSRAAEKVEKQVADAVDHGAVVVRGGKRL------QGSFMEPTLLSNVTSDMLCMREETFGPLIPVVKFNTEQEALAIANASPVGLAGYFYSRDMAQIWRVAEQMEVGMVGVNEGMISTTEAPFGGIKQSGLGREGSIYGVDEYLEIKYMCLGGL 479          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 154.451 bits (389), Expect = 6.721e-40
Identity = 74/162 (45.68%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN  A  KVE+ +  +V+ GA V  GGKR       +G+F +PT++++ ++D    + E FGP+  + K + E+ A+ IAN+   GLAGY +S D  QI+RV+E++++G++GVNEG +S  EAPF G K+SGLG E  I+G+DEYL  KY+C G L
Sbjct:  366 TTQGPLINSRAAEKVEKQVADAVDHGAVVVRGGKRL------QGSFMEPTLLSNVTSDMLCMREETFGPLIPVVKFNTEQEALAIANASPVGLAGYFYSRDMAQIWRVAEQMEVGMVGVNEGMISTTEAPFGGIKQSGLGREGSIYGVDEYLEIKYMCLGGL 521          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 153.295 bits (386), Expect = 1.604e-39
Identity = 73/162 (45.06%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN  A  KVE+ +  +V+ GA V  GGKR       +G+F +PT++++ ++D    + E FGP+  + K + E+ A+ IAN+   GLAGY +S D  QI+RV+E++++G++GVN+G +S  EAPF G K+SGLG E  I+G+DEYL  KY+C G L
Sbjct:  366 TTQGPLINSRAAEKVEKQVADAVDHGAVVVRGGKRL------QGSFMEPTLLSNVTSDMLCMREETFGPLIPVVKFNTEQEALAIANASPVGLAGYFYSRDMAQIWRVAEQMEVGMVGVNQGMISTTEAPFGGIKQSGLGREGSIYGVDEYLEIKYMCLGGL 521          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: CABZ01032488.1 (wu:fb14d09 [Source:NCBI gene;Acc:100536795])

HSP 1 Score: 95.1301 bits (235), Expect = 6.144e-21
Identity = 54/152 (35.53%), Postives = 80/152 (52.63%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
            +  QGP +N+D  +KV   I+     GA++  GG  A      +G F QPTV  D   D  + + EIFGPV  I K    +  +  AN    GLAG +F++D  +   +S  L+ G + +N   V   +APF G+K SG+G E G +G++ Y
Sbjct:  165 NTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAA----ERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENY 312          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: aldh2.2 (aldehyde dehydrogenase 2 family member, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030326-5])

HSP 1 Score: 94.7449 bits (234), Expect = 7.661e-21
Identity = 54/152 (35.53%), Postives = 80/152 (52.63%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
            +  QGP +N+D  +KV   I+     GA++  GG  A      +G F QPTV  D   D  + + EIFGPV  I K    +  +  AN    GLAG +F++D  +   +S  L+ G + +N   V   +APF G+K SG+G E G +G++ Y
Sbjct:  354 NTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAA----ERGYFIQPTVFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAPFGGYKASGIGREMGEYGLENY 501          

HSP 2 Score: 26.1794 bits (56), Expect = 7.661e-21
Identity = 9/17 (52.94%), Postives = 11/17 (64.71%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            C +  R  V ESI+DEF
Sbjct:  318 CCAGTRTFVQESIYDEF 334          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: ago1 (argonaute 1, RISC catalytic component [Source:Xenbase;Acc:XB-GENE-5933499])

HSP 1 Score: 166.777 bits (421), Expect = 1.212e-44
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  300 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 456          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: ago1 (argonaute 1, RISC catalytic component [Source:Xenbase;Acc:XB-GENE-5933499])

HSP 1 Score: 167.162 bits (422), Expect = 2.424e-44
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  348 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 504          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: ago1 (argonaute 1, RISC catalytic component [Source:Xenbase;Acc:XB-GENE-5933499])

HSP 1 Score: 166.777 bits (421), Expect = 4.081e-44
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  370 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 526          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: ago1 (argonaute 1, RISC catalytic component [Source:Xenbase;Acc:XB-GENE-5933499])

HSP 1 Score: 165.622 bits (418), Expect = 8.950e-44
Identity = 79/161 (49.07%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KV+Q ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  353 TQGPLINEKAVQKVKQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 509          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: aldh1a1 (aldehyde dehydrogenase 1 family member A1 [Source:NCBI gene;Acc:613078])

HSP 1 Score: 93.2041 bits (230), Expect = 1.058e-20
Identity = 56/150 (37.33%), Postives = 83/150 (55.33%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
            NQGP I++D   K+ +LI    + GA+++ GG  A  EK   G +  PTV +D   D  + K EIFGPV  I K       ++ AN+ N GLA  +F++D  +   +S  LQ G + +N  +    ++PF G+K SG G E G +G+ EY
Sbjct:  343 NQGPQIDKDQFDKILELIESGKKEGAKLECGGS-AWGEK---GFYISPTVFSDVKDDMRIAKEEIFGPVQQILKFKRIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTALQAGTVWINCYSAMSPQSPFGGFKMSGNGREMGEYGLHEY 488          

HSP 2 Score: 27.7202 bits (60), Expect = 1.058e-20
Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            CI+ +RI V E I+DEF
Sbjct:  305 CIAGSRIFVEEPIYDEF 321          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh5a1 (aldhehyde dehydrogenase family 5, subfamily A1 [Source:MGI Symbol;Acc:MGI:2441982])

HSP 1 Score: 160.999 bits (406), Expect = 4.106e-42
Identity = 78/162 (48.15%), Postives = 107/162 (66.05%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR        GNFF+PT++++ + D      E FGP+  + K   E+ AV IAN+   GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  366 TTQGPLINEKAVEKVEKQVNDAVAKGATVVTGGKR----HQSGGNFFEPTLLSNVTRDMLCITEETFGPLAPVIKFDKEEEAVAIANAAEVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL 523          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh9a1 (aldehyde dehydrogenase 9, subfamily A1 [Source:MGI Symbol;Acc:MGI:1861622])

HSP 1 Score: 103.605 bits (257), Expect = 8.237e-23
Identity = 59/162 (36.42%), Postives = 83/162 (51.23%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILE--KYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
            +D   GPLIN   + +V   +  + E GA V  GG+  + E  K   G +  P ++T+C  D    K EIFGPV +I     E   +  AN    GLA  +F+ D ++  RV+ ELQ G   +N   VS  E PF G+K+SG G E+G   I+ Y   K +C
Sbjct:  347 EDTRMGPLINAPHLERVLGFVKLAKEQGATVLCGGEVYVPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPVMSILTFGTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVC 508          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1l1 (aldehyde dehydrogenase 1 family, member L1 [Source:MGI Symbol;Acc:MGI:1340024])

HSP 1 Score: 92.0485 bits (227), Expect = 4.055e-21
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPK-GNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISD--EKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICW 1872
            +D N GP  ++  +RK+ +   R V+ GA +  GG +      P+ G FFQPTV TD      + K E FGP+  I++ +D    + +  AN+   GLA  +F+ D  +   VS++LQ G + VN    +   APF G+K+SG G + G   ++EYL  K + +
Sbjct:  742 RDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQV-----PRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTF 900          

HSP 2 Score: 30.0314 bits (66), Expect = 4.055e-21
Identity = 10/23 (43.48%), Postives = 18/23 (78.26%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIIIK 1405
            CI+A R+ V +SIHD+F + +++
Sbjct:  707 CIAAGRLFVEDSIHDQFVQKVVE 729          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1l1 (aldehyde dehydrogenase 1 family, member L1 [Source:MGI Symbol;Acc:MGI:1340024])

HSP 1 Score: 92.0485 bits (227), Expect = 4.055e-21
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPK-GNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISD--EKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICW 1872
            +D N GP  ++  +RK+ +   R V+ GA +  GG +      P+ G FFQPTV TD      + K E FGP+  I++ +D    + +  AN+   GLA  +F+ D  +   VS++LQ G + VN    +   APF G+K+SG G + G   ++EYL  K + +
Sbjct:  742 RDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQV-----PRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTF 900          

HSP 2 Score: 30.0314 bits (66), Expect = 4.055e-21
Identity = 10/23 (43.48%), Postives = 18/23 (78.26%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIIIK 1405
            CI+A R+ V +SIHD+F + +++
Sbjct:  707 CIAAGRLFVEDSIHDQFVQKVVE 729          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Aldh1a1 (aldehyde dehydrogenase family 1, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353450])

HSP 1 Score: 90.8929 bits (224), Expect = 5.557e-21
Identity = 56/150 (37.33%), Postives = 81/150 (54.00%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
            NQGP I+++   K+  LI    + GA+++ GG R       KG F QPTV ++ + +  + K EIFGPV  I K       ++ AN+   GLA  LF++D  +   VS  LQ G++ VN   +   + PF G+K SG G E G  G+ EY
Sbjct:  341 NQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRW----GNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEY 486          

HSP 2 Score: 30.4166 bits (67), Expect = 5.557e-21
Identity = 11/19 (57.89%), Postives = 16/19 (84.21%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKK 1393
            C++A+RI V ES++DEF K
Sbjct:  303 CVAASRIFVEESVYDEFVK 321          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P51650|SSDH_RAT (Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh5a1 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 5.672e-42
Identity = 79/162 (48.77%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR        GNFF+PT++++ + D      E FGPV  + K   E+ AV IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  366 TTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKR----HQSGGNFFEPTLLSNVTRDMLCITEETFGPVAPVIKFDKEEEAVAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL 523          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8BWF0|SSDH_MOUSE (Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh5a1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.872e-41
Identity = 78/162 (48.15%), Postives = 107/162 (66.05%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR        GNFF+PT++++ + D      E FGP+  + K   E+ AV IAN+   GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  366 TTQGPLINEKAVEKVEKQVNDAVAKGATVVTGGKR----HQSGGNFFEPTLLSNVTRDMLCITEETFGPLAPVIKFDKEEEAVAIANAAEVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL 523          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|B9F3B6|SSDH_ORYSJ (Succinate-semialdehyde dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ALDH5F1 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 8.005e-41
Identity = 78/164 (47.56%), Postives = 109/164 (66.46%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            +  +QGPLIN+ A++KVE+ IN +   GA + LGGKR  L      +F++PTV+ + S D  LF+ E+FGPV  +     E+ A+R+AN  N GLA Y+F++   + +RVSE L+ G++GVNEG +S   APF G K+SGLG E   +G+DEYL  KYIC GNL
Sbjct:  367 ESTSQGPLINEAAVQKVEKFINDATSKGANIMLGGKRHSLGM----SFYEPTVVGNVSNDMLLFREEVFGPVAPLVPFKTEEDAIRMANDTNAGLAAYIFTKSIPRSWRVSEALEYGLVGVNEGIISTEVAPFGGVKQSGLGREGSKYGMDEYLELKYICMGNL 526          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6A2H0|SSDH_PANTR (Succinate-semialdehyde dehydrogenase, mitochondrial OS=Pan troglodytes OX=9598 GN=ALDH5A1 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.967e-36
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  378 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 535          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6A2H1|SSDH_GORGO (Succinate-semialdehyde dehydrogenase, mitochondrial OS=Gorilla gorilla gorilla OX=9595 GN=ALDH5A1 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.063e-36
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +N +V  GA V  GGKR  L K    NFF+PT++ + + D      E FGP+  + K   E+ A+ IAN+ + GLAGY +S+D  QI+RV+E+L++G++GVNEG +S  E PF G K+SGLG E   +GIDEYL  KY+C+G L
Sbjct:  378 TTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK----NFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 535          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A401Q1J6 (Aldedh domain-containing protein (Fragment) OS=Scyliorhinus torazame OX=75743 GN=scyTo_0019520 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.981e-43
Identity = 80/164 (48.78%), Postives = 111/164 (67.68%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            +   QGPLIN+ A++KVE  I+ +V  GA +  GGKR        G FF+PT++++ +TD    + E FGP+  + K   E+ AV IAN+ N GLAGY +S DH QI+RV+E+L++GI+GVNEG +S  EAPF G K+SGLG E   +GID+YL  KY+C+G L
Sbjct:   38 EQTTQGPLINERAVKKVEGQISDAVSRGASIVTGGKR----HSSGGTFFEPTLLSNVTTDMLCAQEETFGPLAPVLKFRTEEEAVTIANASNVGLAGYFYSRDHAQIWRVAEQLEVGIVGVNEGLLSTPEAPFGGLKQSGLGREGSKYGIDDYLEIKYVCFGGL 197          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: F6YU71 (Argonaute 1, RISC catalytic component OS=Xenopus tropicalis OX=8364 GN=ppp3cc PE=4 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.904e-41
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  300 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 456          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A0B7AUN9 (Succinate-semialdehyde dehydrogenase OS=Arion vulgaris OX=1028688 GN=ORF142130 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.881e-41
Identity = 82/162 (50.62%), Postives = 110/162 (67.90%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLINQ A+ KV+ L+  +V SGA V  GG    L     GNF+QPT++T  +T+  + K EIFGPV A  K   E+ A+ IANS+ +GLAGY ++ D  Q +R+SE+L+ G++GVNEG +S  EA F GWKESG+G E G +GIDEYL  KY+C+G +
Sbjct:  367 TTQGPLINQRAVEKVDGLVKDAVGSGANVVCGGSGDSL----GGNFYQPTLLTGVTTNMRIAKEEIFGPVAATIKFQTEEEAIAIANSVTSGLAGYFYTSDIAQAWRISEQLEYGLLGVNEGVISGVEAAFGGWKESGIGREGGKYGIDEYLEMKYVCYGGI 524          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: B4F708 (Succinate-semialdehyde dehydrogenase OS=Xenopus tropicalis OX=8364 GN=aldh5a1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 3.027e-41
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  332 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 488          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Match: F6YTH6 (Succinate-semialdehyde dehydrogenase OS=Xenopus tropicalis OX=8364 GN=ptger3 PE=3 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 3.807e-41
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
             QGPLIN+ A++KVEQ ++ +V  GAQ++ GGKR+ + K    NFF+PT++++ +TD    + E FGP+  + K   E+ AV IANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  E PF G K+SG+G E   +GIDEYL  KY+C+G L
Sbjct:  348 TQGPLINEKAVQKVEQHVSNAVSLGAQIEAGGKRSAVGK----NFFEPTLLSNVTTDMLCTQEETFGPLAPVIKFDTEEEAVAIANSANVGLAGYFYSQDPAQIWRVAERLEVGMVGVNEGLLSSVECPFGGVKQSGIGREGSKYGIDEYLEVKYVCFGGL 504          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh5a1 (aldehyde dehydrogenase 5 family member A1 [Source:NCBI gene;Acc:103033070])

HSP 1 Score: 152.14 bits (383), Expect = 1.992e-39
Identity = 78/162 (48.15%), Postives = 106/162 (65.43%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN  A  KVE+ I  +V  GA V  GGKR       +G+F QPT++++ ST+    + E FGP+  + K + E+ A+ IAN+   GLAGY FS+D  QI+RV+E+L++G++GVNEG +S  EA F G K+SGLG E   +GIDEYL  KY+C G L
Sbjct:  327 TTQGPLINVRAAEKVERQIADAVSQGAMVLKGGKRL------EGSFMQPTLLSNVSTNMQCMQEETFGPLIPVVKFNTEEEALAIANASPVGLAGYFFSQDLSQIWRVAEQLEVGMVGVNEGLISAAEAAFGGIKQSGLGREGSKYGIDEYLEVKYVCIGGL 482          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh5a1 (aldehyde dehydrogenase 5 family member A1 [Source:NCBI gene;Acc:103033070])

HSP 1 Score: 152.14 bits (383), Expect = 3.099e-39
Identity = 78/162 (48.15%), Postives = 106/162 (65.43%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN  A  KVE+ I  +V  GA V  GGKR       +G+F QPT++++ ST+    + E FGP+  + K + E+ A+ IAN+   GLAGY FS+D  QI+RV+E+L++G++GVNEG +S  EA F G K+SGLG E   +GIDEYL  KY+C G L
Sbjct:  355 TTQGPLINVRAAEKVERQIADAVSQGAMVLKGGKRL------EGSFMQPTLLSNVSTNMQCMQEETFGPLIPVVKFNTEEEALAIANASPVGLAGYFFSQDLSQIWRVAEQLEVGMVGVNEGLISAAEAAFGGIKQSGLGREGSKYGIDEYLEVKYVCIGGL 510          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh5a1 (aldehyde dehydrogenase 5 family member A1 [Source:NCBI gene;Acc:103033070])

HSP 1 Score: 95.9005 bits (237), Expect = 1.189e-21
Identity = 50/113 (44.25%), Postives = 71/113 (62.83%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQ 1734
              QGPLIN  A  KVE+ I  +V  GA V  GGKR       +G+F QPT++++ ST+    + E FGP+  + K + E+ A+ IAN+   GLAGY FS+D  QI+RV+E+L+
Sbjct:  355 TTQGPLINVRAAEKVERQIADAVSQGAMVLKGGKRL------EGSFMQPTLLSNVSTNMQCMQEETFGPLIPVVKFNTEEEALAIANASPVGLAGYFFSQDLSQIWRVAEQLE 461          

HSP 2 Score: 27.335 bits (59), Expect = 1.189e-21
Identity = 10/25 (40.00%), Postives = 15/25 (60.00%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIIIKVL 1411
            C+ +NR LV   IHD F + + K +
Sbjct:  317 CVCSNRFLVQSGIHDAFLEKLGKTM 341          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh1a3 (aldehyde dehydrogenase 1 family member A3 [Source:NCBI gene;Acc:103032207])

HSP 1 Score: 93.2041 bits (230), Expect = 6.987e-20
Identity = 56/157 (35.67%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
             + GP INQ    K+  L+      GA+++ GG  A+ +K   G F QPT+ +D      L K EIFGPV  I K   ++  +  ANS + GLA  +F+    +   VS  L+ G + VN     H +APF G+K SG G E G + + EY   K +
Sbjct:  245 TSHGPQINQQQFEKILDLVESGKREGAKLECGG-HALQDK---GLFIQPTIFSDVKDHMRLAKEEIFGPVQCIMKFKSQEEVIERANSTHYGLAAAVFTRSVDRAMSVSSALEAGTVWVNCYNALHAQAPFGGYKMSGNGRELGEYALAEYTEVKAV 397          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:103042804])

HSP 1 Score: 89.7373 bits (221), Expect = 7.139e-20
Identity = 51/155 (32.90%), Postives = 79/155 (50.97%), Query Frame = 1
Query: 1402 QGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            QGP I+ +  R+V + +   +  GA+++ GGK      + KG + QPTV ++      + + EIFGPV  I K    +  +  AN+   GL   +F+ D  +   +S  LQ G + +N      C+ PF G+K SG G E G +G+ EY   K I
Sbjct:  360 QGPQISAEQQRRVLEFVESGISEGAKLECGGK----AHFSKGFYIQPTVFSNVQDHMRIAREEIFGPVQQIMKFKTMEEVIERANNTEYGLTAAVFTNDISKAMAISTALQAGTVWINCFNALSCQCPFGGFKMSGNGRELGEYGLREYTEVKTI 510          

HSP 2 Score: 27.7202 bits (60), Expect = 7.139e-20
Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            C + +RI V ESI+DEF
Sbjct:  321 CTAGSRIFVEESIYDEF 337          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 149.058 bits (375), Expect = 1.526e-39
Identity = 76/162 (46.91%), Postives = 103/162 (63.58%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            N  GPLIN+ A+ KVE+ +  +V  GA+V +GG R  L     G+FFQPTV+ D + +    + E FGP+  I K   E+ A+ +ANS   GLAGY FS D  Q++RVSE L++G++G NEG +S  EAPF G K+SGLG E    G+ EY+  KY+C G L
Sbjct:  261 NTLGPLINEHALEKVERHVVDAVSQGARVVVGGARHAL----GGSFFQPTVLADVTPNMLCAREETFGPLAPIIKFKTEEEAIALANSTAMGLAGYFFSRDVAQVWRVSEALEVGMVGANEGLLSAVEAPFGGIKQSGLGREGAQQGMLEYMHVKYVCLGGL 418          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004609.1 (pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 gene:ENSPMAG00000004155.1 transcript:ENSPMAT00000004609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 2.042e-21
Identity = 56/159 (35.22%), Postives = 85/159 (53.46%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYP-KGNFFQ-PTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
               G LI+Q  + +V   + R+V+ GA++  GGK+ + E    KG FF  P V+ +C  D    + EIFGPV A+     E+  ++ AN+ + GLA  +F++D  +  RV   LQ G   +N   V   E PF G+K SG G E+G+  +D Y   K +
Sbjct:  356 TTMGALISQSHLDRVLAYVQRAVQEGAKLVCGGKKYVPEDPSLKGGFFMTPCVLAECRDDMQAVREEIFGPVMAVLAFDTEEEVLQRANATDFGLAAGVFTKDLTRAHRVIAALQAGSCYINNYNVVLMEMPFGGYKMSGFGRENGMATVDYYTQLKTV 514          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh8a1 (aldehyde dehydrogenase 8 family, member A1 [Source:NCBI gene;Acc:447801])

HSP 1 Score: 93.5893 bits (231), Expect = 1.833e-20
Identity = 53/145 (36.55%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPK---GNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTE 1821
            +N GPLI+++ + KV   +  +   G QV  G     L   P+   G F  PTVIT    D P  + EIFGPV  ++   DE  AV  +N +  GLA  ++S D  ++ RV++ LQ GI+  N   +     PF G K SG+G E
Sbjct:  324 SNMGPLISKEHLAKVRGYVELAERDGGQVLCGEGVDPLLLPPRCQGGYFLAPTVITGVPDDSPAMQEEIFGPVVCVSPFEDEDEAVTRSNGVRYGLAAVVWSRDVARVHRVAKRLQAGIVWTNCWLIRELNLPFGGMKASGIGRE 468          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002659.1 (pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene:ENSPMAG00000002422.1 transcript:ENSPMAT00000002659.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 3.868e-19
Identity = 48/153 (31.37%), Postives = 79/153 (51.63%), Query Frame = 1
Query: 1408 PLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            P I++    K+ +L+  ++E GA ++ GG    +    +G + QPTV +D      + + EIFGPV  I +    +  V  AN+   GL G +F+ D  +   VS  +Q G + +N     + ++PF G+K SG G E G +G+ EY   K +
Sbjct:    1 PQIDEKQRSKILELVQSALEEGAHLECGG----VACEGRGFYVQPTVFSDVPDSARITREEIFGPVQLIMRFDSLEDVVARANASPYGLVGAVFTRDLERALAVSAAMQAGTVWINCYNAMNAQSPFGGYKMSGNGREMGEYGLQEYTEVKTV 149          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: aldh1l2 (aldehyde dehydrogenase 1 family, member L2 [Source:ZFIN;Acc:ZDB-GENE-100426-6])

HSP 1 Score: 67.3958 bits (163), Expect = 4.707e-15
Identity = 46/162 (28.40%), Postives = 80/162 (49.38%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFF-QPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNT--GLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            +  + GP  ++  + K+ +     V+ GA +  GG++      P+   F  P+V T       + + E FGP+  I+K  D      +A + NT  GLA  +F+ D  +   VS++L+ G + +N    +   APF G+K+SG G + G   ++EYL  K +
Sbjct:  531 RSTDHGPQNHRAHMEKLVEYCEVGVKEGATLVHGGRQV-----PRPEVFANPSVFTGVEDHMYIAQEESFGPIMVISKFPDGDIDGVLARANNTEFGLASGVFTRDISKALYVSDQLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLRTKAV 687          

HSP 2 Score: 31.187 bits (69), Expect = 4.707e-15
Identity = 11/23 (47.83%), Postives = 18/23 (78.26%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIIIK 1405
            CI+A R+ V ESIHDE+ + +++
Sbjct:  496 CIAAGRLFVEESIHDEYVRRVVE 518          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: UGA2 (Succinate semialdehyde dehydrogenase; involved in the utilization of gamma-aminobutyrate (GABA) as a nitrogen source; part of the 4-aminobutyrate and glutamate degradation pathways; localized to the cytoplasm [Source:SGD;Acc:S000000210])

HSP 1 Score: 112.079 bits (279), Expect = 7.796e-28
Identity = 62/162 (38.27%), Postives = 89/162 (54.94%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
               G +IN  AI KVE+    +++ GA+V L G R + E  P  NF+ P +++   +   + K E FGP+C I      +  V  AN    GLA Y+FS++   ++ VSE L+ G++  N G  S C  PF G KESG G E  ++GI++Y V K I  GNL
Sbjct:  335 TTHGCVINSSAIEKVERHKQDAIDKGAKVVLEGGR-LTELGP--NFYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLAAYVFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLYGIEDYTVLKTITIGNL 493          

HSP 2 Score: 29.261 bits (64), Expect = 7.796e-28
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKII 1399
            C+ ANR+ VH SI D+F K++
Sbjct:  298 CVCANRLYVHSSIIDKFAKLL 318          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: MSC7 (Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum; msc7 mutants are defective in directing meiotic recombination events to homologous chromatids [Source:SGD;Acc:S000001081])

HSP 1 Score: 97.8265 bits (242), Expect = 8.202e-22
Identity = 52/162 (32.10%), Postives = 89/162 (54.94%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSH-CEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            + G +I+ +   ++E L+  +V  GA++  GG R    KYP+G++FQPT++ D + +  + +NE+FGP+  + K  +    V++ANS   GL G +F  D ++   V+  LQ G + +N+ A  + C+ PF G   SG G   G  G+      K +C+  L
Sbjct:  431 DMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFKHPKYPQGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSVFGADIKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAKSVCFDTL 592          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD3 (Cytoplasmic aldehyde dehydrogenase; involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose [Source:SGD;Acc:S000004779])

HSP 1 Score: 86.6557 bits (213), Expect = 2.122e-18
Identity = 46/156 (29.49%), Postives = 81/156 (51.92%), Query Frame = 1
Query: 1405 GPLINQDAIRKVEQLINR-------SVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYL 1851
            GP+I+     +++  I R        +   ++  +GG         KG F  PT+ TD      L ++EIFGPV  ++K ++   A+++AN    GLA  +F++D ++    + +++ G + +N+      + PF G+K SG+G ESG  G+D YL
Sbjct:  346 GPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGA--------KGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYL 493          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD2 (Cytoplasmic aldehyde dehydrogenase; involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p [Source:SGD;Acc:S000004780])

HSP 1 Score: 83.1889 bits (204), Expect = 3.206e-17
Identity = 46/161 (28.57%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1405 GPLINQDAIRKVEQLINR-------SVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            GP+I+     +++  I R        +   ++  +GG         KG F  PT+ TD      L ++EIFGPV  ++K ++   A+++AN    GLA  +F++D ++    + +++ G + +N         PF G+K SG+G E G  G+D YL  K +
Sbjct:  346 GPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGA--------KGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGRELGQSGVDTYLQTKAV 498          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Match: ALD4 (Mitochondrial aldehyde dehydrogenase; required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed; can substitute for cytosolic NADP-dependent aldehyde dehydrogenase when directed to the cytosol; human homolog ALDH2 can complement yeast ald4 mutant [Source:SGD;Acc:S000005901])

HSP 1 Score: 77.7962 bits (190), Expect = 4.258e-16
Identity = 46/155 (29.68%), Postives = 72/155 (46.45%), Query Frame = 1
Query: 1402 QGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            QG   +Q  + K+ + ++     GA +  GG+R       KG F +PTV  D   D  + K EIFGPV  +TK       + +AN    GLA  + + +     +V++ +  G + +N     H   PF G+  SGLG E  +  +  YL  K +
Sbjct:  363 QGAQTSQMQLNKILKYVDIGKNEGATLITGGERL----GSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSVDALQNYLQVKAV 513          

HSP 2 Score: 23.8682 bits (50), Expect = 4.258e-16
Identity = 8/17 (47.06%), Postives = 13/17 (76.47%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEF 1387
            C + +R+ V ESI+D+F
Sbjct:  324 CCAGSRVYVEESIYDKF 340          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO45404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT61])

HSP 1 Score: 157.918 bits (398), Expect = 8.667e-42
Identity = 77/163 (47.24%), Postives = 108/163 (66.26%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKG-NFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
              QGPLIN+ A+ KVE+ +  ++  GA++  GG R     +P+G NFF+PTV+TD S D  + K E FGP+  + +   E  AV IANS  +GLAGY +S+D  Q++RV+E L++G++GVNE  +S   APF GWK+SGLG E   +GI EYL  KY+C G +
Sbjct:  330 TTQGPLINKMAVEKVERHVADALSKGAKLMRGGHR-----HPQGENFFEPTVLTDVSPDMLVCKEETFGPLAPLVRFKTEAEAVAIANSTQSGLAGYFYSQDLSQVWRVAEALEVGLVGVNESMISTEVAPFGGWKQSGLGIEGSRYGIHEYLETKYVCMGGI 487          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO27561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8X3])

HSP 1 Score: 125.946 bits (315), Expect = 2.961e-31
Identity = 61/159 (38.36%), Postives = 95/159 (59.75%), Query Frame = 1
Query: 1399 NQGPLINQDAIRKVEQLINRSVESGAQV--KLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYIC 1869
            N GPLINQ AI   + LI+ ++   AQ+   L   R++      GNF  P V+ +C+++  +F  EIF PV A+ K S ++  + +AN    GLA Y +S++  ++F +++ELQ GI+G+N G +S    PF G K SG G E   +G+D+Y+  KY+C
Sbjct:  258 NIGPLINQAAIDHAKGLIDDAINQKAQLLYHLEEDRSL-----NGNFLNPVVLGNCNSNMRIFNEEIFAPVIAVYKFSTDEEVINLANKTRFGLASYFYSQNTSRVFNIADELQYGIVGINSGLISAENVPFGGVKHSGFGREGSFYGLDDYINIKYVC 411          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO25608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW01])

HSP 1 Score: 97.4413 bits (241), Expect = 1.278e-22
Identity = 46/160 (28.75%), Postives = 79/160 (49.38%), Query Frame = 1
Query: 1396 NNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWG 1875
               GPLI       +E  +   +  G ++  GG+R    ++ +G +++PT+I     D  + + EIFGPV       +E   +  AN     LA  +++ D++  +R+   +Q G + +N         PF GW++SGLG E G  GI +Y+ +K + WG
Sbjct:  104 TQMGPLITAKHRESIESYVALGLSEGGRLLTGGQRPEGAQFERGYYYRPTIIDGVKNDWQICQQEIFGPVLVAMPFDNEDDLLAQANDSVYALAAGIWTRDYKSAWRIGRAVQAGTVWINTYKQFSISTPFGGWRDSGLGREKGRLGIQQYMEQKSMYWG 263          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO29328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3Y4])

HSP 1 Score: 92.8189 bits (229), Expect = 4.279e-21
Identity = 50/152 (32.89%), Postives = 81/152 (53.29%), Query Frame = 1
Query: 1405 GPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKK 1860
            G +++     ++   I+R+   GA +  GG+R  L      +F QPT+ T+ S D  L + E+FGPV A+     E+ AVR+AN+   GLA  L+++D  +  RV++ L+ G + VN         PF G K+SG G +  +   D+Y + K
Sbjct:  248 GAIVDARQAERIMGFIDRAQSQGATLVCGGQR--LSINGSDSFIQPTIFTNVSPDMQLAQEEVFGPVLAVIPFDSEEEAVRLANNSQYGLAASLWTDDLNRAHRVAKRLRAGTVSVNTVDALDVCVPFGGCKQSGFGRDLSLHAFDKYSLMK 397          

HSP 2 Score: 26.9498 bits (58), Expect = 4.279e-21
Identity = 10/22 (45.45%), Postives = 16/22 (72.73%), Query Frame = 2
Query: 1337 CISANRILVHESIHDEFKKIII 1402
            C + +R+LV  SIHDEF + ++
Sbjct:  208 CSANSRLLVERSIHDEFVQCLV 229          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO34362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ4])

HSP 1 Score: 96.2857 bits (238), Expect = 4.396e-21
Identity = 54/159 (33.96%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAIL-EKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            D   G +I+   + KV   +    + GA+V  GG+R  L E    G +  P V+ +C+ D  + K EIFGPV  +     E+ AV  AN+   GLAG +F+ D  +  RV   LQ G   +N   ++  E PF G+K SG G E G   ++ Y   K +
Sbjct:  296 DTQMGAMISSAHLNKVLDYVQIGKDEGAKVLCGGERLHLPEPLTSGYYMSPCVMAECTDDMTVVKEEIFGPVMTVLTFQTEEEAVTRANNTTFGLAGGIFTRDLNRAHRVIGSLQAGTCWINSFNITPVEVPFGGYKMSGFGREGGTAAVEHYTQLKTV 454          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh5a1 (aldehyde dehydrogenase 5 family member A1 [Source:NCBI gene;Acc:101159164])

HSP 1 Score: 157.532 bits (397), Expect = 3.913e-41
Identity = 78/163 (47.85%), Postives = 107/163 (65.64%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNL 1881
            D  QGPLIN  A  KV   I+ +V  GA+V  GGKR       +G+F +PT++ D ST+    + E FGP+  + +   E+ AV +ANS N GLAGY +S+D  QI+RV+E L++G++GVNEG +S  EAPF G K+SGLG E   +G+DEYL  KY+C+G L
Sbjct:  347 DTTQGPLINARAAEKVAHQISDAVSHGAKVLRGGKRL------EGSFMEPTLLADVSTEMLCTREETFGPLLPVIRFETEEEAVAVANSANVGLAGYFYSQDVSQIWRVAEALEVGMVGVNEGLLSAPEAPFGGVKQSGLGREGSKYGVDEYLEVKYMCFGGL 503          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh1a2 (aldehyde dehydrogenase 1 family member A2 [Source:NCBI gene;Acc:100049450])

HSP 1 Score: 91.6633 bits (226), Expect = 3.955e-19
Identity = 57/155 (36.77%), Postives = 82/155 (52.90%), Query Frame = 1
Query: 1402 QGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            QGP I+++   +V + I   ++ GA+++ GGK   L    KG F +PTV +D   D  + K EIFGPV  I K    + A+  AN+ + GL   +F+ D  +   VS  +Q G + VN       + PF G+K SG G E G  G+ EYL  K I
Sbjct:  359 QGPQISREHQNRVLEYIQSGIQEGAKLECGGKALGL----KGFFIEPTVFSDVKDDMRIAKEEIFGPVQQIMKFKTVEEAIERANNSDYGLTAAVFTTDINKAMTVSTAMQAGTVWVNCFNALSTQCPFGGYKMSGNGRELGESGLKEYLEIKTI 509          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh9a1b (aldehyde dehydrogenase family 9 member A1-B [Source:NCBI gene;Acc:101155544])

HSP 1 Score: 88.5817 bits (218), Expect = 4.593e-18
Identity = 52/161 (32.30%), Postives = 82/161 (50.93%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILE--KYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            +    G L+++  + KV   + ++   GA V  GG+  +    K   G +  P V+ DC+ D    K EIFGPV ++     E+ A++ AN    GLA  +F+ D ++  RV E L+ G   +N   V+  E PF G+K SG+G E+G   I+ Y   K +
Sbjct:  346 ESTRMGALVSRPHLDKVLSYVQQAKAEGATVLCGGEPFVPSDPKLRGGYYMSPCVLGDCTDDMTCVKEEIFGPVMSVLSFETEEEALQRANDTTLGLAAGIFTRDVKRAHRVVEHLKAGSCFINNYNVTPVEVPFGGFKMSGIGRENGQVTIEFYSQMKTV 506          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh9a1 (aldehyde dehydrogenase 9 family member A1 [Source:NCBI gene;Acc:100049493])

HSP 1 Score: 86.6557 bits (213), Expect = 1.623e-17
Identity = 49/154 (31.82%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILE--KYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
                G LI +  + KV   ++++ + G +V  GG+  +    K   G F  P ++ +C  D    K EIFGPV ++     E+  +R AN+   GLA  +F+ D  +  RV+  L+ G   +N   +S  E PF G+K SG G E+G   I+ Y
Sbjct:  335 STRMGALITKPHLEKVLGFVSQAKKEGGRVLCGGEPFVPSDPKLKGGYFMSPCILDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVIRRANNTTFGLASGVFTRDISRAHRVAASLEAGTCFINNYNISPVEVPFGGYKMSGFGRENGQVTIEYY 488          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: aldh9a1 (aldehyde dehydrogenase 9 family member A1 [Source:NCBI gene;Acc:100049493])

HSP 1 Score: 86.6557 bits (213), Expect = 1.623e-17
Identity = 49/154 (31.82%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1393 DNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILE--KYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEY 1848
                G LI +  + KV   ++++ + G +V  GG+  +    K   G F  P ++ +C  D    K EIFGPV ++     E+  +R AN+   GLA  +F+ D  +  RV+  L+ G   +N   +S  E PF G+K SG G E+G   I+ Y
Sbjct:  335 STRMGALITKPHLEKVLGFVSQAKKEGGRVLCGGEPFVPSDPKLKGGYFMSPCILDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVIRRANNTTFGLASGVFTRDISRAHRVAASLEAGTCFINNYNISPVEVPFGGYKMSGFGRENGQVTIEYY 488          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000015620.1 (SMESG000015620.1)

HSP 1 Score: 347.051 bits (889), Expect = 2.148e-112
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query: 1390 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNLY 1884
            KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNLY
Sbjct:  339 KDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYICWGNLY 503          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000059107.1 (SMESG000059107.1)

HSP 1 Score: 140.969 bits (354), Expect = 6.654e-39
Identity = 76/179 (42.46%), Postives = 106/179 (59.22%), Query Frame = 1
Query:  517 VRREHALRYTGLPSTYSASEIIFIDEVGFQVSTRVTTVKSFVGSPATITVPNIEKTRLEV--------ILVYRCQPFGFNTQTFLDYVTGLMSNLRRGNMKNAIFIVDNVPFYKSMAVQTLSQNGGYNLDYLPPYSPFLNPIENLFSKWKEHTKKVNSNNEIELIRAIENVKYLITLID 1029
             R+E+AL ++ + S YS  E+IFIDEVGF VS R T  +S +G+PAT+ VP I    + +        +L Y+      N + F++Y+T L   L    +   +FI+DN  F+KS  V +   N    + +LPPYSPFLNPIEN+FSKWKE  K+ N  NE +L+RAIE    LI+  D
Sbjct: 1369 TRKEYALNFSFILSIYSEQELIFIDEVGFNVSMRTTRGRSQIGTPATLNVPTIRSRNISIACAMNKNGLLFYKSFNRALNKEKFIEYITELKEVLIDKEIHRCVFIMDNAKFHKSPEVLSAINNENTTVKFLPPYSPFLNPIENMFSKWKEIIKRANLRNEDDLMRAIEIGSTLISSQD 1547          

HSP 2 Score: 40.0466 bits (92), Expect = 6.654e-39
Identity = 21/58 (36.21%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  339 WLDEH*LYLSLSSIKNRILTIFDISDSAPSIFRYIKDFHYSLKRTYLILVRRNDPDTI 512
            W+D++   LSL  +   + T F I  S   ++  +  FHYS+KR +LI  RRN  + I
Sbjct: 1311 WVDDN-CQLSLKVLVENVFTEFQIRISTTYVYNLLSLFHYSMKRLHLIPERRNSTEVI 1367          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1)

HSP 1 Score: 122.865 bits (307), Expect = 4.514e-31
Identity = 70/179 (39.11%), Postives = 101/179 (56.42%), Query Frame = 1
Query:  517 VRREHALRYTGLPSTYSASEIIFIDEVGFQVSTRVTTVKSFVGSPATITVPNIEKTRLEV--------ILVYRCQPFGFNTQTFLDYVTGLMSNLRRGNMKNAIFIVDNVPFYKSMAVQTLSQNGGYNLDYLPPYSPFLNPIENLFSKWKEHTKKVNSNNEIELIRAIENVKYLITLID 1029
            +R ++A R+  L ST   S+I FIDEVGF VS R    +S     A   V +I    + V        I  Y  Q   +NTQ+FL+++  ++  +   N+  AIFI+DNVPF+K++A++   +  G+ + +LPPYSPFLNPIENLF KWK+  +      E +L   IEN   LI+  D
Sbjct:  537 LRAQYANRFMELLSTIDDSKIFFIDEVGFNVSIRSRRGRSLKNKRAVQNVSSIRARNISVCCAMNKEGIFKYFTQTKSYNTQSFLEFIRLIIEKMSSLNISGAIFIMDNVPFHKNIAIKEEIEISGHRILFLPPYSPFLNPIENLFLKWKQFIRSSRPEGEDQLFENIENGSSLISSDD 715          

HSP 2 Score: 31.9574 bits (71), Expect = 4.514e-31
Identity = 19/58 (32.76%), Postives = 33/58 (56.90%), Query Frame = 3
Query:  339 WLDEH*LYLSLSSIKNRILTIFDISDSAPSIFRYIKDFHYSLKRTYLILVRRNDPDTI 512
            W+D++   L+L  IK++I     +  S  +I R I  F YS+KR  ++ ++RN  + I
Sbjct:  479 WIDKN-CALTLKQIKSKIELERGVVVSQSTINRCIGGFGYSMKRINIMPIKRNTVEVI 535          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.348e-28
Identity = 70/179 (39.11%), Postives = 101/179 (56.42%), Query Frame = 1
Query:  517 VRREHALRYTGLPSTYSASEIIFIDEVGFQVSTRVTTVKSFVGSPATITVPNIEKTRLEV--------ILVYRCQPFGFNTQTFLDYVTGLMSNLRRGNMKNAIFIVDNVPFYKSMAVQTLSQNGGYNLDYLPPYSPFLNPIENLFSKWKEHTKKVNSNNEIELIRAIENVKYLITLID 1029
            +R ++A R+  L ST   S+I FIDEVGF VS R    +S     A   V +I    + V        I  Y  Q   +NTQ+FL+++  ++  +   N+  AIFI+DNVPF+K++A++   +  G+ + +LPPYSPFLNPIENLF KWK+  +      E +L   IEN   LI+  D
Sbjct:   19 LRAQYANRFMELLSTIDDSKIFFIDEVGFNVSIRSRRGRSLKNKRAVQNVSSIRARNISVCCAMNKEGIFKYFTQTKSYNTQSFLEFIRLIIEKMSSLNISGAIFIMDNVPFHKNIAIKEEIEISGHRILFLPPYSPFLNPIENLFLKWKQFIRSSRPEGEDQLFENIENGSSLISSDD 197          
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000016195.1 (SMESG000016195.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.730e-19
Identity = 56/159 (35.22%), Postives = 83/159 (52.20%), Query Frame = 1
Query: 1393 DN-NQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEAPFSGWKESGLGTESGIFGIDEYLVKKYI 1866
            DN +QGP I+++ + K+   I+     GAQ+  GGK+       KG F +PT+ T       + K EIFGPV  I K  D    +  AN+   GLA  +F++D  +   V++ L+ G + VN   V    APF G+K SG+G E G +G+  Y   K +
Sbjct:  357 DNVDQGPQIDEEQMNKILGFIDSGKSEGAQMCTGGKQI----GSKGFFIEPTIFTKVEDSMRIAKEEIFGPVMQIMKFKDTNEVIARANNNEYGLAASIFTQDIDKSLHVTQSLRAGTVWVNCYDVFDAAAPFGGYKSSGVGRELGEYGLSNYTEVKMV 511          
The following BLAST results are available for this feature:
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDH5A17.155e-3848.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
ALDH5A12.599e-3748.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
ALDH5A14.771e-3748.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
ALDH5A15.912e-3748.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
ALDH9A19.498e-2337.04aldehyde dehydrogenase 9 family member A1 [Source:... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alh-72.712e-3642.31ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-74.341e-3541.77ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-74.341e-3541.77ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-31.563e-2032.1010-formyltetrahydrofolate dehydrogenase [Source:U... [more]
alh-113.732e-1632.03ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ssadh9.919e-3644.85gene:FBgn0039349 transcript:FBtr0100569[more]
Ssadh9.919e-3644.85gene:FBgn0039349 transcript:FBtr0100571[more]
Ssadh9.919e-3644.85gene:FBgn0039349 transcript:FBtr0300728[more]
Ssadh9.919e-3644.85gene:FBgn0039349 transcript:FBtr0084891[more]
Ssadh9.919e-3644.85gene:FBgn0039349 transcript:FBtr0100570[more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh5a14.012e-4045.68aldehyde dehydrogenase 5 family, member A1 (succin... [more]
aldh5a16.721e-4045.68aldehyde dehydrogenase 5 family, member A1 (succin... [more]
aldh5a11.604e-3945.06aldehyde dehydrogenase 5 family, member A1 (succin... [more]
CABZ01032488.16.144e-2135.53wu:fb14d09 [Source:NCBI gene;Acc:100536795][more]
aldh2.27.661e-2135.53aldehyde dehydrogenase 2 family member, tandem dup... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago11.212e-4449.69argonaute 1, RISC catalytic component [Source:Xenb... [more]
ago12.424e-4449.69argonaute 1, RISC catalytic component [Source:Xenb... [more]
ago14.081e-4449.69argonaute 1, RISC catalytic component [Source:Xenb... [more]
ago18.950e-4449.07argonaute 1, RISC catalytic component [Source:Xenb... [more]
aldh1a11.058e-2037.33aldehyde dehydrogenase 1 family member A1 [Source:... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh5a14.106e-4248.15aldhehyde dehydrogenase family 5, subfamily A1 [So... [more]
Aldh9a18.237e-2336.42aldehyde dehydrogenase 9, subfamily A1 [Source:MGI... [more]
Aldh1l14.055e-2134.15aldehyde dehydrogenase 1 family, member L1 [Source... [more]
Aldh1l14.055e-2134.15aldehyde dehydrogenase 1 family, member L1 [Source... [more]
Aldh1a15.557e-2137.33aldehyde dehydrogenase family 1, subfamily A1 [Sou... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51650|SSDH_RAT5.672e-4248.77Succinate-semialdehyde dehydrogenase, mitochondria... [more]
sp|Q8BWF0|SSDH_MOUSE2.872e-4148.15Succinate-semialdehyde dehydrogenase, mitochondria... [more]
sp|B9F3B6|SSDH_ORYSJ8.005e-4147.56Succinate-semialdehyde dehydrogenase, mitochondria... [more]
sp|Q6A2H0|SSDH_PANTR1.967e-3648.15Succinate-semialdehyde dehydrogenase, mitochondria... [more]
sp|Q6A2H1|SSDH_GORGO2.063e-3648.15Succinate-semialdehyde dehydrogenase, mitochondria... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401Q1J63.981e-4348.78Aldedh domain-containing protein (Fragment) OS=Scy... [more]
F6YU711.904e-4149.69Argonaute 1, RISC catalytic component OS=Xenopus t... [more]
A0A0B7AUN92.881e-4150.62Succinate-semialdehyde dehydrogenase OS=Arion vulg... [more]
B4F7083.027e-4149.69Succinate-semialdehyde dehydrogenase OS=Xenopus tr... [more]
F6YTH63.807e-4149.69Succinate-semialdehyde dehydrogenase OS=Xenopus tr... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh5a11.992e-3948.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
aldh5a13.099e-3948.15aldehyde dehydrogenase 5 family member A1 [Source:... [more]
aldh5a11.189e-2144.25aldehyde dehydrogenase 5 family member A1 [Source:... [more]
aldh1a36.987e-2035.67aldehyde dehydrogenase 1 family member A3 [Source:... [more]
aldh1a27.139e-2032.90aldehyde dehydrogenase 1 family member A2 [Source:... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh5a11.526e-3946.91aldehyde dehydrogenase 5 family, member A1 (succin... [more]
ENSPMAT00000004609.12.042e-2135.22pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 g... [more]
aldh8a11.833e-2036.55aldehyde dehydrogenase 8 family, member A1 [Source... [more]
ENSPMAT00000002659.13.868e-1931.37pep scaffold:Pmarinus_7.0:GL481598:469:3326:1 gene... [more]
aldh1l24.707e-1528.40aldehyde dehydrogenase 1 family, member L2 [Source... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UGA27.796e-2838.27Succinate semialdehyde dehydrogenase; involved in ... [more]
MSC78.202e-2232.10Protein of unknown function; green fluorescent pro... [more]
ALD32.122e-1829.49Cytoplasmic aldehyde dehydrogenase; involved in be... [more]
ALD23.206e-1728.57Cytoplasmic aldehyde dehydrogenase; involved in et... [more]
ALD44.258e-1629.68Mitochondrial aldehyde dehydrogenase; required for... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454048.667e-4247.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275612.961e-3138.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256081.278e-2228.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO293284.279e-2132.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343624.396e-2133.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh5a13.913e-4147.85aldehyde dehydrogenase 5 family member A1 [Source:... [more]
aldh1a23.955e-1936.77aldehyde dehydrogenase 1 family member A2 [Source:... [more]
aldh9a1b4.593e-1832.30aldehyde dehydrogenase family 9 member A1-B [Sourc... [more]
aldh9a11.623e-1731.82aldehyde dehydrogenase 9 family member A1 [Source:... [more]
aldh9a11.623e-1731.82aldehyde dehydrogenase 9 family member A1 [Source:... [more]
back to top
BLAST of Succinate-semialdehyde dehydrogenase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015620.12.148e-112100.00SMESG000015620.1[more]
SMESG000059107.16.654e-3942.46SMESG000059107.1[more]
SMESG000026481.14.514e-3139.11SMESG000026481.1[more]
SMESG000026481.11.348e-2839.11SMESG000026481.1[more]
SMESG000016195.11.730e-1935.22SMESG000016195.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021672 ID=SMED30021672|Name=Succinate-semialdehyde dehydrogenase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1908bp
CCGGCCCTGGCTGAATCCTATATTTCGCTGACATCAAATACACTCCCAGC
ACCTATTAATATAACAAATTTACCATTATATCTAGATTCACCGCTTCAAG
TCCTAGCAATTATTCCTAGAAGATATGTTACAACAAGTGATACTGATAGA
TCACGAATAATAGATTTATACGTTTCTGGAAATAGCATGGCTAGATTAGC
TTTGGTTCTGGGTTTGAAGAAGTCGACAATTAGTGCTATAATAAAGCAAT
ATAAAGACAGTAGAAAAAAGTTCGCAAGCGTTCGAGGTGGAGCTCATAAC
ACAAAATTGAATGATGAAAAAAACTCCTGATTAAAACGTGGCTTGATGAA
CATTGATTGTACTTAAGTCTCTCGTCTATAAAGAATAGAATTCTTACAAT
ATTCGATATCTCAGATTCTGCTCCTTCAATTTTTCGATATATCAAAGATT
TTCATTATTCGCTGAAAAGAACATACTTGATTCTTGTGCGTCGCAATGAT
CCAGATACGATCTTAAGTACGTCGAGAACACGCTCTAAGATATACTGGCT
TGCCTTCTACGTATAGCGCCAGCGAGATTATTTTTATAGATGAGGTGGGT
TTTCAGGTTTCTACCAGAGTTACAACGGTAAAATCGTTTGTAGGAAGTCC
GGCTACCATCACTGTACCTAACATCGAAAAAACTAGATTAGAAGTCATAC
TGGTGTATAGGTGTCAACCCTTTGGATTTAATACTCAAACGTTCCTTGAT
TATGTTACAGGATTAATGTCAAATTTGCGCAGAGGAAACATGAAAAACGC
AATTTTTATTGTGGACAATGTTCCGTTTTACAAGAGTATGGCTGTTCAGA
CTCTTAGTCAGAATGGAGGATATAATCTCGACTATTTGCCTCCTTATAGC
CCGTTTCTAAATCCAATCGAAAACCTTTTTAGTAAGTGGAAGGAGCATAC
CAAAAAAGTCAATAGTAATAACGAGATTGAATTAATTCGGGCAATTGAGA
ATGTAAAATATTTGATTACACTCATTGACTGAAGAATATTTCAGAAATAT
GTCAAGCTATATTCAAAGAAGCATTATTGGAGATTAAATAACCTTATTTA
TATCATTTATATTTAGTGTATAGCAAATTTTGGTGTATTAATGTATTTTC
ATTGTAAACATAATAAAATAATAATTTCGAAATTAAATTTGAATCTAAAG
AAATGAAATTTGAATTTTATAAAGTCAGATTTGAACTTAACAAAATCAGA
TTAGTCTGATAAACCCTGTAGGTTAAAATTATACATTAAAGATTAAGAAC
TCTAGTTTATTATTAACCATATTAAGATTTTAGGCCTGCATATCTGCTAA
TCGAATCCTTGTTCATGAATCTATCCACGATGAGTTTAAAAAGATAATAA
TCAAGGTCCTTTAATCAATCAGGATGCTATTAGAAAAGTTGAGCAATTAA
TAAACAGATCTGTTGAATCAGGTGCTCAAGTTAAACTTGGGGGTAAACGG
GCTATTTTAGAAAAGTATCCGAAGGGAAACTTTTTTCAACCCACGGTTAT
TACTGATTGCAGTACAGATCATCCACTTTTCAAAAATGAAATCTTTGGAC
CTGTGTGTGCAATTACAAAGATTTCGGATGAGAAATCAGCAGTTCGAATA
GCAAATTCACTTAATACTGGATTGGCTGGTTATTTGTTCAGTGAAGATCA
TAGACAAATTTTTAGAGTTTCAGAAGAACTTCAAATGGGTATCATCGGAG
TAAATGAAGGTGCGGTTTCTCATTGTGAAGCTCCATTTAGTGGCTGGAAA
GAATCAGGTTTGGGCACAGAAAGTGGAATTTTTGGAATAGATGAATATTT
AGTTAAAAAGTACATATGTTGGGGAAATCTTTACTAGTAATAATTTACAA
ATTTCCTG
back to top

protein sequence of SMED30021672-orf-1

>SMED30021672-orf-1 ID=SMED30021672-orf-1|Name=SMED30021672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
PALAESYISLTSNTLPAPINITNLPLYLDSPLQVLAIIPRRYVTTSDTDR
SRIIDLYVSGNSMARLALVLGLKKSTISAIIKQYKDSRKKFASVRGGAHN
TKLNDEKNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016491oxidoreductase activity
GO:0003677DNA binding
GO:0004777succinate-semialdehyde dehydrogenase (NAD+) activity
GO:0009013succinate-semialdehyde dehydrogenase [NAD(P)+] activity
GO:0031406carboxylic acid binding
GO:0051287NAD binding
Vocabulary: INTERPRO
TermDefinition
IPR016163Ald_DH_C
IPR016161Ald_DH/histidinol_DH
IPR015590Aldehyde_DH_dom
IPR009057Homeobox-like_sf
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
GO:0006105succinate metabolic process
GO:0007417central nervous system development
GO:0009450gamma-aminobutyric acid catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 42..103