Adenosine monophosphate-protein transferase FICD

Overview
NameAdenosine monophosphate-protein transferase FICD
Smed IDSMED30021637
Length (bp)1950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenosine monophosphate-protein transferase FICD (SMED30021637) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenosine monophosphate-protein transferase FICD (SMED30021637) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenosine monophosphate-protein transferase FICD (SMED30021637) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenosine monophosphate-protein transferase FICD (SMED30021637) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021637

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021637SMESG000007402.1 dd_Smed_v4_11524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021637SMESG000007402.1 dd_Smed_v4_11524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021637SMESG000007402.1 dd_Smed_v6_11524_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30021637SMESG000007402.1 Contig43916newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021637SMESG000007402.1 Contig43916uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30021637SMESG000007402.1 dd_Smed_v4_11524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Match: CEP44 (centrosomal protein 44 [Source:HGNC Symbol;Acc:HGNC:29356])

HSP 1 Score: 60.4622 bits (145), Expect = 8.920e-10
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELIS 473
            L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++   +   V K   EL S
Sbjct:   13 LEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSS 125          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Match: CEP44 (centrosomal protein 44 [Source:HGNC Symbol;Acc:HGNC:29356])

HSP 1 Score: 58.9214 bits (141), Expect = 9.835e-10
Identity = 33/111 (29.73%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNEL 467
            L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++   +   V K   EL
Sbjct:   13 LEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKEL 123          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Match: CEP44 (centrosomal protein 44 [Source:HGNC Symbol;Acc:HGNC:29356])

HSP 1 Score: 57.3806 bits (137), Expect = 1.366e-9
Identity = 29/97 (29.90%), Postives = 54/97 (55.67%), Query Frame = 3
Query:  132 SLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            +L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++
Sbjct:   12 NLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Match: CEP44 (centrosomal protein 44 [Source:HGNC Symbol;Acc:HGNC:29356])

HSP 1 Score: 57.3806 bits (137), Expect = 1.366e-9
Identity = 29/97 (29.90%), Postives = 54/97 (55.67%), Query Frame = 3
Query:  132 SLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            +L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++
Sbjct:   12 NLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Match: CEP44 (centrosomal protein 44 [Source:HGNC Symbol;Acc:HGNC:29356])

HSP 1 Score: 60.8474 bits (146), Expect = 3.526e-9
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELIS 473
            L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++   +   V K   EL S
Sbjct:   13 LEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSS 125          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Zebrafish
Match: cep44 (centrosomal protein 44 [Source:ZFIN;Acc:ZDB-GENE-060929-392])

HSP 1 Score: 72.4034 bits (176), Expect = 5.007e-14
Identity = 32/96 (33.33%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            L   LR LK  + VD++ L  G+  + + +    F   + + + Y+V+ G +L+G+ D +F+E+VYK++RD+F+ KP + + QF   GF +RK+ +
Sbjct:   13 LEASLRSLKYPRDVDYQRLAVGDPSACLPIVSFAFTSFSPSLTEYLVDFGVELTGMNDLRFIENVYKVLRDVFSYKPLLTKQQFLQFGFAERKVSI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Zebrafish
Match: cep44 (centrosomal protein 44 [Source:ZFIN;Acc:ZDB-GENE-060929-392])

HSP 1 Score: 72.4034 bits (176), Expect = 3.740e-13
Identity = 32/96 (33.33%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            L   LR LK  + VD++ L  G+  + + +    F   + + + Y+V+ G +L+G+ D +F+E+VYK++RD+F+ KP + + QF   GF +RK+ +
Sbjct:   13 LEASLRSLKYPRDVDYQRLAVGDPSACLPIVSFAFTSFSPSLTEYLVDFGVELTGMNDLRFIENVYKVLRDVFSYKPLLTKQQFLQFGFAERKVSI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Xenopus
Match: cep44 (centrosomal protein 44kDa [Source:NCBI gene;Acc:780008])

HSP 1 Score: 74.7146 bits (182), Expect = 1.039e-13
Identity = 31/103 (30.10%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            V      L + LR L   + VD+ GL+ G+  +F+ +  + F   + + +  ++  G +L+  +D +F+E+VYK++RD+FN KP + + QF    F++RK+++
Sbjct:    6 VKGCIRKLEQRLRTLNYPRDVDYSGLIKGDPSAFLPIISYTFTCYSTSIAEILISLGIELATKSDLRFIEAVYKVLRDVFNYKPILTKQQFLQSSFSERKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Xenopus
Match: cep44 (centrosomal protein 44kDa [Source:NCBI gene;Acc:780008])

HSP 1 Score: 74.3294 bits (181), Expect = 1.444e-13
Identity = 31/103 (30.10%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            V      L + LR L   + VD+ GL+ G+  +F+ +  + F   + + +  ++  G +L+  +D +F+E+VYK++RD+FN KP + + QF    F++RK+++
Sbjct:    6 VKGCIRKLEQRLRTLNYPRDVDYSGLIKGDPSAFLPIISYTFTCYSTSIAEILISLGIELATKSDLRFIEAVYKVLRDVFNYKPILTKQQFLQSSFSERKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Mouse
Match: Cep44 (centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:3525111])

HSP 1 Score: 61.2326 bits (147), Expect = 1.577e-10
Identity = 34/120 (28.33%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  135 LSRELRKLKNI-------KSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELIS 473
            L R LRKL+ +         VD+ GL+ G++ + + +  +     +   +  ++E   +L    D +F ++VYK++RD F+ KP + + QF   GF + K+E+   +   V K   ELI 
Sbjct:    6 LKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIG 125          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Mouse
Match: Cep44 (centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:3525111])

HSP 1 Score: 62.003 bits (149), Expect = 9.178e-10
Identity = 34/119 (28.57%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  135 LSRELRKLKNI-------KSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELI 470
            L R LRKL+ +         VD+ GL+ G++ + + +  +     +   +  ++E   +L    D +F ++VYK++RD F+ KP + + QF   GF + K+E+   +   V K   ELI
Sbjct:    6 LKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELI 124          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Mouse
Match: Cep44 (centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:3525111])

HSP 1 Score: 53.1434 bits (126), Expect = 2.754e-8
Identity = 27/96 (28.12%), Postives = 50/96 (52.08%), Query Frame = 3
Query:  135 LSRELRKLKNI-------KSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGF 401
            L R LRKL+ +         VD+ GL+ G++ + + +  +     +   +  ++E   +L    D +F ++VYK++RD F+ KP + + QF   GF
Sbjct:    6 LKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGF 101          
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Match: sp|Q0P4I1|CEP44_XENTR (Centrosomal protein of 44 kDa OS=Xenopus tropicalis OX=8364 GN=cep44 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.464e-13
Identity = 31/103 (30.10%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            V      L + LR L   + VD+ GL+ G+  +F+ +  + F   + + +  ++  G +L+  +D +F+E+VYK++RD+FN KP + + QF    F++RK+++
Sbjct:    6 VKGCIRKLEQRLRTLNYPRDVDYSGLIKGDPSAFLPIISYTFTCYSTSIAEILISLGIELATKSDLRFIEAVYKVLRDVFNYKPILTKQQFLQCAFSERKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Match: sp|A2RVA7|CEP44_XENLA (Centrosomal protein of 44 kDa OS=Xenopus laevis OX=8355 GN=cep44 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.064e-11
Identity = 30/103 (29.13%), Postives = 60/103 (58.25%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEM 422
            V      L + LR L   + VD+ GL+ G+  + + +  + F   + + +  ++  G +L+  +D +F+E+VYK++RD+FN KP + + QF    F++RK+++
Sbjct:    6 VKGCIRKLEQRLRTLNYPRDVDYTGLIKGDPSASLPIISYTFTCYSTSIAEILISFGIELTTKSDLRFIEAVYKVLRDVFNYKPILTKQQFLQCAFSERKIQI 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Match: sp|Q5HZK1|CEP44_MOUSE (Centrosomal protein of 44 kDa OS=Mus musculus OX=10090 GN=Cep44 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 6.420e-9
Identity = 34/119 (28.57%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  135 LSRELRKLKNI-------KSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELI 470
            L R LRKL+ +         VD+ GL+ G++ + + +  +     +   +  ++E   +L    D +F ++VYK++RD F+ KP + + QF   GF + K+E+   +   V K   ELI
Sbjct:    6 LKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELI 124          
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Match: sp|Q9C0F1|CEP44_HUMAN (Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.903e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELIS 473
            L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++   +   V K   EL S
Sbjct:   13 LEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSS 125          
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Match: sp|Q4R7I0|CEP44_MACFA (Centrosomal protein of 44 kDa OS=Macaca fascicularis OX=9541 GN=CEP44 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.989e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  135 LSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELIS 473
            L + LR L   + VD  GL+ G+  + + +  + F   +   +  I+E   +L    D +F+++VYK++RD FN KP + + QF   GF + K+++   +   V K   EL S
Sbjct:   13 LEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSS 125          
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Match: A0A5J4N775 (CEP44 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006385 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.955e-24
Identity = 49/124 (39.52%), Postives = 78/124 (62.90%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELISR 476
            M  +    E   R+LR LK    V+F+G+  G   +F+N +RHL C+ N   +  +V KG+ + G TDY+FME+VY+++RDL  ++P I   QF+S GF +RKLEM++ +AA +  L +  +S+
Sbjct:    1 MHNLKGQVEIFRRQLRALKFTHDVNFQGMFQGTPVAFINFYRHLLCDFNAELTTLLVNKGFSILGTTDYRFMEAVYRILRDLLGLRPPITLTQFYSSGFAERKLEMASQIAARLGSLISRPLSK 124          
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Match: A0A5K4F765 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.227e-24
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKL 455
            M  +  + E+L R+LR ++    V+F+G++ G S +FV  +RHL C+ N   + Y+VE G+ + G TD +FME +Y+++RDLF+ +PSI   QFF  GF +RK+EM+T +A H+  L
Sbjct:    1 MPNIKGSIENLRRQLRSIRFSYDVNFQGMVLGQSSAFVEFYRHLLCDYNAKVTSYLVELGFGMLGTTDSRFMEVLYRILRDLFSYRPSITMAQFFVTGFAERKIEMATTVALHIGSL 117          
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Match: Q5BZI9 (SJCHGC04075 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 2.762e-24
Identity = 48/117 (41.03%), Postives = 79/117 (67.52%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKL 455
            M  +  + E+L R+LR L+    V+F+G++ G S +FV  +RHL C+ N   + Y+VE+G+ + G TD +FME +Y+++RD+F+ +PSI   QFF  GF +RK+EM+T +A ++  L
Sbjct:    1 MPNLKGSIENLRRQLRSLRFNYEVNFQGMVLGQSSAFVEFYRHLLCDYNTNVTSYLVERGFGILGTTDNRFMEVLYRVLRDVFSFRPSITIAQFFMSGFAERKIEMATTVALNIESL 117          
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Match: A0A3Q0KNY6 (Asparagine-rich antigen, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 6.852e-24
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKL 455
            M  +  + E+L R+LR ++    V+F+G++ G S +FV  +RHL C+ N   + Y+VE G+ + G TD +FME +Y+++RDLF+ +PSI   QFF  GF +RK+EM+T +A H+  L
Sbjct:    1 MPNIKGSIENLRRQLRSIRFSYDVNFQGMVLGQSSAFVEFYRHLLCDYNAKVTSYLVELGFGMLGTTDSRFMEVLYRILRDLFSYRPSITMAQFFVTGFAERKIEMATTVALHIGSL 117          
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Match: G4M0S5 (Asparagine-rich antigen, putative OS=Schistosoma mansoni OX=6183 GN=Smp_145070 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 9.073e-24
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKL 455
            M  +  + E+L R+LR ++    V+F+G++ G S +FV  +RHL C+ N   + Y+VE G+ + G TD +FME +Y+++RDLF+ +PSI   QFF  GF +RK+EM+T +A H+  L
Sbjct:    1 MPNIKGSIENLRRQLRSIRFSYDVNFQGMVLGQSSAFVEFYRHLLCDYNAKVTSYLVELGFGMLGTTDSRFMEVLYRILRDLFSYRPSITMAQFFVTGFAERKIEMATTVALHIGSL 117          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Cavefish
Match: cep44 (centrosomal protein 44 [Source:NCBI gene;Acc:103025656])

HSP 1 Score: 73.1738 bits (178), Expect = 2.129e-13
Identity = 45/154 (29.22%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHV----RKLTN----------ELISRVNKKTVQTQSLMKSSLKRP 533
            +  + + L   LR LK  + VD+  L  G+  S + +  + F   + A + ++VE+G +L+G  D  F+E+VYK++RD F+ KP + + QF   GF +RK  +   +   V    +KLT            L+SR + KT ++  L ++  + P
Sbjct:    6 LKGSLKKLQTSLRYLKYPREVDYNSLAKGDPFSCLPIVSYAFTSFSSAVAEHLVEQGIELTGKNDLSFIETVYKVLRDFFSYKPLLTKQQFLQFGFAERKAGLLCDIIGFVMEKHKKLTKGSKVVSPPKRRLLSRSDSKTAESPPLRETCHRVP 159          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003141.1 (pep scaffold:Pmarinus_7.0:GL479732:13517:21204:-1 gene:ENSPMAG00000002871.1 transcript:ENSPMAT00000003141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.156e-20
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELISRVNKKTVQTQSLMKSSLKRPNSA 542
            +  +   +  E+R L+    VD+ GLL+G++++ + L  H F E ++  +  + E G +L+  +D +F+E+VY+++RD F ++P + + QF   GF +RK++M   +   VR    EL          TQ   K S ++P SA
Sbjct:    6 IKGSLRRVQMEVRLLRYPHEVDYEGLLTGDAKALLPLLHHAFTEYSLPVAECLAEWGVELAAKSDLRFVEAVYRVLRDRFEVRPVLTKAQFLQLGFAERKMQMLCDIGQAVRTKHKEL----------TQLAHKVSARQPCSA 138          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Nematostella
Match: EDO40092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S827])

HSP 1 Score: 80.4925 bits (197), Expect = 4.010e-18
Identity = 37/105 (35.24%), Postives = 63/105 (60.00%), Query Frame = 3
Query:  108 AQVNNNAESLSRELR--KLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKL 416
              +NNN   L +EL+  +   +  +D R L  G  +SF+ +  ++F + +   S +  EK YDL G TD +F+E+VYK++RD F+ KP + + QF + G+ +RK+
Sbjct:    4 GDINNNLRKLLKELKNVRFPRMHELDLRALSLGKPDSFLPILHYVFLDYSCELSEFFSEKDYDLYGKTDLRFVETVYKILRDEFHYKPPLTREQFLALGYAERKV 108          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Medaka
Match: ENSORLT00000013730.2 (pep primary_assembly:ASM223467v1:1:27433211:27436715:-1 gene:ENSORLG00000010947.2 transcript:ENSORLT00000013730.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 1.339e-13
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  114 VNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKL 416
            V +    L   LR +K  + VD+  L  G+  +F+ +        +  F+  ++  G++L G TD +F +++YK++RD+F+ KP +++ QFF  GF+QRK+
Sbjct:    7 VQSGLRKLESLLRVIKYPEDVDYNKLSKGDPSAFLPIASFTLTTFSPPFAELLMTAGFELIGKTDLRFTDTLYKLLRDVFHYKPVLSKQQFFQLGFSQRKI 107          
BLAST of Adenosine monophosphate-protein transferase FICD vs. Planmine SMEST
Match: SMESG000007402.1 (SMESG000007402.1)

HSP 1 Score: 1198.34 bits (3099), Expect = 0.000e+0
Identity = 595/600 (99.17%), Postives = 596/600 (99.33%), Query Frame = 3
Query:  105 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLAAHVRKLTNELISRVNKKTVQTQSLMKSSLKRPNSAPKQAKVIELGDEHEEDYVKNRSFSINNNRSKKIKSVNKYSDKLSGLNGKSKKNSNIKEHADDINGLSTDSEPSNPANSFNFNHTINPSLDNHQYNNDDD-AIRGCDKYHTLQAFREPIEVANVSAYESAALDHESYLRPYQNYQQYTRSDLHDQKVYDVKQYTPRSNDENLVIKKHDNIPGLDKIMQQFDTVIARITLLESRMQRIESKFNISYKPSFDNQSLGHTFYSGXXXXXXXXFSVPHNYHDINIVESYNEKIPNFVRDSRTIISDFESNHQTNNNRNDSNKQYSTFGSGTSTADNLYQPYITNQPGSIKANVEKSSLSCANSAPGSYRSSLSMDLHSSVATVPKYMSSTTNYSEKRSFDVNNLPKDNNAYRITNTSTKYTQPTQKTYNSIPPMHPIMKKSDNSEFDENRQGKSLNFDKYDSNFQSQTDRIASLLSDTQKMLKISDEEL 1901
            MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLA HVRKLTNELISRVNKKTVQTQSLMKSSLKRPNSAPKQAKVIELGDEHEEDYVKNRSFSINNNRSKKIKSVNKYSDKLSGLNGKSKKNSNIKEHADDINGLSTDSEPSNPANSFNFNHTINPSLDNHQYN+DDD AIRGCDKYH LQAFREPIEVANVSAYESAALDHESYLRPYQNYQQYTRSDLHDQKVYDVKQYTPRSNDEN VIKKHDNIPGLDKIMQQFDTVIARITLLESRMQRIESKFNISYKPSFDNQSLGHTFYSGQNNQNNQQFSVPHNYHDINIVESYNEKIPNFVRDSRTIISDFESNHQTNNNRNDSNKQYSTFGSGTSTADNLYQPYITNQPGSIKANVEKSSLSCANSAPGSYRSSLSMDLHSSVATVPKYMSSTTNYSEKRSFDVNNLPKDNNAYRITNTSTKYTQPTQKTYNSIPPMHPIMKKSDNSEFDENRQGKSLNFDKYDSNFQSQTDRIASLLSDTQKMLKISDEEL
Sbjct:    1 MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNIAFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFTQRKLEMSTLLATHVRKLTNELISRVNKKTVQTQSLMKSSLKRPNSAPKQAKVIELGDEHEEDYVKNRSFSINNNRSKKIKSVNKYSDKLSGLNGKSKKNSNIKEHADDINGLSTDSEPSNPANSFNFNHTINPSLDNHQYNDDDDDAIRGCDKYHALQAFREPIEVANVSAYESAALDHESYLRPYQNYQQYTRSDLHDQKVYDVKQYTPRSNDENQVIKKHDNIPGLDKIMQQFDTVIARITLLESRMQRIESKFNISYKPSFDNQSLGHTFYSGQNNQNNQQFSVPHNYHDINIVESYNEKIPNFVRDSRTIISDFESNHQTNNNRNDSNKQYSTFGSGTSTADNLYQPYITNQPGSIKANVEKSSLSCANSAPGSYRSSLSMDLHSSVATVPKYMSSTTNYSEKRSFDVNNLPKDNNAYRITNTSTKYTQPTQKTYNSIPPMHPIMKKSDNSEFDENRQGKSLNFDKYDSNFQSQTDRIASLLSDTQKMLKISDEEL 600          
The following BLAST results are available for this feature:
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP448.920e-1030.09centrosomal protein 44 [Source:HGNC Symbol;Acc:HGN... [more]
CEP449.835e-1029.73centrosomal protein 44 [Source:HGNC Symbol;Acc:HGN... [more]
CEP441.366e-929.90centrosomal protein 44 [Source:HGNC Symbol;Acc:HGN... [more]
CEP441.366e-929.90centrosomal protein 44 [Source:HGNC Symbol;Acc:HGN... [more]
CEP443.526e-930.09centrosomal protein 44 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep445.007e-1433.33centrosomal protein 44 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cep443.740e-1333.33centrosomal protein 44 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep441.039e-1330.10centrosomal protein 44kDa [Source:NCBI gene;Acc:78... [more]
cep441.444e-1330.10centrosomal protein 44kDa [Source:NCBI gene;Acc:78... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cep441.577e-1028.33centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:... [more]
Cep449.178e-1028.57centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:... [more]
Cep442.754e-828.13centrosomal protein 44 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P4I1|CEP44_XENTR7.464e-1330.10Centrosomal protein of 44 kDa OS=Xenopus tropicali... [more]
sp|A2RVA7|CEP44_XENLA1.064e-1129.13Centrosomal protein of 44 kDa OS=Xenopus laevis OX... [more]
sp|Q5HZK1|CEP44_MOUSE6.420e-928.57Centrosomal protein of 44 kDa OS=Mus musculus OX=1... [more]
sp|Q9C0F1|CEP44_HUMAN1.903e-830.09Centrosomal protein of 44 kDa OS=Homo sapiens OX=9... [more]
sp|Q4R7I0|CEP44_MACFA1.989e-830.09Centrosomal protein of 44 kDa OS=Macaca fascicular... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N7751.955e-2439.52CEP44 domain-containing protein OS=Paragonimus wes... [more]
A0A5K4F7652.227e-2441.88Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
Q5BZI92.762e-2441.03SJCHGC04075 protein (Fragment) OS=Schistosoma japo... [more]
A0A3Q0KNY66.852e-2441.88Asparagine-rich antigen, putative OS=Schistosoma m... [more]
G4M0S59.073e-2441.88Asparagine-rich antigen, putative OS=Schistosoma m... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep442.129e-1329.22centrosomal protein 44 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003141.11.156e-2030.07pep scaffold:Pmarinus_7.0:GL479732:13517:21204:-1 ... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400924.010e-1835.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000013730.21.339e-1331.68pep primary_assembly:ASM223467v1:1:27433211:274367... [more]
back to top
BLAST of Adenosine monophosphate-protein transferase FICD vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000007402.10.000e+099.17SMESG000007402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021637 ID=SMED30021637|Name=Adenosine monophosphate-protein transferase FICD|organism=Schmidtea mediterranea sexual|type=transcript|length=1950bp
ATATAACTAAGGTATCAATATAATGCATAAATTTATAAATTAGTTACTAA
TCAAAACTCACTTTAGTTAAATTTAAGATTTTTAATTTTAACCATAGTTT
CCAAATGGCACAAGTAAATAATAATGCAGAATCTTTAAGTCGAGAATTAA
GAAAGTTAAAGAATATTAAATCAGTTGATTTTCGAGGTCTTCTATCAGGA
AATTCTGAAAGTTTTGTGAATCTCTTTCGACATTTGTTTTGTGAAAATAA
TATCGCATTTTCTCGATATATTGTTGAAAAAGGTTATGATTTATCCGGAT
TAACTGATTACAAATTTATGGAATCTGTTTACAAAATGATGAGAGATTTG
TTTAATATTAAACCTTCTATAAATCAGAATCAGTTCTTTTCTCAAGGATT
CACTCAACGGAAATTGGAAATGAGTACTCTGTTAGCAGCCCACGTTAGAA
AATTAACAAATGAATTGATTAGTAGAGTTAATAAGAAAACTGTCCAAACA
CAATCATTGATGAAATCATCGTTGAAACGACCAAACTCAGCTCCGAAACA
AGCTAAAGTCATTGAACTAGGAGACGAACACGAAGAGGACTATGTCAAAA
ACCGGAGTTTTTCAATAAATAATAATCGGTCCAAAAAAATTAAATCTGTC
AATAAGTATTCCGATAAGTTATCCGGTCTTAATGGAAAATCAAAAAAGAA
CTCAAATATTAAGGAGCATGCTGATGATATTAACGGTCTTAGTACTGATT
CTGAGCCATCAAATCCAGCAAATAGCTTTAATTTCAACCACACAATCAAT
CCGTCTTTGGATAACCATCAGTATAATAATGATGATGATGCAATCCGAGG
TTGTGATAAATACCATACTTTACAAGCTTTTCGGGAACCTATAGAAGTTG
CAAATGTATCGGCTTATGAATCGGCAGCTTTAGATCATGAATCATATTTG
AGGCCATATCAGAATTATCAGCAATATACACGTTCGGATTTGCACGATCA
AAAAGTGTATGATGTTAAACAGTACACTCCGAGATCAAACGACGAAAACC
TAGTTATCAAAAAACATGATAATATTCCGGGATTGGATAAAATTATGCAG
CAATTCGATACAGTGATAGCCAGAATCACTCTTCTTGAAAGTCGGATGCA
AAGAATTGAATCAAAATTTAATATTAGTTACAAGCCTTCGTTTGACAATC
AATCACTCGGTCACACATTTTATTCTGGACAGAACAATCAAAACAATCAG
CAATTCTCAGTTCCTCATAACTATCACGATATCAACATTGTTGAATCTTA
CAATGAAAAAATCCCAAATTTTGTTCGTGATTCAAGAACAATAATATCTG
ACTTTGAATCCAACCATCAAACAAATAACAACAGAAATGACTCTAACAAG
CAATATTCTACTTTTGGTTCAGGAACAAGTACTGCTGATAATCTTTATCA
GCCGTATATTACTAATCAACCCGGGTCAATTAAAGCTAATGTTGAAAAAT
CATCTCTTTCTTGTGCAAATAGCGCACCTGGCTCCTATAGATCAAGTTTA
TCAATGGATCTTCATAGCTCCGTTGCTACTGTTCCGAAATACATGAGCAG
TACAACTAATTATTCTGAAAAACGTTCATTCGACGTTAATAATTTGCCTA
AAGACAATAATGCTTATCGTATTACAAATACAAGCACAAAATACACACAA
CCGACACAAAAAACCTACAACAGTATTCCGCCAATGCATCCTATAATGAA
AAAATCTGACAACTCCGAATTCGATGAAAACCGTCAAGGGAAATCATTGA
ATTTCGACAAATATGATTCTAATTTCCAGTCACAAACCGATCGAATTGCT
TCATTATTATCGGATACACAGAAAATGCTTAAAATATCAGATGAAGAATT
ATGATGGTGATCATTGGACTGATTGATCTAGCGTAGTATTGAATGCTCAC
back to top

protein sequence of SMED30021637-orf-1

>SMED30021637-orf-1 ID=SMED30021637-orf-1|Name=SMED30021637-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=600bp
MAQVNNNAESLSRELRKLKNIKSVDFRGLLSGNSESFVNLFRHLFCENNI
AFSRYIVEKGYDLSGLTDYKFMESVYKMMRDLFNIKPSINQNQFFSQGFT
QRKLEMSTLLAAHVRKLTNELISRVNKKTVQTQSLMKSSLKRPNSAPKQA
KVIELGDEHEEDYVKNRSFSINNNRSKKIKSVNKYSDKLSGLNGKSKKNS
NIKEHADDINGLSTDSEPSNPANSFNFNHTINPSLDNHQYNNDDDAIRGC
DKYHTLQAFREPIEVANVSAYESAALDHESYLRPYQNYQQYTRSDLHDQK
VYDVKQYTPRSNDENLVIKKHDNIPGLDKIMQQFDTVIARITLLESRMQR
IESKFNISYKPSFDNQSLGHTFYSGQNNQNNQQFSVPHNYHDINIVESYN
EKIPNFVRDSRTIISDFESNHQTNNNRNDSNKQYSTFGSGTSTADNLYQP
YITNQPGSIKANVEKSSLSCANSAPGSYRSSLSMDLHSSVATVPKYMSST
TNYSEKRSFDVNNLPKDNNAYRITNTSTKYTQPTQKTYNSIPPMHPIMKK
SDNSEFDENRQGKSLNFDKYDSNFQSQTDRIASLLSDTQKMLKISDEEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR033603CEP44
IPR029157CEP44_CC
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0030496midbody
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21
IPR029157Centrosomal CEP44 domainPFAMPF15007CEP44coord: 4..127
e-value: 2.4E-29
score: 102.1
IPR033603Centrosomal protein of 44kDaPANTHERPTHR31477FAMILY NOT NAMEDcoord: 4..420