Exosome complex component RRP45

Overview
NameExosome complex component RRP45
Smed IDSMED30021651
Length (bp)1143
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exosome complex component RRP45 (SMED30021651) t-SNE clustered cells

Violin plots show distribution of expression levels for Exosome complex component RRP45 (SMED30021651) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exosome complex component RRP45 (SMED30021651) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exosome complex component RRP45 (SMED30021651) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021651h1SMcG0004482 SmedASXL_010774SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Match: EXOSC9 (exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9137])

HSP 1 Score: 125.946 bits (315), Expect = 2.575e-33
Identity = 71/234 (30.34%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSEL 775
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++   +++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      GSE+
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGSEM 241          
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Match: EXOSC9 (exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9137])

HSP 1 Score: 122.094 bits (305), Expect = 1.775e-30
Identity = 77/261 (29.50%), Postives = 144/261 (55.17%), Query Frame = 2
Query:   98 QRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            QRLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++   +++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G  +        RC ++   KV  +  LI + ++  Q
Sbjct:    6 QRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQV-LRCSKIAGVKVAEITELILKALENDQ 257          
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Match: EXOSC9 (exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9137])

HSP 1 Score: 122.479 bits (306), Expect = 2.263e-30
Identity = 76/267 (28.46%), Postives = 148/267 (55.43%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++   +++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G  +        RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQV-LRCSKIAGVKVAEITELILKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Match: EXOSC9 (exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9137])

HSP 1 Score: 122.094 bits (305), Expect = 2.437e-30
Identity = 76/267 (28.46%), Postives = 148/267 (55.43%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++   +++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G  +        RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQV-LRCSKIAGVKVAEITELILKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Match: EXOSC8 (exosome component 8 [Source:HGNC Symbol;Acc:HGNC:17035])

HSP 1 Score: 88.5817 bits (218), Expect = 2.509e-19
Identity = 69/278 (24.82%), Postives = 125/278 (44.96%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            FK ++     R+ LK++ R DGR + E+R  ++ +  IS    A  + L+ LG T V+C +  +   P  + P +G +  +V+   + ++  +     E+A      I   +  ++ +  + LCI  G+ V+ +  ++     DGN+LD    + L  LK  + P+VTI E   +    NLK K    L I+T P   +  V  +   LI+D    EE      + + +    +L C H  G    T     + C     ++   +  L+ +VIK+ +
Sbjct:    5 FKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIST---ADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETAL-AEVNLKKKS--YLNIRTHPVATSFAVF-DDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQD-CMSRAVTRHKEVKKLMDEVIKSMK 274          
BLAST of Exosome complex component RRP45 vs. Ensembl Celegans
Match: exos-9 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:Q8MNS7])

HSP 1 Score: 125.946 bits (315), Expect = 3.227e-32
Identity = 78/270 (28.89%), Postives = 146/270 (54.07%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            +I + LK  +R D R++ E+R++ + +           T + ++G T+V+  +S ++ EP +  P +G+I +DV+ S + N +N+      K ++L  ++E  +  ++ +D+++LCI AG+ ++ I ++++   +DG+LLD   L+A+  L+ F+RP+VT+     +   E   +K PVPL I  MP   TIG+L +   +++D    E   LD  IVV      ++   H   + L  +     RC +L  ++  AL  ++S VIK  Q
Sbjct:   13 VILEALKIGKRFDFRSLEEFRDVKLVV------GAEVGTAICTIGNTKVMAAVSAEIAEPSSMRPHKGVINIDVDLSPMANYANEHDRLGSKGMELIRLLELIIRDSRCIDVEALCIRAGKEIWKIRVDVRILDEDGSLLDCACLAAITALQHFRRPNVTLEPHHTLIYSEY--EKAPVPLNIYHMPICTTIGLLDKGQIVVIDPTDKETACLDGSIVVACNKRREVCALHQ-STNLILSTKQIERCVKLAMARAEALTAVVSDVIKQDQ 273          
BLAST of Exosome complex component RRP45 vs. Ensembl Celegans
Match: exos-9 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:Q8MNS7])

HSP 1 Score: 125.946 bits (315), Expect = 3.227e-32
Identity = 78/270 (28.89%), Postives = 146/270 (54.07%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            +I + LK  +R D R++ E+R++ + +           T + ++G T+V+  +S ++ EP +  P +G+I +DV+ S + N +N+      K ++L  ++E  +  ++ +D+++LCI AG+ ++ I ++++   +DG+LLD   L+A+  L+ F+RP+VT+     +   E   +K PVPL I  MP   TIG+L +   +++D    E   LD  IVV      ++   H   + L  +     RC +L  ++  AL  ++S VIK  Q
Sbjct:   13 VILEALKIGKRFDFRSLEEFRDVKLVV------GAEVGTAICTIGNTKVMAAVSAEIAEPSSMRPHKGVINIDVDLSPMANYANEHDRLGSKGMELIRLLELIIRDSRCIDVEALCIRAGKEIWKIRVDVRILDEDGSLLDCACLAAITALQHFRRPNVTLEPHHTLIYSEY--EKAPVPLNIYHMPICTTIGLLDKGQIVVIDPTDKETACLDGSIVVACNKRREVCALHQ-STNLILSTKQIERCVKLAMARAEALTAVVSDVIKQDQ 273          
BLAST of Exosome complex component RRP45 vs. Ensembl Fly
Match: Rrp45 (gene:FBgn0030789 transcript:FBtr0344090)

HSP 1 Score: 108.227 bits (269), Expect = 6.849e-26
Identity = 77/269 (28.62%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   68 NMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKA 868
            + ++  +K +QRLDGR  +E R++ +   K         +  +S+G T+VL +++C++  P  + P+ G I L+V    +           +++LKL  ++E+    ++++DL+SLC+   + V+CI + +     DGNL D   ++ L  L  F+RPDV   + G + + +  K+++ +PL     P  VT  V   S Q ILD   LEE+  DS IV+      +L C    G    TN     +C    ++  V    L++ V KA
Sbjct:   18 SFVQLAVKQNQRLDGRRSNESRDVELTFGK------DWGSVAVSMGDTKVLAQVTCEMGPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCVAVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDVWY-KDGELRIFKK-KEREFIPLLFHHYPVSVTYCVYKSSVQPILDPTLLEENAADSVIVLSFNSFQEL-CSLTAGGTAPTNARIIMQC---ARNAAVRCKSLLNFVRKA 274          
BLAST of Exosome complex component RRP45 vs. Ensembl Fly
Match: Rrp45 (gene:FBgn0030789 transcript:FBtr0074355)

HSP 1 Score: 108.227 bits (269), Expect = 6.849e-26
Identity = 77/269 (28.62%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   68 NMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKA 868
            + ++  +K +QRLDGR  +E R++ +   K         +  +S+G T+VL +++C++  P  + P+ G I L+V    +           +++LKL  ++E+    ++++DL+SLC+   + V+CI + +     DGNL D   ++ L  L  F+RPDV   + G + + +  K+++ +PL     P  VT  V   S Q ILD   LEE+  DS IV+      +L C    G    TN     +C    ++  V    L++ V KA
Sbjct:   18 SFVQLAVKQNQRLDGRRSNESRDVELTFGK------DWGSVAVSMGDTKVLAQVTCEMGPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCVAVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDVWY-KDGELRIFKK-KEREFIPLLFHHYPVSVTYCVYKSSVQPILDPTLLEENAADSVIVLSFNSFQEL-CSLTAGGTAPTNARIIMQC---ARNAAVRCKSLLNFVRKA 274          
BLAST of Exosome complex component RRP45 vs. Ensembl Zebrafish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:450057])

HSP 1 Score: 126.716 bits (317), Expect = 1.826e-32
Identity = 77/264 (29.17%), Postives = 146/264 (55.30%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIK 865
            K +K+ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK + P+ G++  ++  S + + + +    +E  + L   +E+CL  +K +D +SLC+ +GE+V+ I +++     DGNL+D   ++A+  L  F+RPDV I +  ++TV    +++DP+PL I  MP  V+    ++ + L++D  + EE   D  +V+ +    ++      G  +        RC ++   KV  +  LI++ ++
Sbjct:   16 KAIKEKKRLDGRQTYDYRNIKISF------GTDYGCCVVELGKTRVLSQVSCELVPPKDSRPTEGIVFFNLELSPMASPAFEPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDVAI-QGRDVTVF-GPEERDPIPLSIYHMPICVSFAFFLQGSFLLVDPCEREERVKDGLLVIAMNKHREICSIQSSGGIMLLKEQV-LRCSKIASVKVSEITELINKALE 270          
BLAST of Exosome complex component RRP45 vs. Ensembl Zebrafish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:450057])

HSP 1 Score: 87.0409 bits (214), Expect = 2.949e-19
Identity = 67/264 (25.38%), Postives = 122/264 (46.21%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIK 865
            K +K+ +RLDGR  ++YRNI I           +  C++ LGKT+                                         +E  + L   +E+CL  +K +D +SLC+ +GE+V+ I +++     DGNL+D   ++A+  L  F+RPDV I +  ++TV    +++DP+PL I  MP  V+    ++ + L++D  + EE   D  +V+ +    ++      G  +        RC ++   KV  +  LI++ ++
Sbjct:   16 KAIKEKKRLDGRQTYDYRNIKISF------GTDYGCCVVELGKTR----------------------------------------QSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDVAI-QGRDVTVF-GPEERDPIPLSIYHMPICVSFAFFLQGSFLLVDPCEREERVKDGLLVIAMNKHREICSIQSSGGIMLLKEQV-LRCSKIASVKVSEITELINKALE 230          
BLAST of Exosome complex component RRP45 vs. Ensembl Zebrafish
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 74.7146 bits (182), Expect = 1.064e-14
Identity = 60/232 (25.86%), Postives = 108/232 (46.55%), Query Frame = 2
Query:   86 LKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDK--DPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGS 769
            ++D  RLDGR   +YR++ I    +S  +    +  +SLG T VL  I  ++ +P+   P  G ++  V+ S       + R   E  ++L   + K  N   ++DL SLCIC GE  + + +++     DGNL D I ++    L   + P V I E         L D   D + L ++ +P  VT+  +   ++ ++D    E+    + +++ +T T  + C   +G 
Sbjct:   18 VRDDLRLDGRGCEDYRHMEIETDVVSNTD---GSAKISLGHTDVLVGIKAEIGKPRPMVPDEGYLEFFVDCSANATPEFEGRGGEELGVELSNTLLKVFNNRHSLDLRSLCICPGENCWVLYVDVLLLQCDGNLFDAISIAIKAALFNTRIPKVHISEDEEGGKEIELSDDPFDCMRLNVENVPCIVTLCKI--GHRHVVDATLQEKACSVASLLIAVTHTGMVTCVRKMGG 244          
BLAST of Exosome complex component RRP45 vs. Ensembl Zebrafish
Match: exosc8 (exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1736])

HSP 1 Score: 65.855 bits (159), Expect = 1.069e-11
Identity = 60/247 (24.29%), Postives = 114/247 (46.15%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCW--HPLGSEL 775
            FK  +     R  LK++ R DGR + E+R  ++ +  IS    A  + L+ +G T V+C I  ++  P +   ++G +  +V+   + ++  +     E+A      I   +  +  ++L+ LCI   +  + +  +I     DGNLLD  +   L  LKT + P+VTI +  ++   +  K +    L+I   P   +  V  +S  +I+     EE++L + ++  +T      C    P G+ L
Sbjct:    5 FKTAEPLEYHRSFLKENCRPDGRELGEFRPTTLNINSIST---ADGSALVKIGNTTVICGIKAELAVPPSEAQNKGYLVPNVDLPPLCSSRFRAGPPGEQAQAASQFIADVIESSDLINLEELCIEKAKLCWVLYCDIMCLDYDGNLLDACITVLLAALKTAQLPEVTINKETDLAEVDIEKKRR---LKINRHPVGSSFAVFDDS--IIIVDPTAEEESLSTALMTVVTDEEDRLCAVHKPGGTSL 243          
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 130.568 bits (327), Expect = 1.337e-33
Identity = 71/218 (32.57%), Postives = 132/218 (60.55%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            + + + +RLDGR  ++YRNI I           +  C++ LGKT+VLC++S ++V PK N P+ G++  D+  S +     ++   +E ++KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     +GN++D   ++A+ GL  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +
Sbjct:   16 QAIAERKRLDGRQTYDYRNIKITF------GTDYGCCIVELGKTRVLCQVSSEIVTPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIIDAASIAAIAGLCHFRRPDVSV-QGEEVTVY-TPEERDPVPLSIHHMPICVSFAFFQQGIYLLVDPSEREEWVMDGLLVISM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 129.798 bits (325), Expect = 2.219e-33
Identity = 71/218 (32.57%), Postives = 132/218 (60.55%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            + + + +RLDGR  ++YRNI I           +  C++ LGKT+VLC++S ++V PK N P+ G++  D+  S +     ++   +E ++KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     +GN++D   ++A+ GL  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +
Sbjct:   16 QAIAERKRLDGRQTYDYRNIKITF------GTDYGCCIVELGKTRVLCQVSSEIVTPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIIDAASIAAIAGLCHFRRPDVSV-QGEEVTVY-TPEERDPVPLSIHHMPICVSFAFFQQGIYLLVDPSEREEWVMDGLLVISM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 129.413 bits (324), Expect = 3.280e-33
Identity = 81/275 (29.45%), Postives = 152/275 (55.27%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI----KARQSSNE 886
            + + + +RLDGR  ++YRNI I           +  C++ LGKT+VLC++S ++V PK N P+ G++  D+  S +     ++   +E ++KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     +GN++D   ++A+ GL  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +    ++      G  +        RC ++   KV  +  LI + +    KAR+   +
Sbjct:   16 QAIAERKRLDGRQTYDYRNIKITF------GTDYGCCIVELGKTRVLCQVSSEIVTPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIIDAASIAAIAGLCHFRRPDVSV-QGEEVTVY-TPEERDPVPLSIHHMPICVSFAFFQQGIYLLVDPSEREEWVMDGLLVISMNKHREICTIQSSGGIMLLKEQV-LRCSKVAGVKVGEITELIQKALENDKKARKEGGK 281          
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 129.798 bits (325), Expect = 3.311e-33
Identity = 71/218 (32.57%), Postives = 132/218 (60.55%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            + + + +RLDGR  ++YRNI I           +  C++ LGKT+VLC++S ++V PK N P+ G++  D+  S +     ++   +E ++KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     +GN++D   ++A+ GL  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +
Sbjct:   16 QAIAERKRLDGRQTYDYRNIKITF------GTDYGCCIVELGKTRVLCQVSSEIVTPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIIDAASIAAIAGLCHFRRPDVSV-QGEEVTVY-TPEERDPVPLSIHHMPICVSFAFFQQGIYLLVDPSEREEWVMDGLLVISM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 129.028 bits (323), Expect = 4.523e-33
Identity = 71/218 (32.57%), Postives = 132/218 (60.55%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            + + + +RLDGR  ++YRNI I           +  C++ LGKT+VLC++S ++V PK N P+ G++  D+  S +     ++   +E ++KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     +GN++D   ++A+ GL  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +
Sbjct:   16 QAIAERKRLDGRQTYDYRNIKITF------GTDYGCCIVELGKTRVLCQVSSEIVTPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIIDAASIAAIAGLCHFRRPDVSV-QGEEVTVY-TPEERDPVPLSIHHMPICVSFAFFQQGIYLLVDPSEREEWVMDGLLVISM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Match: Exosc9 (exosome component 9 [Source:MGI Symbol;Acc:MGI:1355319])

HSP 1 Score: 122.479 bits (306), Expect = 3.522e-32
Identity = 70/219 (31.96%), Postives = 129/219 (58.90%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ GE   +   E   ++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGEEVTLYTPE---ERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Match: Exosc9 (exosome component 9 [Source:MGI Symbol;Acc:MGI:1355319])

HSP 1 Score: 125.176 bits (313), Expect = 1.523e-31
Identity = 80/269 (29.74%), Postives = 148/269 (55.02%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGS-ELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ GE   +   E   ++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G   L  +  F  RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGEEVTLYTPE---ERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVF--RCSKIAGVKVAEITELIQKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Match: Exosc8 (exosome component 8 [Source:MGI Symbol;Acc:MGI:1916889])

HSP 1 Score: 85.5001 bits (210), Expect = 2.099e-18
Identity = 68/278 (24.46%), Postives = 124/278 (44.60%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            FK ++     R+ LK++ R DGR + E+R  ++ +  IS    A  + L+ LG T V+C +  +   P  + P RG +  +V+   + ++  +     E+A      I   ++  + +  + LCI  G+  + +  ++     DGN+LD    + L  LK  + P+VTI E   +    NLK K    L ++T P   +  V  +   LI+D    EE      + V      +L C H  G    T     + C     ++   ++ L+ +VI++ +
Sbjct:    5 FKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSIST---ADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETAL-AEVNLKKKS--YLNVRTNPVATSFAVF-DDTLLIVDPTGEEEHLSTGTLTVVTDEDGKLCCLHKPGGSGLTGAKLQD-CMSRAVTRHKEVSKLLDEVIQSMR 274          
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Match: Exosc9 (exosome component 9 [Source:MGI Symbol;Acc:MGI:1355319])

HSP 1 Score: 76.6406 bits (187), Expect = 2.405e-16
Identity = 45/129 (34.88%), Postives = 79/129 (61.24%), Query Frame = 2
Query:  350 LKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ GE   +   E   ++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +
Sbjct:   16 VKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGEEVTLYTPE---ERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAM 141          
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Match: Exosc8 (exosome component 8 [Source:MGI Symbol;Acc:MGI:1916889])

HSP 1 Score: 53.9138 bits (128), Expect = 1.271e-8
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLI 280
            FK ++     R+ LK++ R DGR + E+R  ++ +  IS    A  + L+ LG T V+C +  +   P  + P RG +
Sbjct:    5 FKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSIST---ADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYV 79          
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Match: sp|Q5XJQ5|EXOS9_DANRE (Exosome complex component RRP45 OS=Danio rerio OX=7955 GN=exosc9 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.378e-31
Identity = 77/264 (29.17%), Postives = 146/264 (55.30%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIK 865
            K +K+ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK + P+ G++  ++  S + + + +    +E  + L   +E+CL  +K +D +SLC+ +GE+V+ I +++     DGNL+D   ++A+  L  F+RPDV I +  ++TV    +++DP+PL I  MP  V+    ++ + L++D  + EE   D  +V+ +    ++      G  +        RC ++   KV  +  LI++ ++
Sbjct:   16 KAIKEKKRLDGRQTYDYRNIKISF------GTDYGCCVVELGKTRVLSQVSCELVPPKDSRPTEGIVFFNLELSPMASPAFEPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDVAI-QGRDVTVF-GPEERDPIPLSIYHMPICVSFAFFLQGSFLLVDPCEREERVKDGLLVIAMNKHREICSIQSSGGIMLLKEQV-LRCSKIASVKVSEITELINKALE 270          
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Match: sp|Q3SWZ4|EXOS9_BOVIN (Exosome complex component RRP45 OS=Bos taurus OX=9913 GN=EXOSC9 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.066e-31
Identity = 77/267 (28.84%), Postives = 150/267 (56.18%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++  L+++DPVPL I  MP  V+     +   L++D ++ EE  +D  +V+ +    ++      G  +        RC ++   KVV +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIKISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TLEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPSEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQV-LRCSKIAGVKVVEITELIQKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Match: sp|Q9JHI7|EXOS9_MOUSE (Exosome complex component RRP45 OS=Mus musculus OX=10090 GN=Exosc9 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.066e-30
Identity = 80/269 (29.74%), Postives = 148/269 (55.02%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGS-ELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ GE   +   E   ++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G   L  +  F  RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGEEVTLYTPE---ERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVF--RCSKIAGVKVAEITELIQKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Match: sp|Q4QR75|EXOS9_RAT (Exosome complex component RRP45 OS=Rattus norvegicus OX=10116 GN=Exosc9 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.916e-30
Identity = 80/269 (29.74%), Postives = 148/269 (55.02%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGS-ELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ GE   +   E   ++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G   L  +  F  RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGEEVTLYTPE---ERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVF--RCSKIAGVKVAEITELIQKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Match: sp|Q06265|EXOS9_HUMAN (Exosome complex component RRP45 OS=Homo sapiens OX=9606 GN=EXOSC9 PE=1 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 1.170e-29
Identity = 76/267 (28.46%), Postives = 148/267 (55.43%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQ 874
            + +++ +RLDGR  ++YRNI I           +  C++ LGKT+VL ++SC++V PK N  + G++  ++  S +   + +    ++  +KL  ++E+CL  +K +D +SLC+ AGE+V+ I +++     DGN++D   ++A++ L  F+RPDV++ +   +T++   +++DPVPL I  MP  V+     +   L++D N+ EE  +D  +V+ +    ++      G  +        RC ++   KV  +  LI + ++  Q
Sbjct:   16 RAIEEKKRLDGRQTYDYRNIRISF------GTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSV-QGDEVTLY-TPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQV-LRCSKIAGVKVAEITELILKALENDQ 273          
BLAST of Exosome complex component RRP45 vs. TrEMBL
Match: A0A3P7LAR7 (Uncharacterized protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9645 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.910e-42
Identity = 99/319 (31.03%), Postives = 167/319 (52.35%), Query Frame = 2
Query:   83 LLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNN--SNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTL-DSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI----------------------KARQSSNET-IIINSASYVPSHPVFVDENLEDNE 961
            +L    RLDGR + EYR I+   P    +      C++ +G T VL KIS +VVEPK   P++G++ ++ + + +  N    K R   ++  +L  +++ C    VDLD+LCI A ERVF I ++++A   DGNL D   L+A++ L +F+RPDV +G+ G + V    K + PVPL ++ +P  VT+G+  ++  ++ D  K EE  L   +++V LT   +L C H  G          +RC  L  S+  +L  L+++V+                      +A+Q ++E  ++++SAS++P         LE+ E
Sbjct:   14 MLLSGVRLDGRTLKEYREITFHFPHGHANG---GCCIVKIGSTAVLAKISVEVVEPKHYRPAQGMLFVNFDATILSANDVKRKGRSRDDEGRRLSAVLQTCFRDCVDLDALCIVAWERVFAIRVDLRALASDGNLGDCGALAAVVALASFRRPDVYVGDEGRVIVDTQCKHRPPVPLFLRRIPVLVTLGLASDTKIILQDPTKREEAILTGGRVMVGLTAHGELCCLHTSGLSTPIRPDSLSRCILLANSRARSLVTLVNRVLDGLERQRQARQAAFSARQADVERAKQMADEAPLVLSSASFLPGGENAPVGGLEEGE 329          
BLAST of Exosome complex component RRP45 vs. TrEMBL
Match: H2KTE0 (Exosome complex component RRP45 OS=Clonorchis sinensis OX=79923 GN=CLF_102525 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 9.359e-42
Identity = 91/298 (30.54%), Postives = 168/298 (56.38%), Query Frame = 2
Query:   29 YLIKIYFKFIQIFNM---------IRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTL-DSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQSSNETI 892
            Y I    +F+  FN+         +  +L D  RLDGR++HEYR IS R P+ + D+  +S C++++G T V+ ++S +V+EPK + PS+G++ ++ + + I  N+   R   E+  +L  +++  L  +VDLDSLCI A ERVF I +E++A   DGNL D   L+A+  L  F+RPDV + ++G +TV    K +  V L ++ +P  VT G+  ++  ++ D    E+  L   ++++ +T  +++ C +  G       +  ++C  +  S+  +L  L+++V+   +  +E +
Sbjct:   16 YFISHTSRFVHRFNLEMANAEILTLTDMLVDGYRLDGRSLHEYREISFRFPRSAEDD-HNSCCIVNIGATSVVARVSAEVLEPKPSRPSQGMLFVNFDVTLIHPNAAS-RHKIEEGRRLSSVLQTLLRDSVDLDSLCIVAWERVFAIRVELRALSYDGNLGDCGALAAISALAAFRRPDVFVQDNGTVTVDTEAKYRPRVALGLRRIPVLVTFGMTADATVIVQDATAREDAILTGGRVMIGVTSFSEVCCLYTTGLTKPLRSTSLSKCVRMADSRARSLVALVNRVLDGLKRQHEAM 311          
BLAST of Exosome complex component RRP45 vs. TrEMBL
Match: A0A1S8WYF4 (3' exoribonuclease family, domain 1 OS=Opisthorchis viverrini OX=6198 GN=X801_04703 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 7.601e-41
Identity = 87/271 (32.10%), Postives = 159/271 (58.67%), Query Frame = 2
Query:   83 LLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTL-DSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQSSNETI 892
            +L D  RLDGR++HEYR IS R P+ + D+  +S C++++G T V+ ++S +V+EPK + PS+G++ ++ + + I  N+   R   E+  +L  +++  L  +VDLDSLCI A ERVF I +E++A   DGNL D   L+A+  L  F+RPDV + ++G +TV    K +  V L ++ +P  VT G+  ++  ++ D    E+  L   ++++ +T  +++ C +  G       +  ++C  +  S+  +L  L+++V+   +  +E I
Sbjct:   12 MLLDGYRLDGRSLHEYREISFRFPRSAEDD-HNSCCIVNIGATSVVARVSAEVLEPKPSRPSQGMLFVNFDATLIHPNAPS-RQKIEEGRRLSSVLQTLLRDSVDLDSLCIVAWERVFAIRVELRALSYDGNLGDCGALAAISALAAFRRPDVFVQDNGTVTVDTEAKYRPRVALGLRRIPVLVTFGMTADATVIVQDATAREDAILTGGRVMIGVTSFSEVCCLYTTGLTKPLRSTSLSKCVRMADSRARSLVALVNRVLDGLRRQHEAI 280          
BLAST of Exosome complex component RRP45 vs. TrEMBL
Match: A0A183T627 (RNase_PH domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11925 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.382e-40
Identity = 94/300 (31.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  101 RLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNS--NKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTL-DSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI-------KARQSSNET----------------IIINSASYVPS 922
            RLDGR + EYR I+   P    +      C++ +G T VL K+S +VVEPK   P++G++ ++ + + +  N    K R   ++  +L  +++ C    VDLD+LCI A ERVF I ++++A   DGNL D   L+A++ L +F+RPDV +G+ G + V    K + PVPL ++ +P  VT+G+  ++  ++ D  K EE  L   +++V LT   +L C H  G          +RC  L  S+  +L  L+ +V+       +ARQ+++                  ++++SAS++P 
Sbjct:   20 RLDGRTLKEYREITFHFPHGHANG---GCCIVKIGSTAVLAKVSVEVVEPKHYRPAQGMLFVNFDATILSANEVKRKGRSRDDEGRRLSAVLQTCFRDCVDLDALCIVAWERVFAIRVDLRALASDGNLGDCGALAAVVALASFRRPDVYVGDEGRVIVDTQCKHRPPVPLFLRRIPVLVTLGLASDTKIILQDPTKREEAILTGGRVMVGLTSHGELCCLHTSGLSTPIRPESLSRCILLANSRARSLVTLVHRVLDGLERQRQARQAASSARQADVERAKQMEEDAPLVLSSASFLPG 316          
BLAST of Exosome complex component RRP45 vs. TrEMBL
Match: A0A0X3PNT3 (RNase_PH domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR167580 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.470e-40
Identity = 94/300 (31.33%), Postives = 160/300 (53.33%), Query Frame = 2
Query:  101 RLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNS--NKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTL-DSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI-------KARQSSNET----------------IIINSASYVPS 922
            RLDGR + EYR I+   P    +      C++ +G T VL K+S +VVEPK   P++G++ ++ + + +  N    K R   ++  +L  +++ C    VDLD+LCI A ERVF I ++++A   DGNL D   L+A++ L +F+RPDV +G+ G + V    K + PVPL ++ +P  VT+G+  ++  ++ D  K EE  L   +++V LT   +L C H  G          +RC  L  S+  +L  L+ +V+       +ARQ+++                  ++++SAS++P 
Sbjct:   20 RLDGRTLKEYREITFHFPHGHANG---GCCIVKIGSTAVLAKVSVEVVEPKHYRPAQGMLFVNFDATILSANEVKRKGRSRDDEGRRLSAVLQTCFRDCVDLDALCIVAWERVFAIRVDLRALASDGNLGDCGALAAVVALASFRRPDVYVGDEGRVIVDTQCKHRPPVPLFLRRIPVLVTLGLASDTKIILQDPTKREEAILTGGRVMVGLTSHGELCCLHTSGLSTPIRPESLSRCILLANSRARSLVTLVHRVLDGLERQRQARQAASSARQADVERAKQMEEDAPLVLSSASFLPG 316          
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:103023601])

HSP 1 Score: 124.02 bits (310), Expect = 1.165e-31
Identity = 70/218 (32.11%), Postives = 127/218 (58.26%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            K +++ +RLDGR  ++YRNI I           +  C +SLGKT+VL ++SC++V PK + P+ G++  ++  S + + + +    +E  + L   +E+CL  +K +D +SLC+ +GE+V+ I +++     DGNL+D   ++A+  L  F+RPDV I +  +IT+  + +++DPV L I  MP  V+     +   L++D  + EE   D  +V+ +
Sbjct:   16 KAVEEKKRLDGRQTYDYRNIRITF------GTDYGCCTVSLGKTRVLAQVSCELVPPKDSRPTEGIVFFNLELSPMASPAFQPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDVAI-QGRDITIF-SPEERDPVALSIYHMPICVSFAFFQQGTYLLVDPCEKEEQVTDGLLVIAM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:103023601])

HSP 1 Score: 124.405 bits (311), Expect = 1.207e-31
Identity = 70/218 (32.11%), Postives = 127/218 (58.26%), Query Frame = 2
Query:   80 KLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCL 727
            K +++ +RLDGR  ++YRNI I           +  C +SLGKT+VL ++SC++V PK + P+ G++  ++  S + + + +    +E  + L   +E+CL  +K +D +SLC+ +GE+V+ I +++     DGNL+D   ++A+  L  F+RPDV I +  +IT+  + +++DPV L I  MP  V+     +   L++D  + EE   D  +V+ +
Sbjct:   16 KAVEEKKRLDGRQTYDYRNIRITF------GTDYGCCTVSLGKTRVLAQVSCELVPPKDSRPTEGIVFFNLELSPMASPAFQPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDVAI-QGRDITIF-SPEERDPVALSIYHMPICVSFAFFQQGTYLLVDPCEKEEQVTDGLLVIAM 225          
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 73.559 bits (179), Expect = 2.411e-14
Identity = 58/236 (24.58%), Postives = 109/236 (46.19%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIG--ESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLG 766
             I   ++D  R+DGR   +YR++ +    +S  +    +  +SLG T VL  I  ++ +PK   P+ G ++  V+ S       + R   E  ++L   + K  N   ++DL SLCIC GE  + + I++     DGNL D + ++    L   + P V +   E G   +  +    D + L +  +P  VT+  +   ++ ++D    E+    + +++ +T    + C   LG
Sbjct:   13 YIMHGVRDDLRVDGRGCEDYRHMEVETDVVSNTD---GSAKVSLGHTDVLVGIKAEIGKPKPAVPNEGYVEFFVDCSANATPEFEGRGGEELGVELSNTLYKVFNNRHSLDLRSLCICPGEHCWVLYIDVLLLQCDGNLFDAMSVAIKAALFNTRIPKVQVSEDEEGGKEIELSDDPYDCMRLDVTNVPCIVTLSKI--GHRHVVDATLQEKACSVASLLISITHKGLVTCVRKLG 243          
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:103041470])

HSP 1 Score: 70.8626 bits (172), Expect = 1.872e-13
Identity = 63/246 (25.61%), Postives = 113/246 (45.93%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWH-PLGSEL 775
            FK  +     R  LK++ R DGR + E+R  ++ +  I     A  + ++ +G T V+C I  ++  P ++ P +G I  +V+   + ++  +     E+A      I   ++  K +  + LCI   +  + +  +I     DGN+LD  +++ L  LK  + P VTI +  ++    +++ K    LQI   P   +  V  +   LI+D    EE    S I   +   +QL  +H P GS L
Sbjct:    5 FKTAEPLEYHRSFLKENCRPDGRELGEFRPTTLNIGSI---GTADGSAMVKIGNTTVICGIKAELSAPPSDAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIDGSKIIKKEDLCIEKSKLCWVLYCDIMCLDYDGNVLDACIITLLAALKNTQIPKVTINKETDL-AEVDIEHKR--HLQINKHPVSSSFAVF-DDTVLIVDPTAEEESLATSVITAVVDEDDQLCAFHKPGGSSL 243          
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:103041470])

HSP 1 Score: 68.5514 bits (166), Expect = 9.958e-13
Identity = 61/247 (24.70%), Postives = 113/247 (45.75%), Query Frame = 2
Query:   44 YFKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWH-PLGSEL 775
            + +  +     R  LK++ R DGR + E+R  ++ +  I     A  + ++ +G T V+C I  ++  P ++ P +G I  +V+   + ++  +     E+A      I   ++  K +  + LCI   +  + +  +I     DGN+LD  +++ L  LK  + P VTI +  ++    +++ K    LQI   P   +  V  +   LI+D    EE    S I   +   +QL  +H P GS L
Sbjct:    3 FIRTAEPLEYHRSFLKENCRPDGRELGEFRPTTLNIGSI---GTADGSAMVKIGNTTVICGIKAELSAPPSDAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIDGSKIIKKEDLCIEKSKLCWVLYCDIMCLDYDGNVLDACIITLLAALKNTQIPKVTINKETDL-AEVDIEHKR--HLQINKHPVSSSFAVF-DDTVLIVDPTAEEESLATSVITAVVDEDDQLCAFHKPGGSSL 242          
BLAST of Exosome complex component RRP45 vs. Ensembl Sea Lamprey
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:450057])

HSP 1 Score: 111.694 bits (278), Expect = 8.089e-28
Identity = 66/220 (30.00%), Postives = 125/220 (56.82%), Query Frame = 2
Query:  212 QVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIK 865
            +VL ++SC++V PK N P+ G++ +++  S + + + +    +E  ++L  ++E+CL  ++ VD +SLC+ AGE+V+ I  ++     DGN+LD   ++A+  L  F+RPDV++ +   +TV+   +++DPVPL I  MP  V+     +   L++D  +LEE  +D ++V+ +    +L      G  + T      RC ++   KV  +  LI + +K
Sbjct:    1 RVLAQVSCELVAPKQNRPTDGILFVNLELSPMASPALEAGRQSEMGVELNRLLERCLRTSRCVDTESLCVIAGEKVWQIRADVHLLNHDGNVLDAATVAAVTALAHFRRPDVSV-QGSEVTVYPP-EERDPVPLSIHHMPMPVSFAFFEQGTYLLVDATELEERVMDGRLVIAMNKHGELCAVQSSGGIMLTQDQM-LRCTKIANVKVGEITELIQRALK 217          
BLAST of Exosome complex component RRP45 vs. Ensembl Sea Lamprey
Match: exosc8 (exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1736])

HSP 1 Score: 65.4698 bits (158), Expect = 2.299e-12
Identity = 60/250 (24.00%), Postives = 113/250 (45.20%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIG-ESG--NITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLT-PTNQLWCWH-PLGSEL 775
            FK  +     R  LK++ R DGR + E+R  ++ +  +S    A  + L+ +G T V+C +  ++  P +  P +G I  ++    + +   +     E+A      +   ++ +  + L  LCI  G+  + +  ++     DGN+LD   ++ L  L+    P V +  E+G   +TV E L      P+++   P   +  +  +   L++D    EE+ L   +V  +T   +QL   H P GS L
Sbjct:    8 FKTAEPVEYYRSFLKENCRPDGRELGEFRVTTLNIGSLST---ADGSALVKVGNTTVICGVKGELAAPTSEAPDQGFIVPNLELPPLCSPRFRPGPPGEQAQAASQFLADVIDSSHIIALQDLCIEKGKLAWVLYCDLMCLDYDGNILDACSIALLAALQNLTLPKVGVSKETGLAQVTVQERL------PVKVGNYPVSTSFSIF-DGTVLLVDPTD-EEEALSCGMVTIVTDEEDQLCAVHKPGGSPL 246          
BLAST of Exosome complex component RRP45 vs. Ensembl Sea Lamprey
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 50.447 bits (119), Expect = 2.528e-7
Identity = 44/192 (22.92%), Postives = 88/192 (45.83%), Query Frame = 2
Query:   86 LKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSN---KLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKD--KDPVPLQIKTMPFFVTI 640
            ++D  R DGR   ++R + +    +S  N + S   L LG+T VL  +  ++  P+ + P  G ++  V+ +    N+    + R   + +L++   +++    A  +DL SLCI   ++ + + +++      GN+ D   ++    L   + P V + E         L D   D V L++  +P  VT+
Sbjct:   19 VQDGVRGDGRGCEDFRVVELETEVVS--NTSGSA-RLRLGQTDVLVGVKAELGSPRLDCPDEGYLEFFVDCTTSSANATPEFEGRGGEDLSLEISSALQRSFAHAGCLDLRSLCILPRQQCWVLYVDVLLLEYGGNVFDAASIAVKAALFNTRIPTVHVSEDEEGVREIELSDDPYDCVRLEVARVPCIVTL 207          
BLAST of Exosome complex component RRP45 vs. Ensembl Yeast
Match: RRP45 (Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp45p (PM/SCL-75, EXOSC9); protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002688])

HSP 1 Score: 91.2781 bits (225), Expect = 2.453e-21
Identity = 59/197 (29.95%), Postives = 102/197 (51.78%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDAT-EKALKLEPIIEKCLNK--AVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVL 649
             I + L+ + RLDGR+  ++R++ I   K   D        + +G T+V C+ISC + +P  + P  GL  +    S +  +  +  + T E  +    IIEK + +  A+D++ LCI AG + + +  ++     DG  +D   ++ + GL  FK+PD+T+ GE   I VH  + +++PVPL I  +P  VT    
Sbjct:   14 FILEALRQNYRLDGRSFDQFRDVEITFGKEFGD------VSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGE--QIIVHP-VNEREPVPLGILHIPICVTFSFF 201          
BLAST of Exosome complex component RRP45 vs. Ensembl Nematostella
Match: EDO40802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S657])

HSP 1 Score: 130.568 bits (327), Expect = 1.592e-35
Identity = 79/256 (30.86%), Postives = 137/256 (53.52%), Query Frame = 2
Query:  104 LDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTI-GESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI 862
            LDGR +++YR + I        ++    C + LGKT+VL ++SC++ +PK N  + G I ++V  S + + + +    +E  ++L   +E+    ++A+D +SLCI AGE+V+ + ++I+     GN+LD   +SA+  L  F+RPDV++ GE   +T+H    D+DPVPL I  MP  VT         L++D N  EE  +D  +++ L    ++ C   +G  +        RC  +   KV  +  LI + +
Sbjct:    2 LDGRGIYDYRKLRIAF------SVERGHCEVQLGKTRVLAQVSCEITKPKTNRQTDGHIYINVELSPMASPAFEAGRMSELGVELNRFVERFYIESRAIDTESLCIVAGEKVWSVRVDIQVLDHSGNILDCACISAITALSHFRRPDVSVSGE--EVTIHSE-ADRDPVPLSILHMPICVTFAFFDNGELLLVDPNDKEEAVMDGHMMMALNIHREV-CGAVMGGGVSLETDQIIRCSNIAVVKVAEITELIEKAL 247          
BLAST of Exosome complex component RRP45 vs. Ensembl Nematostella
Match: EDO34153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ48])

HSP 1 Score: 98.2117 bits (243), Expect = 1.669e-23
Identity = 73/270 (27.04%), Postives = 131/270 (48.52%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLI 850
            FK  +     ++ LK++ R DGR + ++R   + +  IS    A+ + L+ LG T V+C ++ +  EP A+ P++G I  +V+   + + S +    +E A  L   I+  +  +  +DL+ LCI  G+ V+ + I++     DGN+ D  V++ L  L+  +   VTI E          KD   + L++K+MP  VT G+  + + +  D    EE     K+ V +T  N++   H  G    T       CF++   +V+ +  LI
Sbjct:    5 FKTAEPVEYYKQFLKENIRPDGRGLFDFRETILNVGSIST---ANGSALVKLGNTTVVCGVTAEFAEPAADVPNKGFIVPNVDLPPLCSPSFRPGPPSEHAQVLSTFIDNLITNSQLIDLEDLCIVDGKLVWVLYIDLMCLDYDGNVADAAVIAMLAALQNTRLHTVTINEETETPEPSENKD---IHLKLKSMPVAVTFGIF-DDDHIYCDPTDEEERLASGKVSVVMTTNNKVVAVHKPGGPPLTQDKL-QECFDVTTGRVLEVQQLI 266          
BLAST of Exosome complex component RRP45 vs. Ensembl Nematostella
Match: EDO34155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ50])

HSP 1 Score: 53.5286 bits (127), Expect = 2.736e-8
Identity = 54/211 (25.59%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  218 LCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLI 850
            LC    +  EP A+ P++G I  +V+   + + S +    +E A  L   I+  + K      L   A   V+ + I++     DGN+ D  V++ L  L+  +   VTI E          KD   + L++K+MP  VT G+  + + +  D    EE     K+ V +T  N++   H  G    T       CF++   +V+ +  LI
Sbjct:   12 LCFFKKEFAEPAADVPNKGFIVPNVDLPPLCSPSFRPGPPSEHAQVLSTFIDNLITKRSM--ELLQHAKYLVWVLYIDLMCLDYDGNVADAAVIAMLAALQNTRLHTVTINEETETPEPSENKD---IHLKLKSMPVAVTFGIF-DDDHIYCDPTDEEERLASGKVSVVMTTNNKVVAVHKPGGPPLTQDKL-QECFDVTTGRVLEVQQLI 215          
BLAST of Exosome complex component RRP45 vs. Ensembl Nematostella
Match: EDO34904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ0])

HSP 1 Score: 49.2914 bits (116), Expect = 8.323e-7
Identity = 52/225 (23.11%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  101 RLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLN--KAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKD-KDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLG 766
            R DGR+  +YR   +    +S  N + S   L L  T +L  +  ++ EP    P  G ++  V+ S   +     R   + A  L   +++  +   A+DL SL I  G++ + + ++       GNL D + L+    L   + P+VT+   G     E   D  D   L    MP  +T+  +    + ++D ++ EE   D  ++V +     +     +G
Sbjct:   23 RSDGRSCEDYRYFEVETGIVS--NTSGSA-RLRLSDTDILVGVKAEIGEPNLLTPGCGRVEFFVDCSSNASVEFNGRSGDDLAADLMRSLDRTYSNKSAIDLSSLSIIHGQQCWVLYVDTLVLECGGNLYDALSLAVKAALYNTRIPNVTVSSDGGEVELEISDDPYDCHQLPPDQMPIIITLSKI--GGRHVVDASQSEELCSDCHLLVAVNSCGNVCGQQKIG 242          
BLAST of Exosome complex component RRP45 vs. Ensembl Medaka
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:101156627])

HSP 1 Score: 129.028 bits (323), Expect = 3.837e-33
Identity = 74/267 (27.72%), Postives = 148/267 (55.43%), Query Frame = 2
Query:   68 NMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCL--NKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVI 862
            + I K +++ +RLDGR  ++YR I I           +  C + LG+T+V+ ++SC++V PK + P+ G++  ++  S + + + +    +E ++KL   +E+CL  +K +D +SLC+ +GE+V+ I +++    +DGNL+D   ++A+  L  F+RPDV + +   +TV+ + +++DP+PL I  MP  V+     +   L++D  + EE  +D  +++ +    ++      G  +        RC ++   KV  +  LIS+ +
Sbjct:   12 DFILKAIEEKKRLDGRQTYDYRKIKISF------GTDYGCCFVDLGQTRVMAQVSCELVAPKESRPNEGIMFFNIELSPLASPAFEQGRQSELSVKLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHMLNNDGNLMDASSIAAIAALCHFRRPDVAV-QGEEVTVY-SPEERDPIPLSIYHMPISVSFSFFQQGTYLLVDPCEREERVMDGLLMIAMNKHREICSIQSSGGIMLLKEQV-MRCSKIASVKVSEITELISKAL 269          
BLAST of Exosome complex component RRP45 vs. Ensembl Medaka
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:101168140])

HSP 1 Score: 68.5514 bits (166), Expect = 1.162e-12
Identity = 61/246 (24.80%), Postives = 111/246 (45.12%), Query Frame = 2
Query:   47 FKFIQIFNMIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWH-PLGSEL 775
            FK  +        LK++ R DGR + E+R  ++ +  IS    A  + L+ LG T V+C I  ++  P    P +G I  +V+   + ++  +     E+A      I   +  +  +  + LCI  G+  + +  +I     DGN+LD  +++ L  LK  + P VT+ ++       +LK++  +P  +   P   +  +  +S  LI+D    EE    S++ V      +L   H P G+ L
Sbjct:    5 FKTAEPLEYHMSFLKENCRPDGRELSEFRTTTLNIGSIST---ADGSALVKLGSTTVICGIKAELANPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQASSQFIADVIESSEIIKPEDLCIDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTRLPKVTVNKA-TCKPEIDLKERHELP--VHKHPVGTSFCIFQDS-ILIVDPTADEESLSTSRLSVVTDEEERLCSLHKPGGTSL 243          
BLAST of Exosome complex component RRP45 vs. Ensembl Medaka
Match: exosc7 (exosome component 7 [Source:NCBI gene;Acc:101160328])

HSP 1 Score: 67.3958 bits (163), Expect = 3.152e-12
Identity = 55/232 (23.71%), Postives = 106/232 (45.69%), Query Frame = 2
Query:   86 LKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNK--AVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDK--DPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGS 769
            ++D  R+DGR+  +YR++ +    +S  +    +  +SLG T VL  I  ++ +P+   P  G ++  V+ S       + R   E  ++L   + +  N   ++DL  LCI AGE  + + +++     DGNL D I ++    L   K P V +           L D   D V L ++ +P  VT+  +   ++ ++D    E+    + +++ +T    + C   +G 
Sbjct:   18 IRDDLRVDGRSCEDYRHMEVETDVVSNTD---GSARVSLGHTAVLVGIKAEIGKPRPLVPDEGYLEFFVDCSANATPEFEGRGGEELGIELSNTLYRVFNNKNSIDLKGLCISAGEHCWVLYVDVLLLQCDGNLYDAISVAIKAALFNTKIPRVHMSSDDEGGKEVELSDDPFDCVRLSVENVPCIVTLCKV--GHRHVVDATLQEKACSVASLIIAVTHRGTVTCVKKVGG 244          
BLAST of Exosome complex component RRP45 vs. Ensembl Medaka
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:101168140])

HSP 1 Score: 66.2402 bits (160), Expect = 4.688e-12
Identity = 59/234 (25.21%), Postives = 108/234 (46.15%), Query Frame = 2
Query:   83 LLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKA--VDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWH-PLGSEL 775
             LK++ R DGR + E+R  ++ +  IS    A  + L+ LG T V+C I  ++  P    P +G I  +V+   + ++  +     E+A      I   +  +  +  + LCI  G+  + +  +I     DGN+LD  +++ L  LK  + P VT+ ++       +LK++  +P  +   P   +  +  +S  LI+D    EE    S++ V      +L   H P G+ L
Sbjct:    3 FLKENCRPDGRELSEFRTTTLNIGSIST---ADGSALVKLGSTTVICGIKAELANPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQASSQFIADVIESSEIIKPEDLCIDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTRLPKVTVNKA-TCKPEIDLKERHELP--VHKHPVGTSFCIFQDS-ILIVDPTADEESLSTSRLSVVTDEEERLCSLHKPGGTSL 229          
BLAST of Exosome complex component RRP45 vs. Planmine SMEST
Match: SMESG000033994.1 (SMESG000033994.1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 349/351 (99.43%), Postives = 349/351 (99.43%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILXXXXXXXXXXXTNEILDSAQNDDWSRIESLVSHTEKVVYQKS 1123
            MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDN AHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQ IKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILDGSDDMDIDSDTNEILDSAQNDDWSRIESLVSHTEKVVYQKS
Sbjct:    1 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNKAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQAIKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILDGSDDMDIDSDTNEILDSAQNDDWSRIESLVSHTEKVVYQKS 351          
BLAST of Exosome complex component RRP45 vs. Planmine SMEST
Match: SMESG000033981.1 (SMESG000033981.1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 349/351 (99.43%), Postives = 349/351 (99.43%), Query Frame = 2
Query:   71 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQVIKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILXXXXXXXXXXXTNEILDSAQNDDWSRIESLVSHTEKVVYQKS 1123
            MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDN AHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQ IKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILDGSDDMDIDSDTNEILDSAQNDDWSRIESLVSHTEKVVYQKS
Sbjct:    1 MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNKAHSTCLLSLGKTQVLCKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVKSKVVALNCLISQAIKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEKLIHEAPEILDGSDDMDIDSDTNEILDSAQNDDWSRIESLVSHTEKVVYQKS 351          
BLAST of Exosome complex component RRP45 vs. Planmine SMEST
Match: SMESG000042098.1 (SMESG000042098.1)

HSP 1 Score: 48.521 bits (114), Expect = 3.740e-6
Identity = 49/225 (21.78%), Postives = 96/225 (42.67%), Query Frame = 2
Query:  101 RLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDV-VEPKANHPSRGLIK--LDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLG 766
            RL  R  + +R ISI         +  +   ++ G T+VL  I+ +   +P  ++P  G IK  +D++ + I   SN+  D   + +K   I     +  ++L  LCI   ++ + I ++I     DGNLLD++ +     LK    P V   ++              +  +    P +VT+  +    + ++D ++ EE    ++ +  + P   + C    G
Sbjct:   24 RLSNRGFYSFRPISIE--------VGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANK-----------ELQFKFDNCPIYVTVNKI--DCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDG 227          
BLAST of Exosome complex component RRP45 vs. Planmine SMEST
Match: SMESG000042098.1 (SMESG000042098.1)

HSP 1 Score: 48.1358 bits (113), Expect = 4.498e-6
Identity = 49/225 (21.78%), Postives = 96/225 (42.67%), Query Frame = 2
Query:  101 RLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVLCKISCDV-VEPKANHPSRGLIK--LDVNTSFIKNNSNKLRDATEKALKLEPIIEKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLKTFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLILDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLG 766
            RL  R  + +R ISI         +  +   ++ G T+VL  I+ +   +P  ++P  G IK  +D++ + I   SN+  D   + +K   I     +  ++L  LCI   ++ + I ++I     DGNLLD++ +     LK    P V   ++              +  +    P +VT+  +    + ++D ++ EE    ++ +  + P   + C    G
Sbjct:   28 RLSNRGFYSFRPISIE--------VGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANK-----------ELQFKFDNCPIYVTVNKI--DCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDG 231          
The following BLAST results are available for this feature:
BLAST of Exosome complex component RRP45 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EXOSC92.575e-3330.34exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9... [more]
EXOSC91.775e-3029.50exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9... [more]
EXOSC92.263e-3028.46exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9... [more]
EXOSC92.437e-3028.46exosome component 9 [Source:HGNC Symbol;Acc:HGNC:9... [more]
EXOSC82.509e-1924.82exosome component 8 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
exos-93.227e-3228.89EXOSome (Multiexonuclease complex) component [Sou... [more]
exos-93.227e-3228.89EXOSome (Multiexonuclease complex) component [Sou... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rrp456.849e-2628.62gene:FBgn0030789 transcript:FBtr0344090[more]
Rrp456.849e-2628.62gene:FBgn0030789 transcript:FBtr0074355[more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
exosc91.826e-3229.17exosome component 9 [Source:NCBI gene;Acc:450057][more]
exosc92.949e-1925.38exosome component 9 [Source:NCBI gene;Acc:450057][more]
exosc71.064e-1425.86exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
exosc81.069e-1124.29exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdelr31.337e-3332.57KDEL endoplasmic reticulum protein retention recep... [more]
kdelr32.219e-3332.57KDEL endoplasmic reticulum protein retention recep... [more]
kdelr33.280e-3329.45KDEL endoplasmic reticulum protein retention recep... [more]
kdelr33.311e-3332.57KDEL endoplasmic reticulum protein retention recep... [more]
kdelr34.523e-3332.57KDEL endoplasmic reticulum protein retention recep... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Exosc93.522e-3231.96exosome component 9 [Source:MGI Symbol;Acc:MGI:135... [more]
Exosc91.523e-3129.74exosome component 9 [Source:MGI Symbol;Acc:MGI:135... [more]
Exosc82.099e-1824.46exosome component 8 [Source:MGI Symbol;Acc:MGI:191... [more]
Exosc92.405e-1634.88exosome component 9 [Source:MGI Symbol;Acc:MGI:135... [more]
Exosc81.271e-830.77exosome component 8 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of Exosome complex component RRP45 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XJQ5|EXOS9_DANRE1.378e-3129.17Exosome complex component RRP45 OS=Danio rerio OX=... [more]
sp|Q3SWZ4|EXOS9_BOVIN5.066e-3128.84Exosome complex component RRP45 OS=Bos taurus OX=9... [more]
sp|Q9JHI7|EXOS9_MOUSE1.066e-3029.74Exosome complex component RRP45 OS=Mus musculus OX... [more]
sp|Q4QR75|EXOS9_RAT1.916e-3029.74Exosome complex component RRP45 OS=Rattus norvegic... [more]
sp|Q06265|EXOS9_HUMAN1.170e-2928.46Exosome complex component RRP45 OS=Homo sapiens OX... [more]
back to top
BLAST of Exosome complex component RRP45 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7LAR72.910e-4231.03Uncharacterized protein (Fragment) OS=Dibothriocep... [more]
H2KTE09.359e-4230.54Exosome complex component RRP45 OS=Clonorchis sine... [more]
A0A1S8WYF47.601e-4132.103' exoribonuclease family, domain 1 OS=Opisthorchi... [more]
A0A183T6271.382e-4031.33RNase_PH domain-containing protein OS=Schistocepha... [more]
A0A0X3PNT31.470e-4031.33RNase_PH domain-containing protein OS=Schistocepha... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exosc91.165e-3132.11exosome component 9 [Source:NCBI gene;Acc:10302360... [more]
exosc91.207e-3132.11exosome component 9 [Source:NCBI gene;Acc:10302360... [more]
exosc72.411e-1424.58exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
exosc81.872e-1325.61exosome component 8 [Source:NCBI gene;Acc:10304147... [more]
exosc89.958e-1324.70exosome component 8 [Source:NCBI gene;Acc:10304147... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc98.089e-2830.00exosome component 9 [Source:NCBI gene;Acc:450057][more]
exosc82.299e-1224.00exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
exosc72.528e-722.92exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RRP452.453e-2129.95Exosome non-catalytic core component; involved in ... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO408021.592e-3530.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341531.669e-2327.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341552.736e-825.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349048.323e-723.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
exosc93.837e-3327.72exosome component 9 [Source:NCBI gene;Acc:10115662... [more]
exosc81.162e-1224.80exosome component 8 [Source:NCBI gene;Acc:10116814... [more]
exosc73.152e-1223.71exosome component 7 [Source:NCBI gene;Acc:10116032... [more]
exosc84.688e-1225.21exosome component 8 [Source:NCBI gene;Acc:10116814... [more]
back to top
BLAST of Exosome complex component RRP45 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000033994.10.000e+099.43SMESG000033994.1[more]
SMESG000033981.10.000e+099.43SMESG000033981.1[more]
SMESG000042098.13.740e-621.78SMESG000042098.1[more]
SMESG000042098.14.498e-621.78SMESG000042098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021651 ID=SMED30021651|Name=Exosome complex component RRP45|organism=Schmidtea mediterranea sexual|type=transcript|length=1143bp
ATTTAATTAAAATATATTTGTTTATAAATATCTAATAAAAATTTATTTTA
AGTTTATTCAAATTTTTAATATGATCAGAAAATTACTTAAAGATTCTCAG
CGCCTTGATGGGCGAAATGTTCATGAATATCGTAATATTTCCATTAGATT
GCCTAAAATTTCAATGGATAATATAGCACACTCAACATGCTTATTATCAT
TGGGCAAAACTCAAGTTTTATGTAAGATAAGTTGCGATGTGGTTGAGCCT
AAAGCGAACCATCCCAGTCGAGGATTAATTAAGCTTGATGTTAATACATC
TTTTATTAAAAATAATTCAAATAAATTACGCGATGCAACAGAAAAAGCAT
TGAAACTAGAACCTATTATTGAAAAATGTTTAAATAAAGCAGTCGATTTA
GATTCCTTGTGTATTTGTGCTGGTGAAAGAGTGTTTTGTATTAATATTGA
AATAAAAGCTCAATTTGACGACGGAAATCTATTGGATGTTATAGTTCTCT
CTGCTTTGATTGGATTAAAGACTTTTAAAAGGCCTGACGTGACAATTGGT
GAATCTGGAAATATTACTGTTCATGAAAATTTAAAAGACAAAGATCCTGT
TCCACTTCAAATCAAAACTATGCCATTTTTCGTGACTATTGGAGTCTTGA
TGGAGTCAAATCAATTAATTTTGGATTTAAACAAATTAGAAGAAGATACT
TTAGATAGTAAAATCGTTGTTTGCCTTACTCCCACCAATCAGCTGTGGTG
TTGGCATCCCCTTGGATCAGAACTTTGGACCAATTTATCTTTCAATAACC
GCTGTTTTGAACTTGTGAAAAGCAAAGTCGTTGCACTAAATTGTTTGATT
TCTCAAGTTATAAAAGCAAGACAATCGAGCAATGAAACAATTATTATAAA
TTCAGCATCTTATGTTCCCAGTCATCCCGTTTTCGTCGATGAAAATCTAG
AAGATAATGAACCGGAAAAATTGATCCATGAAGCTCCTGAAATTCTCGAC
GGATCCGACGATATGGATATCGATAGTGACACCAATGAAATCCTTGATTC
AGCTCAGAATGATGATTGGAGTCGAATAGAGTCTTTGGTATCTCACACTG
AGAAGGTCGTATATCAAAAGAGTTAAATACATGAGATCGGAAG
back to top

protein sequence of SMED30021651-orf-1

>SMED30021651-orf-1 ID=SMED30021651-orf-1|Name=SMED30021651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=352bp
MIRKLLKDSQRLDGRNVHEYRNISIRLPKISMDNIAHSTCLLSLGKTQVL
CKISCDVVEPKANHPSRGLIKLDVNTSFIKNNSNKLRDATEKALKLEPII
EKCLNKAVDLDSLCICAGERVFCINIEIKAQFDDGNLLDVIVLSALIGLK
TFKRPDVTIGESGNITVHENLKDKDPVPLQIKTMPFFVTIGVLMESNQLI
LDLNKLEEDTLDSKIVVCLTPTNQLWCWHPLGSELWTNLSFNNRCFELVK
SKVVALNCLISQVIKARQSSNETIIINSASYVPSHPVFVDENLEDNEPEK
LIHEAPEILDGSDDMDIDSDTNEILDSAQNDDWSRIESLVSHTEKVVYQK
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027408PNPase/RNase_PH_dom_sf
IPR036345ExoRNase_PH_dom2_sf
IPR001247ExoRNase_PH_dom1
IPR015847ExoRNase_PH_dom2
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: cellular component
TermDefinition
GO:0000178exosome (RNase complex)
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027408PNPase/RNase PH domain superfamilyGENE3DG3DSA:3.30.230.70coord: 1..281
e-value: 2.2E-55
score: 190.0
IPR001247Exoribonuclease, phosphorolytic domain 1PFAMPF01138RNase_PHcoord: 30..155
e-value: 5.1E-10
score: 40.0
NoneNo IPR availablePANTHERPTHR11097:SF14EXOSOME COMPLEX COMPONENT RRP45coord: 2..288
NoneNo IPR availablePANTHERPTHR11097EXOSOME COMPLEX EXONUCLEASE RIBOSOMAL RNA PROCESSING PROTEINcoord: 2..288
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 2..208
IPR036345Exoribonuclease, PH domain 2 superfamilySUPERFAMILYSSF55666Ribonuclease PH domain 2-likecoord: 179..271