39S ribosomal protein L23

Overview
Name39S ribosomal protein L23
Smed IDSMED30021657
Length (bp)758
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 39S ribosomal protein L23 (SMED30021657) t-SNE clustered cells

Violin plots show distribution of expression levels for 39S ribosomal protein L23 (SMED30021657) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 39S ribosomal protein L23 (SMED30021657) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 39S ribosomal protein L23 (SMED30021657) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Match: MRPL23 (mitochondrial ribosomal protein L23 [Source:HGNC Symbol;Acc:HGNC:10322])

HSP 1 Score: 65.4698 bits (158), Expect = 9.075e-13
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R+VVYP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL  IY+V    V+T++ +       +NK    + ++        PD     KVAY++L  G  F FP++F E    P+
Sbjct:    3 RNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG------SNKRRDHRNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDESPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Match: MRPL23 (mitochondrial ribosomal protein L23 [Source:HGNC Symbol;Acc:HGNC:10322])

HSP 1 Score: 65.4698 bits (158), Expect = 9.075e-13
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R+VVYP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL  IY+V    V+T++ +       +NK    + ++        PD     KVAY++L  G  F FP++F E    P+
Sbjct:    3 RNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG------SNKRRDHRNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDESPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Match: MRPL23 (mitochondrial ribosomal protein L23 [Source:HGNC Symbol;Acc:HGNC:10322])

HSP 1 Score: 65.4698 bits (158), Expect = 9.075e-13
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R+VVYP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL  IY+V    V+T++ +       +NK    + ++        PD     KVAY++L  G  F FP++F E    P+
Sbjct:    3 RNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG------SNKRRDHRNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDESPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Match: MRPL23 (mitochondrial ribosomal protein L23 [Source:HGNC Symbol;Acc:HGNC:10322])

HSP 1 Score: 65.4698 bits (158), Expect = 9.075e-13
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R+VVYP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL  IY+V    V+T++ +       +NK    + ++        PD     KVAY++L  G  F FP++F E    P+
Sbjct:    3 RNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG------SNKRRDHRNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDESPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Match: AC004556.3 (39S ribosomal protein L23, mitochondrial [Source:NCBI gene;Acc:107987373])

HSP 1 Score: 65.4698 bits (158), Expect = 1.015e-12
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R+VVYP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL  IY+V    V+T++ +       +NK    + ++        PD     KVAY++L  G  F FP++F E    P+
Sbjct:    3 RNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG------SNKRRDHRNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDESPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Celegans
Match: mrpl-23 (Probable 39S ribosomal protein L23, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9GYS9])

HSP 1 Score: 58.5362 bits (140), Expect = 1.347e-10
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  131 GDPKLRIPLVPYWMKLV----YLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFE 475
            G+P+ R+ L  +WM +V          P   VKF++ P+M+ HD++EYL KIYD+    V+T++   D   +T N  +  +  K   +       +  +K+AY+ +  G +F +P +FE
Sbjct:   12 GNPQRRVFLPDFWMAVVESPSVGRNRLPRNCVKFEVDPRMSRHDIREYLTKIYDLPVRDVRTEVQMGD---ITWNSKLDHQYKKAMWK-------DEDKKIAYVFMSKGFEFSYPQMFE 120          
BLAST of 39S ribosomal protein L23 vs. Ensembl Fly
Match: mRpL23 (gene:FBgn0035335 transcript:FBtr0289966)

HSP 1 Score: 65.4698 bits (158), Expect = 5.374e-13
Identity = 46/143 (32.17%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNR 541
            YP Y  G+P+LR+ L  +WMKL+      PP +V F +  +MT +DV+ YL KIY +  + V+T++   + +   T   IT+K                  K+AY+ L   + F FP+ F E + +   +E S   + KAG R
Sbjct:    6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKK---------------DDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSL-DESKAGFR 132          
BLAST of 39S ribosomal protein L23 vs. Ensembl Fly
Match: mRpL23 (gene:FBgn0035335 transcript:FBtr0072900)

HSP 1 Score: 65.4698 bits (158), Expect = 5.374e-13
Identity = 46/143 (32.17%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNR 541
            YP Y  G+P+LR+ L  +WMKL+      PP +V F +  +MT +DV+ YL KIY +  + V+T++   + +   T   IT+K                  K+AY+ L   + F FP+ F E + +   +E S   + KAG R
Sbjct:    6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKK---------------DDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSL-DESKAGFR 132          
BLAST of 39S ribosomal protein L23 vs. Ensembl Fly
Match: mRpL23 (gene:FBgn0035335 transcript:FBtr0331416)

HSP 1 Score: 65.4698 bits (158), Expect = 5.374e-13
Identity = 46/143 (32.17%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNR 541
            YP Y  G+P+LR+ L  +WMKL+      PP +V F +  +MT +DV+ YL KIY +  + V+T++   + +   T   IT+K                  K+AY+ L   + F FP+ F E + +   +E S   + KAG R
Sbjct:    6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKK---------------DDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSL-DESKAGFR 132          
BLAST of 39S ribosomal protein L23 vs. Ensembl Fly
Match: mRpL23 (gene:FBgn0035335 transcript:FBtr0331415)

HSP 1 Score: 65.4698 bits (158), Expect = 5.374e-13
Identity = 46/143 (32.17%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNR 541
            YP Y  G+P+LR+ L  +WMKL+      PP +V F +  +MT +DV+ YL KIY +  + V+T++   + +   T   IT+K                  K+AY+ L   + F FP+ F E + +   +E S   + KAG R
Sbjct:    6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQTYGYITKK---------------DDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSL-DESKAGFR 132          
BLAST of 39S ribosomal protein L23 vs. Ensembl Zebrafish
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:415142])

HSP 1 Score: 67.781 bits (164), Expect = 1.021e-13
Identity = 47/129 (36.43%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNK---MITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE 478
            + ++YP Y LG+P+LRI    + M LV      PP+ V+F+I   MT  DV+ YL KIY V    V+T++ Y       +NK    + ++V +        PD     KVAY++L     FQFP+IF E
Sbjct:    3 KRIIYPLYQLGNPQLRIFRPTFNMTLVRPGKEQPPDTVQFRISMAMTKCDVRNYLEKIYSVPVSAVRTRIQY------CSNKKRNHLNQRVKR--------PD----YKVAYVQLAQQQTFQFPDIFPE 113          
BLAST of 39S ribosomal protein L23 vs. Ensembl Zebrafish
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:415142])

HSP 1 Score: 67.781 bits (164), Expect = 1.021e-13
Identity = 47/129 (36.43%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNK---MITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE 478
            + ++YP Y LG+P+LRI    + M LV      PP+ V+F+I   MT  DV+ YL KIY V    V+T++ Y       +NK    + ++V +        PD     KVAY++L     FQFP+IF E
Sbjct:    3 KRIIYPLYQLGNPQLRIFRPTFNMTLVRPGKEQPPDTVQFRISMAMTKCDVRNYLEKIYSVPVSAVRTRIQY------CSNKKRNHLNQRVKR--------PD----YKVAYVQLAQQQTFQFPDIFPE 113          
BLAST of 39S ribosomal protein L23 vs. Ensembl Xenopus
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:496986])

HSP 1 Score: 72.7886 bits (177), Expect = 1.639e-15
Identity = 45/132 (34.09%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            R V+YP Y LG+P+LR+    + M LV      PP+  +F+I  +MT  DV+ YL  IY V   TV+T++ Y           + ++V +        PD     KVAY++L  G  FQFP++F +    P+
Sbjct:    3 RKVIYPLYQLGNPQLRVFRTNFQMTLVRPGREQPPDTAQFRIPLEMTKADVQNYLQSIYSVPVATVRTRIQYGSNR---KRNHLNQRVKR--------PD----YKVAYVQLGQGQTFQFPDLFPQKDKTPE 119          
BLAST of 39S ribosomal protein L23 vs. Ensembl Xenopus
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:496986])

HSP 1 Score: 68.9366 bits (167), Expect = 4.845e-14
Identity = 43/128 (33.59%), Postives = 65/128 (50.78%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPD 496
            YP Y LG+P+LR+    + M LV      PP+  +F+I  +MT  DV+ YL  IY V   TV+T++ Y           + ++V +        PD     KVAY++L  G  FQFP++F +    P+
Sbjct:   13 YPLYQLGNPQLRVFRTNFQMTLVRPGREQPPDTAQFRIPLEMTKADVQNYLQSIYSVPVATVRTRIQYGSNR---KRNHLNQRVKR--------PD----YKVAYVQLGQGQTFQFPDLFPQKDKTPE 125          
BLAST of 39S ribosomal protein L23 vs. Ensembl Mouse
Match: Mrpl23 (mitochondrial ribosomal protein L23 [Source:MGI Symbol;Acc:MGI:1196612])

HSP 1 Score: 68.1662 bits (165), Expect = 6.549e-14
Identity = 47/141 (33.33%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE---NSPEPDYDELSK 514
            R+V+YP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL +IY+V    V+T++ +       +N+    K ++        PD     KVAY++L  G  F FP++F E    SPEP  +EL +
Sbjct:    3 RNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHG------SNRRRDHKNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQ 128          
BLAST of 39S ribosomal protein L23 vs. Ensembl Mouse
Match: Mrpl23 (mitochondrial ribosomal protein L23 [Source:MGI Symbol;Acc:MGI:1196612])

HSP 1 Score: 64.6994 bits (156), Expect = 1.918e-12
Identity = 45/137 (32.85%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  107 VVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE---NSPEPDYDEL 508
            + YP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL +IY+V    V+T++ +       +N+    K ++        PD     KVAY++L  G  F FP++F E    SPEP  +EL
Sbjct:   31 IRYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHG------SNRRRDHKNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEEL 152          
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Match: sp|O35972|RM23_MOUSE (39S ribosomal protein L23, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl23 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.581e-13
Identity = 47/141 (33.33%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE---NSPEPDYDELSK 514
            R+V+YP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL +IY+V    V+T++ +       +N+    K ++        PD     KVAY++L  G  F FP++F E    SPEP  +EL +
Sbjct:    3 RNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHG------SNRRRDHKNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQ 128          
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Match: sp|Q63750|RM23_RAT (39S ribosomal protein L23, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mrpl23 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.292e-13
Identity = 49/156 (31.41%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIF---EENSPEPDYDEL---SKGSKPKAGNREGW 550
            R+V+YP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL +IY+V    V+T++ +       +N+    K ++        PD     KVAY++L  G  F FP++F   E  SP+P  +EL    + S P+      W
Sbjct:    3 RNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHG------SNRRRDHKNVRIK-----KPD----YKVAYVQLAHGQTFTFPDLFPEKEPTSPDPLEEELPQQRQSSDPRCPGIPSW 143          
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Match: sp|Q6IQS9|RM23_DANRE (39S ribosomal protein L23, mitochondrial OS=Danio rerio OX=7955 GN=mrpl23 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.705e-13
Identity = 47/129 (36.43%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNK---MITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEE 478
            + ++YP Y LG+P+LRI    + M LV      PP+ V+F+I   MT  DV+ YL KIY V    V+T++ Y       +NK    + ++V +        PD     KVAY++L     FQFP+IF E
Sbjct:    3 KRIIYPLYQLGNPQLRIFRPTFNMTLVRPGKEQPPDTVQFRISMAMTKCDVRNYLEKIYSVPVSAVRTRIQY------CSNKKRNHLNQRVKR--------PD----YKVAYVQLAQQQTFQFPDIFPE 113          
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Match: sp|B5FWC0|RM23_OTOGA (39S ribosomal protein L23, mitochondrial OS=Otolemur garnettii OX=30611 GN=MRPL23 PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.083e-12
Identity = 48/163 (29.45%), Postives = 76/163 (46.63%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPE---PDYDELS----------KGSKPKAGNREGW 550
            R+V+YP Y LG P+LR+    ++++LV      P + V+F+I  +MT  D++ YL +IY+V    V+T++ +          +  +K           PD     KVAY++L  G  F FP++F E  P       DE            +GS P+ G    W
Sbjct:    3 RNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQHGSHRKRDHRNVRIKK-----------PD----YKVAYVQLAHGQTFTFPDLFPEKDPRLEGSSVDEAQSTFMADEQQRQGSDPQRGGVPNW 150          
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Match: sp|Q5TUE9|RM23_ANOGA (Probable 39S ribosomal protein L23, mitochondrial OS=Anopheles gambiae OX=7165 GN=mRpL23 PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.625e-12
Identity = 43/131 (32.82%), Postives = 66/131 (50.38%), Query Frame = 2
Query:  113 YPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDE 505
            YP Y  G+P+LR+ L  +W+KLV      PP +V+F    +MT HDVK YL KIY+V  + V+T++        T   ++   + K           E   K AY+ L    +F FP+IF  ++ +   D+
Sbjct:    6 YPIYQRGNPQLRVFLPNFWLKLVRPANEQPPNVVQFACSMEMTRHDVKNYLEKIYNVPVVNVRTRIALGG----TKRDLVLGYITK-----------EEDTKYAYVTLPRTKQFTFPDIFPTDAKQKIEDD 121          
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Match: A0A0X3PCQ2 (39S ribosomal protein L23 OS=Schistocephalus solidus OX=70667 GN=RM23 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.600e-43
Identity = 79/163 (48.47%), Postives = 108/163 (66.26%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGS 520
            M+P+IY NPI I KT +Y PLW RHVVYPK+  GDP+LR+ L P+WMK++Y     P  L  FK+HPQMT  DV++YL KIY V   +V+ KM+Y+DL PL   +   ++    +L      +PERYEK+AY+ L PG  F+FP+IF++ SP  + D L  G+
Sbjct:    1 MRPVIYFNPIAIPKTKHYVPLWNRHVVYPKFTPGDPQLRMFLPPFWMKMIYPGKDCPKCLAVFKVHPQMTQFDVRQYLEKIYKVPVASVRLKMLYHDLPPLDVAE-DPKRAAGATLPHSLPLEPERYEKLAYVHLPPGHDFEFPDIFKDKSPSEELDRLLSGT 162          
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Match: A0A183TS24 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS19272 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.197e-42
Identity = 79/163 (48.47%), Postives = 108/163 (66.26%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGS 520
            M+P+IY NPI I KT +Y PLW RHVVYPK+  GDP+LR+ L P+WMK++Y     P  L  FK+HPQMT  DV++YL KIY V   +V+ KM+Y+DL PL   +   ++    +L      +PERYEK+AY+ L PG  F+FP+IF++ SP  + D L  G+
Sbjct:    1 MRPVIYFNPIAIPKTKHYVPLWNRHVVYPKFTPGDPQLRMFLPPFWMKMIYPGKDCPKCLAVFKVHPQMTQFDVRQYLEKIYKVPVASVRLKMLYHDLPPLDVAE-DPKRAAGATLPHSLPLEPERYEKLAYVHLPPGHDFEFPDIFKDKSPSEELDRLLSGT 162          
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Match: A0A087VXE1 (Mitochondrial ribosomal protein l23 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000070700 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.859e-41
Identity = 77/150 (51.33%), Postives = 104/150 (69.33%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEEN 481
            M+P+IY NPI I KT +Y PLW RHVVYPK+  GDP+LR+ L P+WMK++Y     P  LV FK+HPQMT +DVK+YL KIY V  + V+ KM+Y+DL PL T +    + +  +       +PERYEKVAY+ L PG +F+FP+IF++ 
Sbjct:   14 MRPVIYFNPIAIPKTKHYVPLWNRHVVYPKFTPGDPQLRMFLPPFWMKMLYPGEKCPKRLVVFKVHPQMTKYDVKQYLEKIYKVPVIGVQLKMLYHDLHPLDTAE-DPRRAVGAAFPHLLPREPERYEKVAYVHLAPGYEFEFPDIFKDG 162          
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Match: A0A5J4ND27 (Large subunit ribosomal protein L23 OS=Paragonimus westermani OX=34504 GN=DEA37_0012063 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.927e-41
Identity = 75/153 (49.02%), Postives = 108/153 (70.59%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLR-FQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSP 487
            M+P+I++ PI + KT +Y PLW+R+V YPK+  GDP++R  L P+WMK++Y   + PP+ V FK+HPQMT  DV++YL KIY+V  + V+ KM+Y+DLEP+      +EKV++ S   F   P PERYEK+AY+RL P + F+FPN+F    P
Sbjct:   37 MRPVIFIRPICLPKTPHYVPLWQRYVEYPKFTPGDPQIRCFLPPFWMKMLYPGPYNPPDHVIFKVHPQMTTMDVQQYLEKIYNVPVLHVRVKMVYHDLEPIDEP---SEKVIRRSAEPFMFPPKPERYEKLAYVRLAPNNSFEFPNLFANKRP 186          
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Match: A0A183QUK7 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 4.920e-41
Identity = 76/167 (45.51%), Postives = 109/167 (65.27%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKA 532
            ++P+I++ PI + KT++Y+PLW+R V YPK   GDP +   L P+WMK++Y     PP  V FK+HPQMT  DV++YL KIY+V    V+ KM+Y+DLEP+      + + L  S +F   P PERYEKVAY+RL PG+ F FP++F++  P    D L+ G   K+
Sbjct:    4 VRPVIFIRPICLPKTTHYFPLWRRQVEYPKVFPGDPPVPCFLPPFWMKMMYPGPKNPPNHVVFKVHPQMTKRDVQQYLEKIYNVPVADVRVKMVYHDLEPIDEPAFRSAQRLADSTQF--PPKPERYEKVAYVRLVPGEVFVFPDLFKDKRPSDAVDILNGGDAAKS 168          
BLAST of 39S ribosomal protein L23 vs. Ensembl Cavefish
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:415142])

HSP 1 Score: 57.3806 bits (137), Expect = 2.021e-10
Identity = 32/76 (42.11%), Postives = 44/76 (57.89%), Query Frame = 2
Query:   98 KRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDL 325
             R ++YP Y LG+P+LRI      M LV      P + V+F+I  QMT  DV+ YL KIY V    V+T++ Y +L
Sbjct:    2 SRRLIYPIYQLGNPQLRIFRPTVSMTLVRPGKEQPSDTVQFRIPMQMTKFDVRNYLEKIYSVPVSGVRTRIQYCEL 77          
BLAST of 39S ribosomal protein L23 vs. Ensembl Cavefish
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:415142])

HSP 1 Score: 56.6102 bits (135), Expect = 1.324e-9
Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIY 316
            R ++YP Y LG+P+LRI      M LV      P + V+F+I  QMT  DV+ YL KIY V    V+T++ Y
Sbjct:    3 RRLIYPIYQLGNPQLRIFRPTVSMTLVRPGKEQPSDTVQFRIPMQMTKFDVRNYLEKIYSVPVSGVRTRIQY 74          
BLAST of 39S ribosomal protein L23 vs. Ensembl Sea Lamprey
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:415142])

HSP 1 Score: 70.8626 bits (172), Expect = 1.371e-15
Identity = 53/164 (32.32%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  101 RHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIF-----EENSPEP---------DYDELSKGSKPKAGNREGW 550
            R V+ P Y  G+P+LR+    ++MK+V      P + V+F++  +MT  DVK YL KIY+V    V+T++ Y       +NK   +  L   L+    PD     KVAY++L  G  F FPN+F     +E  PE          + +E  K    + GN   W
Sbjct:    3 RRVLMPIYQYGNPQLRVFRTNFFMKMVRPGKELPEDTVQFRVSMEMTKFDVKNYLQKIYNVSVAEVRTRIQYG------SNK--KKNHLNQHLK---KPDY----KVAYVQLAQGQTFTFPNLFPEKETKEEDPESLEAFERMFRENEEQRKKGDTRRGNMNEW 151          
BLAST of 39S ribosomal protein L23 vs. Ensembl Medaka
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:101158163])

HSP 1 Score: 65.0846 bits (157), Expect = 8.333e-13
Identity = 43/130 (33.08%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  104 HVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEP 493
            +++ P Y LG+P+LRI    +++ LV      PP+  +F++  +MT +DVK YL KIY+V    V+T++ +   +       + +KV K        PD     KVAY++L  G  F FP++F E    P
Sbjct:    4 NIIVPIYQLGNPQLRIFRPNWFLTLVRPGKEQPPDTAQFRVPMEMTKYDVKNYLEKIYNVPVGVVRTRIQFGSNK---KRNHLNQKVKK--------PD----YKVAYVQLAQGQTFTFPDVFPEKDQTP 118          
BLAST of 39S ribosomal protein L23 vs. Ensembl Medaka
Match: mrpl23 (mitochondrial ribosomal protein L23 [Source:NCBI gene;Acc:101158163])

HSP 1 Score: 63.5438 bits (153), Expect = 4.495e-12
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  116 PKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEP 493
            P Y LG+P+LRI    +++ LV      PP+  +F++  +MT +DVK YL KIY+V    V+T++ +   +       + +KV K        PD     KVAY++L  G  F FP++F E    P
Sbjct:   31 PIYQLGNPQLRIFRPNWFLTLVRPGKEQPPDTAQFRVPMEMTKYDVKNYLEKIYNVPVGVVRTRIQFGSNK---KRNHLNQKVKK--------PD----YKVAYVQLAQGQTFTFPDVFPEKDQTP 141          
BLAST of 39S ribosomal protein L23 vs. Planmine SMEST
Match: SMESG000037729.1 (SMESG000037729.1)

HSP 1 Score: 350.903 bits (899), Expect = 2.591e-124
Identity = 172/173 (99.42%), Postives = 173/173 (100.00%), Query Frame = 2
Query:   32 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNREGW 550
            MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGN+EGW
Sbjct:    1 MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLVYLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEPLTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEENSPEPDYDELSKGSKPKAGNQEGW 173          
The following BLAST results are available for this feature:
BLAST of 39S ribosomal protein L23 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRPL239.075e-1332.58mitochondrial ribosomal protein L23 [Source:HGNC S... [more]
MRPL239.075e-1332.58mitochondrial ribosomal protein L23 [Source:HGNC S... [more]
MRPL239.075e-1332.58mitochondrial ribosomal protein L23 [Source:HGNC S... [more]
MRPL239.075e-1332.58mitochondrial ribosomal protein L23 [Source:HGNC S... [more]
AC004556.31.015e-1232.5839S ribosomal protein L23, mitochondrial [Source:N... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl-231.347e-1030.25Probable 39S ribosomal protein L23, mitochondrial ... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mRpL235.374e-1332.17gene:FBgn0035335 transcript:FBtr0289966[more]
mRpL235.374e-1332.17gene:FBgn0035335 transcript:FBtr0072900[more]
mRpL235.374e-1332.17gene:FBgn0035335 transcript:FBtr0331416[more]
mRpL235.374e-1332.17gene:FBgn0035335 transcript:FBtr0331415[more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl231.021e-1336.43mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
mrpl231.021e-1336.43mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl231.639e-1534.09mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
mrpl234.845e-1433.59mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mrpl236.549e-1433.33mitochondrial ribosomal protein L23 [Source:MGI Sy... [more]
Mrpl231.918e-1232.85mitochondrial ribosomal protein L23 [Source:MGI Sy... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35972|RM23_MOUSE4.581e-1333.3339S ribosomal protein L23, mitochondrial OS=Mus mu... [more]
sp|Q63750|RM23_RAT6.292e-1331.4139S ribosomal protein L23, mitochondrial OS=Rattus... [more]
sp|Q6IQS9|RM23_DANRE7.705e-1336.4339S ribosomal protein L23, mitochondrial OS=Danio ... [more]
sp|B5FWC0|RM23_OTOGA3.083e-1229.4539S ribosomal protein L23, mitochondrial OS=Otolem... [more]
sp|Q5TUE9|RM23_ANOGA3.625e-1232.82Probable 39S ribosomal protein L23, mitochondrial ... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PCQ23.600e-4348.4739S ribosomal protein L23 OS=Schistocephalus solid... [more]
A0A183TS241.197e-4248.47Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A087VXE11.859e-4151.33Mitochondrial ribosomal protein l23 OS=Echinococcu... [more]
A0A5J4ND273.927e-4149.02Large subunit ribosomal protein L23 OS=Paragonimus... [more]
A0A183QUK74.920e-4145.51Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl232.021e-1042.11mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
mrpl231.324e-943.06mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl231.371e-1532.32mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 39S ribosomal protein L23 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl238.333e-1333.08mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
mrpl234.495e-1234.13mitochondrial ribosomal protein L23 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L23 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037729.12.591e-12499.42SMESG000037729.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021657 ID=SMED30021657|Name=39S ribosomal protein L23|organism=Schmidtea mediterranea sexual|type=transcript|length=758bp
TTTTTTTTGTTTAACTTACAAAATAATTTAAATGAAACCGTTAATATATG
TTAATCCTATAAGAATCCTTAAAACTTCATATTATTATCCATTATGGAAG
AGACACGTAGTTTACCCAAAATATAACTTAGGAGATCCAAAATTACGAAT
TCCTCTAGTCCCATATTGGATGAAATTGGTTTATCTCGATGGGCATTATC
CTCCTGAATTAGTTAAATTTAAAATCCATCCCCAAATGACAGATCATGAT
GTCAAAGAATATTTAATTAAAATATATGATGTCAAACCAATGACAGTGAA
AACAAAAATGATTTACAATGATTTGGAACCTCTGACAACAAATAAAATGA
TTACTGAAAAAGTATTGAAAACTTCTTTACGGTTCCAGTGTGCCCCGGAT
CCTGAACGATATGAGAAAGTTGCGTACATTAGATTGTTCCCTGGTGATAA
ATTTCAGTTCCCAAATATATTCGAGGAAAACAGTCCAGAACCTGACTATG
ATGAATTATCTAAAGGAAGTAAACCCAAAGCTGGAAATCGGGAAGGGTGG
TTTTTATAAAATAAAATGCTTTATAAACTTTATTTTTGAAAATACAATAA
TAATAATAACATCATTTAAAGTTCGGTAGGAATATCTATCAAGTCATTAA
CAATTTGTTTGACATTTGAATTTTGGAAAATTTCTGAAATATAAAAATAA
AAGCCGTATTACCTAATTTTATACAAATGTTTATGTGATATAAGAATGGT
TAGTGGAG
back to top

protein sequence of SMED30021657-orf-1

>SMED30021657-orf-1 ID=SMED30021657-orf-1|Name=SMED30021657-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
MKPLIYVNPIRILKTSYYYPLWKRHVVYPKYNLGDPKLRIPLVPYWMKLV
YLDGHYPPELVKFKIHPQMTDHDVKEYLIKIYDVKPMTVKTKMIYNDLEP
LTTNKMITEKVLKTSLRFQCAPDPERYEKVAYIRLFPGDKFQFPNIFEEN
SPEPDYDELSKGSKPKAGNREGWFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012677Nucleotide-bd_a/b_plait_sf
IPR013025Ribosomal_L25/23
IPR012678Ribosomal_L23/L15e_core_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013025Ribosomal protein L25/L23PFAMPF00276Ribosomal_L23coord: 61..143
e-value: 7.2E-5
score: 23.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 22..175
e-value: 3.0E-26
score: 94.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 152..175
IPR012678Ribosomal protein L23/L15e core domain superfamilySUPERFAMILYSSF54189Ribosomal proteins S24e, L23 and L15ecoord: 44..140