SMED30021628
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30021628 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30021628 aligns in the following genomic locations:
Homology
BLAST of SMED30021628 vs. TrEMBL
Match: A0A5K4F607 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 2.131e-19 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 673 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 831 L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT GL+VIFI I+S RQYVGK Sbjct: 8 LLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGK 60
BLAST of SMED30021628 vs. TrEMBL
Match: A0A430QHZ8 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0007936 PE=4 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 2.131e-19 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 673 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 831 L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT GL+VIFI I+S RQYVGK Sbjct: 8 LLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGK 60
BLAST of SMED30021628 vs. TrEMBL
Match: A0A183P566 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS9502 PE=4 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 2.131e-19 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 673 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 831 L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT GL+VIFI I+S RQYVGK Sbjct: 8 LLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGK 60
BLAST of SMED30021628 vs. TrEMBL
Match: A0A2H1CXM3 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_00116 PE=4 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 7.212e-19 Identity = 40/53 (75.47%), Postives = 49/53 (92.45%), Query Frame = -2 Query: 673 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 831 L++ GFVFK+GRLF+TPYGGEGVDF DQLNYQFT GL++IFI I+S+RQYVG+ Sbjct: 8 LLDGGFVFKLGRLFRTPYGGEGVDFVDQLNYQFTGGLMIIFIAIISLRQYVGQ 60
BLAST of SMED30021628 vs. TrEMBL
Match: A0A448XG29 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29400 PE=4 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 1.671e-18 Identity = 52/66 (78.79%), Postives = 57/66 (86.36%), Query Frame = -2 Query: 676 GF*KMARXXXXXXGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVG 873 G KMARGAGG L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT GL+VIFI IVS+RQYVG Sbjct: 53 GIFKMARGAGG---LLDGGFVFKLGRLFKTPYGGEGVDFVDQLNYQFTGGLMVIFIAIVSLRQYVG 115
BLAST of SMED30021628 vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1) HSP 1 Score: 113.62 bits (283), Expect = 1.812e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = -2 Query: 673 MARXXXXXXGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 861 MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK Sbjct: 1 MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 63
BLAST of SMED30021628 vs. Planmine SMEST
Match: SMESG000075619.1 (SMESG000075619.1) HSP 1 Score: 71.2478 bits (173), Expect = 1.162e-13 Identity = 29/51 (56.86%), Postives = 43/51 (84.31%), Query Frame = -2 Query: 676 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVG 828 ME+G + K+G+LF T YGG +DF DQ+NYQ++SGL++IFI+I+ +RQ+VG Sbjct: 1 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYSSGLLLIFISIIGLRQFVG 51
BLAST of SMED30021628 vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1) HSP 1 Score: 72.4034 bits (176), Expect = 1.425e-13 Identity = 32/52 (61.54%), Postives = 38/52 (73.08%), Query Frame = -2 Query: 673 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 828 M +G KI R FK PYGG VDF DQLNYQFTSGL+ +F+ I+ RQY+GK Sbjct: 1 MNAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGK 52
BLAST of SMED30021628 vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1) HSP 1 Score: 70.8626 bits (172), Expect = 5.169e-13 Identity = 39/52 (75.00%), Postives = 46/52 (88.46%), Query Frame = -2 Query: 673 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 828 MESG F+IG+LF+ PYGGEGVDF DQLNYQFTSGL+++FI I+ IRQYVGK Sbjct: 1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGK 52
BLAST of SMED30021628 vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1) HSP 1 Score: 68.9366 bits (167), Expect = 2.071e-12 Identity = 30/52 (57.69%), Postives = 39/52 (75.00%), Query Frame = -2 Query: 673 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGK 828 ME+ KIG+ F T YGG +DF DQLNYQ+++GL+ IFI+I+ RQYVGK Sbjct: 1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGK 52 The following BLAST results are available for this feature:
BLAST of SMED30021628 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30021628 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30021628 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30021628 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30021628 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30021628 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021628 ID=SMED30021628|Name=SMED30021628|organism=Schmidtea mediterranea sexual|type=transcript|length=1336bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|