Ras association domain family member 7a

Overview
NameRas association domain family member 7a
Smed IDSMED30021652
Length (bp)851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras association domain family member 7a (SMED30021652) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras association domain family member 7a (SMED30021652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras association domain family member 7a (SMED30021652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras association domain family member 7a (SMED30021652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021652h1SMcG0012732 dd_Smed_v4_3722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021652h1SMcG0012732 dd_Smed_v4_3722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30021652h1SMcG0012732 dd_Smed_v4_3722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021652h1SMcG0012732 dd_Smed_v4_3722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras association domain family member 7a vs. Ensembl Human
Match: RASSF8 (Ras association domain family member 8 [Source:HGNC Symbol;Acc:HGNC:13232])

HSP 1 Score: 67.781 bits (164), Expect = 8.446e-14
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Human
Match: RASSF8 (Ras association domain family member 8 [Source:HGNC Symbol;Acc:HGNC:13232])

HSP 1 Score: 67.781 bits (164), Expect = 1.116e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Human
Match: RASSF8 (Ras association domain family member 8 [Source:HGNC Symbol;Acc:HGNC:13232])

HSP 1 Score: 69.3218 bits (168), Expect = 2.042e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Human
Match: RASSF8 (Ras association domain family member 8 [Source:HGNC Symbol;Acc:HGNC:13232])

HSP 1 Score: 68.9366 bits (167), Expect = 2.069e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Human
Match: RASSF8 (Ras association domain family member 8 [Source:HGNC Symbol;Acc:HGNC:13232])

HSP 1 Score: 67.781 bits (164), Expect = 2.143e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Celegans
Match: K05B2.2 (pep chromosome:WBcel235:X:4907290:4912323:1 gene:WBGene00019403.1 transcript:K05B2.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K05B2.2)

HSP 1 Score: 56.225 bits (134), Expect = 6.172e-9
Identity = 32/85 (37.65%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSD-KNIQF-ILRRSQNSE 412
            ME+K+  +G+ R V GVT+  TC ++I  LA   S  G   +     + E  L P DRPL+ L+K+     N+ F +LR  QN E
Sbjct:    1 MELKINIDGLERSVSGVTDTTTCSQIIYALAHATSQRGRFVMVEKYRNVERRLAPTDRPLETLRKWREHAANVTFQMLRVDQNDE 85          
BLAST of Ras association domain family member 7a vs. Ensembl Fly
Match: RASSF8 (gene:FBgn0261986 transcript:FBtr0084898)

HSP 1 Score: 66.2402 bits (160), Expect = 5.829e-12
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRSQN 406
            ME+KVW EG+ R VCGVT   TC +V+  LA      G   L     + E  L P + P+ +L K+    N +QFIL+RS+N
Sbjct:    1 MELKVWVEGIQRIVCGVTVNTTCQDVVFALAHATGKVGRFTLIERWRNNERHLAPNENPMKLLLKWGEYANDVQFILQRSEN 82          
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Match: rassf8a (Ras association domain family member 8a [Source:ZFIN;Acc:ZDB-GENE-091014-4])

HSP 1 Score: 71.2478 bits (173), Expect = 1.307e-13
Identity = 40/89 (44.94%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRP---LDILKKYTSDKNIQFILRRSQNSENMY 421
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P   L+   +Y  D  +QFIL R+  S N Y
Sbjct:    1 MELKVWVDGVQRVVCGVTEATTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLVPHESPVASLNTWGQYAGD--VQFILHRTGPSLNEY 87          
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Match: rassf7b (Ras association domain family member 7b [Source:ZFIN;Acc:ZDB-GENE-030429-1])

HSP 1 Score: 62.7734 bits (151), Expect = 2.164e-12
Identity = 33/80 (41.25%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRS 400
            ME+KVW +G+ R VCG++E  +C +V++ LAQ    TG   L   + D E  L   + PL+ L K     N +QFILRR+
Sbjct:    1 MELKVWVDGIPRVVCGLSEDTSCQDVVIALAQAIGQTGRYVLIQKLRDKERQLMANECPLEALAKLGQLGNEVQFILRRT 80          
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Match: rassf8b (Ras association domain family member 8b [Source:ZFIN;Acc:ZDB-GENE-040426-1338])

HSP 1 Score: 65.0846 bits (157), Expect = 1.640e-11
Identity = 37/85 (43.53%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     + E  L P + P+  L K   Y SD  +Q +L+R+  S
Sbjct:    4 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRETERHLAPHENPVVSLNKWGQYASD--VQLVLQRTGPS 86          
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Match: rassf8b (Ras association domain family member 8b [Source:ZFIN;Acc:ZDB-GENE-040426-1338])

HSP 1 Score: 65.0846 bits (157), Expect = 1.788e-11
Identity = 37/85 (43.53%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     + E  L P + P+  L K   Y SD  +Q +L+R+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRETERHLAPHENPVVSLNKWGQYASD--VQLVLQRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Match: rassf7b (Ras association domain family member 7b [Source:ZFIN;Acc:ZDB-GENE-030429-1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.984e-11
Identity = 33/80 (41.25%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRS 400
            ME+KVW +G+ R VCG++E  +C +V++ LAQ    TG   L   + D E  L   + PL+ L K     N +QFILRR+
Sbjct:    1 MELKVWVDGIPRVVCGLSEDTSCQDVVIALAQAIGQTGRYVLIQKLRDKERQLMANECPLEALAKLGQLGNEVQFILRRT 80          
BLAST of Ras association domain family member 7a vs. Ensembl Xenopus
Match: foxc1 (forkhead box C1 [Source:Xenbase;Acc:XB-GENE-479055])

HSP 1 Score: 74.3294 bits (181), Expect = 1.693e-14
Identity = 38/85 (44.71%), Postives = 52/85 (61.18%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGV+E+ +C +V++ LAQ    TG   L   + D E  L P +RPL+ L K   Y +D  + FILRR+  S
Sbjct:    1 MELKVWVDGVQRVVCGVSEQTSCQDVVIALAQAIGQTGRYVLIQTLRDKERQLLPHERPLEFLSKSGQYAND--VHFILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Match: Rassf8 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 [Source:MGI Symbol;Acc:MGI:1918573])

HSP 1 Score: 70.0922 bits (170), Expect = 3.822e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIVSLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Match: Rassf8 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 [Source:MGI Symbol;Acc:MGI:1918573])

HSP 1 Score: 70.0922 bits (170), Expect = 3.822e-13
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIVSLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Match: Rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:MGI Symbol;Acc:MGI:1914235])

HSP 1 Score: 65.0846 bits (157), Expect = 5.805e-13
Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLD---ILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +G+ R VCGV+E+ TC EV++ LAQ    TG   L   + + E  L PQ+ P+       ++ +D  +QF+LRR+  S
Sbjct:    8 MELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQATCGQFAND--VQFVLRRTGPS 90          
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Match: Rassf8 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 [Source:MGI Symbol;Acc:MGI:1918573])

HSP 1 Score: 63.1586 bits (152), Expect = 1.291e-12
Identity = 39/81 (48.15%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRR 397
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIVSLNKWGQYASD--VQLILRR 79          
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Match: Rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:MGI Symbol;Acc:MGI:1914235])

HSP 1 Score: 65.855 bits (159), Expect = 1.947e-12
Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLD---ILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +G+ R VCGV+E+ TC EV++ LAQ    TG   L   + + E  L PQ+ P+       ++ +D  +QF+LRR+  S
Sbjct:    8 MELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQATCGQFAND--VQFVLRRTGPS 90          
BLAST of Ras association domain family member 7a vs. UniProt/SwissProt
Match: sp|Q8NHQ8|RASF8_HUMAN (Ras association domain-containing protein 8 OS=Homo sapiens OX=9606 GN=RASSF8 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.413e-12
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. UniProt/SwissProt
Match: sp|Q8CJ96|RASF8_MOUSE (Ras association domain-containing protein 8 OS=Mus musculus OX=10090 GN=Rassf8 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.674e-12
Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P+  L K   Y SD  +Q ILRR+  S
Sbjct:    1 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIVSLNKWGQYASD--VQLILRRTGPS 83          
BLAST of Ras association domain family member 7a vs. UniProt/SwissProt
Match: sp|Q02833|RASF7_HUMAN (Ras association domain-containing protein 7 OS=Homo sapiens OX=9606 GN=RASSF7 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.762e-12
Identity = 35/85 (41.18%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLD---ILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +G+ R VCGV+E+ TC EV++ LAQ    TG   L   + + E  L PQ+ P+       ++ SD  +QF+LRR+  S
Sbjct:    8 MELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQATCGQFASD--VQFVLRRTGPS 90          
BLAST of Ras association domain family member 7a vs. UniProt/SwissProt
Match: sp|Q9DD19|RASF7_MOUSE (Ras association domain-containing protein 7 OS=Mus musculus OX=10090 GN=Rassf7 PE=2 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.964e-11
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query:  158 LCMEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLD---ILKKYTSDKNIQFILRRSQNS 409
            + ME+KVW +G+ R VCGV+E+ TC EV++ LAQ    TG   L   + + E  L PQ+ P+       ++ +D  +QF+LRR+  S
Sbjct:    6 VAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQATCGQFAND--VQFVLRRTGPS 90          
BLAST of Ras association domain family member 7a vs. TrEMBL
Match: A0A267GBX4 (Ras-associating domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017348g1 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.186e-13
Identity = 60/223 (26.91%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQ----------------------------------------------NSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQIDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKEL 694
            ME+ +WFEG  R VC VT   +CH+VI+ +A+TA + G   L L   + E P+ P +     L +  + ++ + IL+R++                                               SEN+ R+LK  L  QE EIE NRL++ E+D+E+  L   QL+  S   L   +  Q+ ++  L Q    D +A+ R     L A++   D ++ ++
Sbjct:    1 MELNIWFEGQPRTVCNVTRDTSCHDVIMAVARTAGLPGRYTLVLRWPNGERPMAPNEPMAASLSR--APQHAELILQRTELTAAGQQHQQQPPQRQNNQLRPASLHTNGSGSSNCSTSSAEQLDAAASENVRRQLKQRLLMQEHEIEMNRLRIEELDKELRLL---QLSCQSAGSLEQRLHQQEAELQQLSQANLADCLAQERQLHDRLQAERRVWDKRLTDV 218          
BLAST of Ras association domain family member 7a vs. TrEMBL
Match: A0A267G9K8 (Ras-associating domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028266g2 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.350e-13
Identity = 60/223 (26.91%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQ----------------------------------------------NSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQIDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKEL 694
            ME+ +WFEG  R VC VT   +CH+VI+ +A+TA + G   L L   + E P+ P +     L +  + ++ + IL+R++                                               SEN+ R+LK  L  QE EIE NRL++ E+D+E+  L   QL+  S   L   +  Q+ ++  L Q    D +A+ R     L A++   D ++ ++
Sbjct:    1 MELNIWFEGQPRTVCNVTRDTSCHDVIMAVARTAGLPGRYTLVLRWPNGERPMAPNEPMAASLSR--APQHAELILQRTELTAAGQQHQQQPPQRQNNQLRPASLDTNGSGSSNCSTSSAEQLDAAASENVRRQLKQRLLMQEHEIEMNRLRIEELDKELRLL---QLSCQSAGSLEQRLHQQEAELQQLSQANLADCLAQERQLHDRLQAERRVWDKRLTDV 218          
BLAST of Ras association domain family member 7a vs. TrEMBL
Match: A0A212EJM4 (Ras-associating domain-containing protein OS=Danaus plexippus plexippus OX=278856 GN=KGM_212488 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 7.069e-13
Identity = 42/85 (49.41%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRSQNSEN 415
            ME+KVW EG+ R VCGVTE  TC +V+  LA      G   L     + E  L PQ+ PL IL K+    N IQFILRRS NS N
Sbjct:    1 MELKVWVEGIQRIVCGVTETTTCQDVVFALAHATGKVGRFTLIERWRNNERLLAPQEYPLKILMKWGEYSNDIQFILRRSDNSNN 85          
BLAST of Ras association domain family member 7a vs. TrEMBL
Match: S4NGZ0 (Ras-associating domain-containing protein (Fragment) OS=Pararge aegeria OX=116150 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.162e-12
Identity = 41/85 (48.24%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRSQNSEN 415
            ME+KVW EG+ R VCGVTE  TC +V+  LA      G   L     + E  L PQ+ PL IL K+    N IQFILRRS N  N
Sbjct:    1 MELKVWVEGIQRIVCGVTETTTCQDVVFALAHATGKVGRFTLIERWRNNERLLAPQEYPLKILMKWGEYSNDIQFILRRSDNGSN 85          
BLAST of Ras association domain family member 7a vs. TrEMBL
Match: A0A194PLN7 (Ras association domain-containing protein 8 OS=Papilio xuthus OX=66420 GN=RR46_06693 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.484e-12
Identity = 41/85 (48.24%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRSQNSEN 415
            ME+KVW EG+ R VCGVTE  TC +V+  LA      G   L     + E  L PQ+ PL IL K+    N IQFILRRS +S N
Sbjct:    1 MELKVWVEGIQRIVCGVTETTTCQDVVFALAHATGKVGRFTLIERWRNNERLLAPQEYPLKILMKWGEYSNDIQFILRRSDSSSN 85          
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Match: rassf8a (ras association domain-containing protein 8-like [Source:NCBI gene;Acc:103039191])

HSP 1 Score: 68.5514 bits (166), Expect = 8.754e-13
Identity = 37/85 (43.53%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRP---LDILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D+E  L P + P   L+   +Y  D  +QF L R+  S
Sbjct:    1 MELKVWVDGVQRVVCGVTEATTCQEVVIALAQAIGRTGRYTLVEKWRDSERHLAPHESPVASLNTWGQYAGD--VQFFLHRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Match: rassf8a (ras association domain-containing protein 8-like [Source:NCBI gene;Acc:103039191])

HSP 1 Score: 68.5514 bits (166), Expect = 1.103e-12
Identity = 37/85 (43.53%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRP---LDILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D+E  L P + P   L+   +Y  D  +QF L R+  S
Sbjct:    1 MELKVWVDGVQRVVCGVTEATTCQEVVIALAQAIGRTGRYTLVEKWRDSERHLAPHESPVASLNTWGQYAGD--VQFFLHRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Match: rassf8b (Ras association domain family member 8 [Source:NCBI gene;Acc:103033282])

HSP 1 Score: 64.6994 bits (156), Expect = 1.622e-11
Identity = 37/85 (43.53%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     + E  L P + P+  L K   Y SD  +Q +L+R+  S
Sbjct:    4 MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRETERYLAPHENPVVSLNKWGQYASD--VQLVLQRTGPS 86          
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Match: rassf7b (ras association domain-containing protein 8-like [Source:NCBI gene;Acc:103046283])

HSP 1 Score: 63.1586 bits (152), Expect = 6.110e-11
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTS-DKNIQFILRRSQNSENMYRKLKNHLAY 448
            ME+KVW +GV R VCG++++ +C +V++ LAQ    TG   L   + D E  L   + PL+ L K       +QFILRR+  + +    L  H ++
Sbjct:    1 MELKVWVDGVQRVVCGLSKETSCQDVVIALAQAIGQTGRYVLVQKLRDTERQLVADECPLESLSKLGQLSSEVQFILRRTGPTTSEGSDLDRHSSF 96          
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Match: rassf7b (ras association domain-containing protein 8-like [Source:NCBI gene;Acc:103046283])

HSP 1 Score: 63.1586 bits (152), Expect = 6.110e-11
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTS-DKNIQFILRRSQNSENMYRKLKNHLAY 448
            ME+KVW +GV R VCG++++ +C +V++ LAQ    TG   L   + D E  L   + PL+ L K       +QFILRR+  + +    L  H ++
Sbjct:    1 MELKVWVDGVQRVVCGLSKETSCQDVVIALAQAIGQTGRYVLVQKLRDTERQLVADECPLESLSKLGQLSSEVQFILRRTGPTTSEGSDLDRHSSF 96          
BLAST of Ras association domain family member 7a vs. Ensembl Sea Lamprey
Match: rassf8a (Ras association domain family member 8a [Source:ZFIN;Acc:ZDB-GENE-091014-4])

HSP 1 Score: 61.6178 bits (148), Expect = 4.303e-11
Identity = 33/80 (41.25%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTS-DKNIQFILRRS 400
            ME+KVW EGV R VCGVT+  TCH+V++ LAQ    TG   L     D E  L P +     L  +     ++Q +LRR+
Sbjct:    1 MELKVWVEGVPRVVCGVTDATTCHDVVIALAQALGRTGRYTLIERWRDTERHLCPGESLAAALAAWGQHSADVQLLLRRT 80          
BLAST of Ras association domain family member 7a vs. Ensembl Nematostella
Match: EDO46381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK7])

HSP 1 Score: 46.595 bits (109), Expect = 4.304e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  167 EMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTS-DKNIQFILR 394
            E++VW +G  R + GV++  TC  +++ LA+ A  TG + L     D E  L   ++P+  L+ + S  K ++F+LR
Sbjct:    3 ELRVWVDGKERIIRGVSDSTTCESILIALAKAAGKTGRVALLEKWRDLERILPRTEKPIKCLQMWGSLQKEVKFLLR 79          
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Match: ENSORLT00000043406.1 (ras association domain-containing protein 8 [Source:NCBI gene;Acc:105354308])

HSP 1 Score: 67.3958 bits (163), Expect = 2.747e-12
Identity = 35/83 (42.17%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSD-KNIQFILRRSQNS 409
            ME+KV+ +GV R VCGVT + TC EV+L LAQ     G   L     D E  + P +RPL+ L+KY    K +Q  L+ S ++
Sbjct:    1 MEVKVFVDGVPRVVCGVTRETTCQEVVLALAQAQGQPGRYILREKFKDFERCMTPDERPLETLEKYGEQAKEVQLTLQSSGST 83          
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Match: rassf8a (ras association domain-containing protein 8 [Source:NCBI gene;Acc:101155683])

HSP 1 Score: 65.855 bits (159), Expect = 7.260e-12
Identity = 36/85 (42.35%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRP---LDILKKYTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     D E  L P + P   L+   +Y  D  +Q +L R+  S
Sbjct:    1 MELKVWVDGVQRVVCGVTEATTCQEVVIALAQAIGRTGRYTLVERWRDTERHLAPNESPVASLNTWGQYAGD--VQLVLHRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Match: rassf8b (ras association domain-containing protein 8 [Source:NCBI gene;Acc:101160776])

HSP 1 Score: 65.4698 bits (158), Expect = 1.042e-11
Identity = 38/85 (44.71%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     + E  L P + P+  L K   Y SD  +Q IL+R+  S
Sbjct:    4 MELKVWVDGVQRIVCGVTEFTTCQEVVIALAQAIGRTGRYTLIEKWRETERHLAPHENPVVSLNKWGQYASD--VQLILQRTGPS 86          
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Match: rassf7a (ras association domain-containing protein 8 [Source:NCBI gene;Acc:101164772])

HSP 1 Score: 65.0846 bits (157), Expect = 1.515e-11
Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKN-IQFILRRSQNS 409
            ME+KVW +G +R VCG++E+ +C +V++ LAQ    TG   L   + D E  L   +RPL+ L K       +QF LRR+  S
Sbjct:    1 MELKVWVDGAVRVVCGLSEETSCQDVVIALAQAIGQTGRYVLIQRLRDTERQLLATERPLESLAKLGQHGGEVQFFLRRTGPS 83          
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Match: rassf8b (ras association domain-containing protein 8 [Source:NCBI gene;Acc:101160776])

HSP 1 Score: 64.6994 bits (156), Expect = 1.532e-11
Identity = 38/85 (44.71%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKK---YTSDKNIQFILRRSQNS 409
            ME+KVW +GV R VCGVTE  TC EV++ LAQ    TG   L     + E  L P + P+  L K   Y SD  +Q IL+R+  S
Sbjct:    4 MELKVWVDGVQRIVCGVTEFTTCQEVVIALAQAIGRTGRYTLIEKWRETERHLAPHENPVVSLNKWGQYASD--VQLILQRTGPS 86          
BLAST of Ras association domain family member 7a vs. Planmine SMEST
Match: SMESG000080298.1 (SMESG000080298.1)

HSP 1 Score: 435.261 bits (1118), Expect = 1.503e-156
Identity = 211/212 (99.53%), Postives = 211/212 (99.53%), Query Frame = 2
Query:  164 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQIDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF 799
            MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQ DLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF
Sbjct:    1 MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQTDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF 212          
BLAST of Ras association domain family member 7a vs. Planmine SMEST
Match: SMESG000080298.1 (SMESG000080298.1)

HSP 1 Score: 431.024 bits (1107), Expect = 5.753e-155
Identity = 209/210 (99.52%), Postives = 209/210 (99.52%), Query Frame = 2
Query:  170 MKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQIDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF 799
            MKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQ DLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF
Sbjct:    1 MKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAEVPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEIENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQTDLLEQVQWIDVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPDSSQGRAPYGVWF 210          
The following BLAST results are available for this feature:
BLAST of Ras association domain family member 7a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASSF88.446e-1447.06Ras association domain family member 8 [Source:HGN... [more]
RASSF81.116e-1347.06Ras association domain family member 8 [Source:HGN... [more]
RASSF82.042e-1347.06Ras association domain family member 8 [Source:HGN... [more]
RASSF82.069e-1347.06Ras association domain family member 8 [Source:HGN... [more]
RASSF82.143e-1347.06Ras association domain family member 8 [Source:HGN... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K05B2.26.172e-937.65pep chromosome:WBcel235:X:4907290:4912323:1 gene:W... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RASSF85.829e-1241.46gene:FBgn0261986 transcript:FBtr0084898[more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf8a1.307e-1344.94Ras association domain family member 8a [Source:ZF... [more]
rassf7b2.164e-1241.25Ras association domain family member 7b [Source:ZF... [more]
rassf8b1.640e-1143.53Ras association domain family member 8b [Source:ZF... [more]
rassf8b1.788e-1143.53Ras association domain family member 8b [Source:ZF... [more]
rassf7b2.984e-1141.25Ras association domain family member 7b [Source:ZF... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
foxc11.693e-1444.71forkhead box C1 [Source:Xenbase;Acc:XB-GENE-479055... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rassf83.822e-1347.06Ras association (RalGDS/AF-6) domain family (N-ter... [more]
Rassf83.822e-1347.06Ras association (RalGDS/AF-6) domain family (N-ter... [more]
Rassf75.805e-1340.00Ras association (RalGDS/AF-6) domain family (N-ter... [more]
Rassf81.291e-1248.15Ras association (RalGDS/AF-6) domain family (N-ter... [more]
Rassf71.947e-1240.00Ras association (RalGDS/AF-6) domain family (N-ter... [more]
back to top
BLAST of Ras association domain family member 7a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8NHQ8|RASF8_HUMAN2.413e-1247.06Ras association domain-containing protein 8 OS=Hom... [more]
sp|Q8CJ96|RASF8_MOUSE2.674e-1247.06Ras association domain-containing protein 8 OS=Mus... [more]
sp|Q02833|RASF7_HUMAN4.762e-1241.18Ras association domain-containing protein 7 OS=Hom... [more]
sp|Q9DD19|RASF7_MOUSE2.964e-1139.08Ras association domain-containing protein 7 OS=Mus... [more]
back to top
BLAST of Ras association domain family member 7a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GBX43.186e-1326.91Ras-associating domain-containing protein OS=Macro... [more]
A0A267G9K83.350e-1326.91Ras-associating domain-containing protein OS=Macro... [more]
A0A212EJM47.069e-1349.41Ras-associating domain-containing protein OS=Danau... [more]
S4NGZ01.162e-1248.24Ras-associating domain-containing protein (Fragmen... [more]
A0A194PLN75.484e-1248.24Ras association domain-containing protein 8 OS=Pap... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf8a8.754e-1343.53ras association domain-containing protein 8-like [... [more]
rassf8a1.103e-1243.53ras association domain-containing protein 8-like [... [more]
rassf8b1.622e-1143.53Ras association domain family member 8 [Source:NCB... [more]
rassf7b6.110e-1135.42ras association domain-containing protein 8-like [... [more]
rassf7b6.110e-1135.42ras association domain-containing protein 8-like [... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rassf8a4.303e-1141.25Ras association domain family member 8a [Source:ZF... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO463814.304e-732.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras association domain family member 7a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043406.12.747e-1242.17ras association domain-containing protein 8 [Sourc... [more]
rassf8a7.260e-1242.35ras association domain-containing protein 8 [Sourc... [more]
rassf8b1.042e-1144.71ras association domain-containing protein 8 [Sourc... [more]
rassf7a1.515e-1139.76ras association domain-containing protein 8 [Sourc... [more]
rassf8b1.532e-1144.71ras association domain-containing protein 8 [Sourc... [more]
back to top
BLAST of Ras association domain family member 7a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000080298.11.503e-15699.53SMESG000080298.1[more]
SMESG000080298.15.753e-15599.52SMESG000080298.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021652 ID=SMED30021652|Name=Ras association domain family member 7a|organism=Schmidtea mediterranea sexual|type=transcript|length=851bp
CACAAATTATATATTTAAAAACAAATTCTATTAAACTATTTAACTATTAT
TATCTGGAACTTAATATTTGACAGTTATTATTAGTAGTAAAGATCATTAA
ATTTAAAATTTTTATTCAATGAATATTTTATACGCTATCTAATAAATTAT
TATTATCCTTTGTATGGAAATGAAAGTTTGGTTTGAAGGAGTTTTAAGAG
ATGTTTGCGGTGTAACTGAAAAAAACACATGCCATGAAGTTATTTTAGTT
TTAGCGCAAACTGCAAGTATTACTGGCTCACTTTTCCTATCTTTAATTGT
AGATGATGCTGAAGTTCCTCTGCATCCTCAAGATCGCCCATTAGATATAT
TAAAAAAGTACACGTCAGACAAAAATATTCAATTTATTCTAAGAAGGTCA
CAGAACAGTGAAAATATGTACAGAAAATTAAAGAATCATTTGGCATATCA
AGAACAAGAAATTGAAAATAATCGCCTGAAACTTTCGGAAATGGATCAAG
AAATAATGGAGCTTCAAAAGTCTCAATTAACGAATCTCAGTGAAGAAGAA
CTGATGGGGATCATCAAAGATCAAAAAGAACAAATCGATTTATTGGAACA
AGTGCAATGGATCGATGTGGTAGCGGAATACCGGTCAAAATGCCGATCAC
TCGCTGCCGACAAGACGAGTCTCGATGGTAAAATCAAAGAGTTGGAGTCG
GCAATACAGGCGGCAAGAACTGCCCATGTAGAATTGAAGAAACAATTATC
AAGAAAACCCGATTCATCTCAGGGCCGTGCACCGTATGGCGTGTGGTTTT
AGTGTAGATAAATCTATGTGTGTATTATGGATATGCTCTGTCATTTTTAC
T
back to top

protein sequence of SMED30021652-orf-1

>SMED30021652-orf-1 ID=SMED30021652-orf-1|Name=SMED30021652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MEMKVWFEGVLRDVCGVTEKNTCHEVILVLAQTASITGSLFLSLIVDDAE
VPLHPQDRPLDILKKYTSDKNIQFILRRSQNSENMYRKLKNHLAYQEQEI
ENNRLKLSEMDQEIMELQKSQLTNLSEEELMGIIKDQKEQIDLLEQVQWI
DVVAEYRSKCRSLAADKTSLDGKIKELESAIQAARTAHVELKKQLSRKPD
SSQGRAPYGVWF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0070507regulation of microtubule cytoskeleton organization
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR033593N-RASSF
IPR000159RA_dom
IPR029071Ubiquitin-like_domsf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 167..194
NoneNo IPR availableCOILSCoilCoilcoord: 93..120
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..87
e-value: 7.4E-19
score: 69.3
NoneNo IPR availablePANTHERPTHR15286:SF6GH01133Pcoord: 1..88
NoneNo IPR availableCDDcd16134RA_RASSF8coord: 2..82
e-value: 1.66691E-20
score: 79.7876
IPR033593N-terminal RASSF familyPANTHERPTHR15286RAS-ASSOCIATING DOMAIN CONTAINING PROTEINcoord: 1..88
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 1..81
score: 9.405
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 1..81